hUC-MSCs strongly express MSC surface markers similar to Bone Marrow Stem Cells. Under optimal growth conditions, Umbical Cord-Derived Mesenchymal Stem Cells have been shown to be multipotent, capable of differentiating down adipogenic, osteogenic and chondrogenic lineages. The harvesting procedure is non-invasive, with umbilical cords obtained from women with healthy pregnancies during caesarean deliveries at the end of gestation.
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
hUCAs-MSCs are specifically taken from umbilical cord artery tissues. Differentiation studies have shown variation between the cord regions, meaning that for some studies MSCs from specific cord regions may be of interest. The harvesting procedure is non-invasive, with umbilical cords obtained from women with healthy pregnancies during caesarean deliveries at the end of gestation.
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
hMSCs have emerged as a promising regenerative tool, owing mainly to their multi-differentiation potential and immunosuppressive capacity. MSCs of neonatal origins exhibit superior proliferation ability, lower immunogenicity, and are expected to show lower incorporated mutation. hMSCs are isolated from three neonatal tissues, namely amniotic membrane, Chorion Villi, and Decidua tissue of the human placenta from the same donor.
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
hMSCs have emerged as a promising regenerative tool, owing mainly to their multi-differentiation potential and immunosuppressive capacity. MSCs of neonatal origins exhibit superior proliferation ability, lower immunogenicity, and are expected to show lower incorporated mutation. hMSCs are isolated from three neonatal tissues, namely amniotic membrane, Chorion Villi, and Decidua tissue of the human placenta from the same donor.
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
Human Gingival fibroblasts (HGFs) are a potential source of somatic cells for genetic manipulation and tissue tissue repair and regeneration.
Gingival fibroblasts are the major constituents of gingival tissue and play a key role in their maintenance. Human gingival fibroblasts (hGFs) are undifferentiated cells with multi-differentiation and self-renewal capacities. The stem cell-like properties of GFs are largely due to the subsets of pluripotent cells including gingiva-derived mesenchymal stem cells (GMSCs) and gingival multipotent progenitor cells (GMPCs)
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
The human endometrium is a highly dynamic tissue that undergoes approximately 400 menstrual cycles during a woman's lifetime. This level of tissue regeneration is comparable to other tissues with high cellular turnover, such as epidermis, gut epithelium, and bone marrow. hEnMSCs are obtained through an endometrial biopsy, from women during a minimally invasive biopsy procedure.
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
Human dermal fibroblasts (HDFs) are a potential source of somatic cells for genetic manipulation and tissue engineering. Confirmation of cytogenetic stability of these cells is an essential step for cell nuclear transfer and generation of a suitable and functional induced pluripotent stem cells line.
Dermal fibroblasts are the main cell type present in skin connective tissue (dermis). Fibroblasts interact with epidermal cells during hair development and in interfollicular skin. Moreover, they play an essential role during cutaneous wound healing and in bioengineering of skin. Hence, culture of primary fibroblast is gaining in importance. In addition, fibroblasts established from skin biopsies provide a powerful tool for investigating normal skin physiology or specific disease states.
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
Mesenchymal stem cells, also known as marrow stromal cells, are defined as a self-renewing population of adherent, bone-marrow-derived multipotent progenitor cells with the capacity to differentiate into several mesenchymal cell lineages. Bone marrow-derived MSCs are multipotent adult stem cells with multilineage differentiation potential, including the ability to differentiate into bone (osteoblasts), tendon, cartilage (chondrocytes), fat (adipocytes), fibroblasts, endothelial cells, and smooth and cardiac muscle cells.
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
hMSCs from adipose tissue (hADSCs) hADSCs have been shown to differentiate in vitro or in vivo into adipocytes, chondrocytes, osteoblasts, myocytes, neurons, hepatocytes, and pancreatic islet cells. hADSCs are harvested from normal human adipose tissue from individual donors and are provided in a cryopreserved format. The cells are tested for their ability to differentiate in vitro into adipocytes, chondrocytes, and osteoblasts and for a verified marker expression profile that complies with ISCT recommendations, providing well characterized cells.
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
Based on IEP, the Goat anti-Rabbit IgG immunopolymer antibody reacts with heavy (γ) chains on rabbit IgG, light chains on all rabbit immunoglobulins; the Goat anti-Mouse IgG immunopolymer antibody reacts with heavy (γ) chains on mouse IgG, light chains on
Cross Reactivity:
Based on IEP, no cross-reactivity is observed from Goat-anti-Rabbit IgG to non-immunoglobulin rabbit serum proteins, serum proteins from human, mouse or rat; no cross-reactivity is observed from Goat-anti-Mouse IgG to non-immunoglobulin mouse serum proteins, serum proteins from bovine, horse, human, pig or rabbit
Country Of Origin:
Goat serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
HQ-O Ready-To-Dilute (RTD TM ) Stain Reagent is designed to label amyloid plaques in paraffin-embedded or freshly cut frozen tissue sections. As a fluorescent zinc chelator, HQ-O is unique as it takes advantage of the known presence of concentrated zinc in amyloid plaques. Studies with HQ-O revealed that fluorescent plaque-like structures are only seen when synthetic A?x-42 is aggregated in the presence of zinc. Under blue light excitation, plaque structures appear bright green fluorescent in the brain parenchyma, correlating closely with plaque structures observed following A? antibody staining. HQ-O RTD TM staining reagent is compatible with other fluorophores, such as DAPI, Hoechst and ethidium bromide, as well as fluorescent-labelled antibodies with emission spectra in the blue and/or red emission range of fluorescent microscopes. Due to its zinc-chelating characteristics, HQ-O RTD TM staining reagent may visualize globular structures within blood vessels and intravascular leucocytes. HQ-O RTD TM staining reagent has multiple advantages over older blue-light exciting stains such as Thioflavin S. Thioflavin S typically exhibits relatively low contrast and resolution and suffers from bleed-through when excited by wavelengths other than blue light. HQ-O RTD TM staining reagent suffers none of these setbacks and not only provides a higher contrast and longer lasting dye, but because it lacks excitation bleed-through, HQ-O can be readily adapted to multiple labelling studies very easily. To visualize the HQ-O tracer, it is recommended to use a filter cube designed for visualizing Fluorescein/FITC or a blue-light laser. Although it can be seen with both narrow and wide-band pass filters, there is no need to use a narrow band filter since the compound does not bleed through when excited with other filters. A recommended excitation range of a wide band filter is 447-503 nm, with a peak at 475.
Background Info:
A novel zinc chelator, HQ-O, was developed for localizing zinc within amyloid plaques. The histology involves incubating tissue sections in a dilute aqueous solution of HQ-O.
Detection and fluorescent-staining of amyloid plaques in paraffin-embedded or freshly cut frozen tissue sections, please see detailed protocol for specific use instructions.
Alternative Names:
HQ-O tracer
Biosensis Brand:
Biosensis® RTD
Detection Method:
Fluorescence
Excitation/Emission:
To visualize the HQ-O tracer, it is recommended to use a filter cube designed for visualizing Fluorescein/FITC or a blue-light laser. Although it can be seen with both narrow and wide-band pass filters, there is no need to use a narrow band filter since the compound does not bleed through when excited with other filters. A recommended excitation range of a wide band filter is 447 503 nm, with a peak at 475 nm.
Shelf Life:
6 months after date of receipt (10X stock solution)
Use:
For research use only.
Kit Components:
One bottle containing 40 mL of 10X HQ-O RTD TM solution This quantity will be sufficient for approximately 8 Coplin Jars or 2-4 staining dishes.
Specificity:
As a fluorescent zinc chelator, HQ-O is unique as it takes advantage of the known presence of concentrated zinc in amyloid plaques. Studies with HQ-O revealed that fluorescent plaque-like structures are only seen when synthetic A?x-42 is aggregated in the presence of zinc. Under blue light excitation, plaque structures appear bright green fluorescent in the brain parenchyma, correlating closely with plaque structures observed following A? antibody staining.
Storage:
Store 10X stock solution at 2-8°C protected from light, for up to 6 months. The diluted dye (1X) should be used within 24 hours.
The Biosensis AG-400-AG kit utilizes an ethidium bromide counter stain for a quick and effective way to visualize cell nuclei and cell bodies of cells while under UV illumination allowing the assessment of amyloid plaques and cell/tissue positioning as well in one step. Amylo-Glo RTD Ready to Dilute Staining reagent is designed to stain amyloid plaques in tissue sections. This novel marker has several advantages over other conventional markers such as Thioflavin S and Congo Red because of its unique chemical and spectral properties. (L. Schmued et al. (2012) J.Neuroscience Methods 209:120- 126). Using Amylo-Glo results in a very bright blue UV excitable stain under physiological conditions that will not bleed through when illuminated with other filters. Its brightness makes it ideal for low magnification quantification studies, while its unique excitation/emission profile and mild staining conditions makes it ideal for combination for multiple immunofluorescent labeling studies. Amylo-Glo RTD is compatible with fresh, frozen, and formalin-fixed immunohistochemistry or cytochemistry, and it is particularly good for confocal and multiple labeling because of its high fluorescent intensity and high resistance to photo-bleaching. Moreover because Amylo-Glo fluoresces in the UV channel, double and triple labeling experiments can be performed very easily (see protocol).
Product Type:
Staining Reagent
Format:
The reagents in the Amyloid Plaque Stain Reagent (100x) are all supplied in a liquid format and are ready-to-dilute.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Application Details:
Staining of amyloid plaques in human and animal tissues, see included protocol. EtBr counter stain stains nuclei and cell bodies for easy identification and spacial orientation.
Alternative Names:
AmyloGlo
Biosensis Brand:
Biosensis® RTD
Detection Method:
Fluorescence
Excitation/Emission:
Excitation Peak: 334 nm; Emission Peak: 533 nm - unbound, 438 nm when bound to amyloid. To visualize Amylo-glo in tissue, UV light is required. For example, Amylo-Glo tissue can be examined using an epifluoresent microscope with UV (Nikon UV-2A) filter cube. Excitation (325-375 nm) Emission (400-450 nm) is typical. Also note, it is not uncommon for Amylo-Glo to appear light yellow when examined by eye, yet appear a light blue color when photographed. <br>Visualization of EtBr: Ethidium bromide has an excitation peak of 300 nm and an emission peak 595 nm. Most UV compatible filter sets can be used.
Shelf Life:
6 months after date of receipt (unopened vial).
Use:
For research use only.
Kit Components:
1 bottle containing 40 mL of 10X Amylo-Glo RTD (A-G RTD) solution 1 bottle containing 40 mL of 10X A-G RTD Ethidium Bromide (EtBr RTD) solution
Product references:
Su IJ et al. (2021) "The Beneficial Effects of Combining Anti-A? Antibody NP106 and Curcumin Analog TML-6 on the Treatment of Alzheimer's Disease in APP/PS1 Mice." Int J Mol Sci. 23(1):556; Application: IHC/IF Species: Mouse Emre C et al. (2020) "Receptors for pro-resolving mediators are increased in Alzheimer's disease brain." Brain Pathol. [Epub ahead of print]; Application: IHC/IF Species: Human Hascup KN et al. (2019) "LY379268 Does Not Have Long-Term Procognitive Effects nor Attenuate Glutamatergic Signaling in A?PP/PS1 Mice." J Alzheimers Dis. [Epub ahead of print]; Application: IHC/IF Species: Mouse Hascup ER et al. (2018) "Diet-Induced Insulin Resistance Elevates Hippocampal Glutamate as well as VGLUT1 and GFAP Expression in A?PP/PS1 Mice." J Neurochem. [Epub ahead of print]; Application: IHC/IF Species: Mouse
Specificity:
Amyloid plaques both intraneuronal and vascular for A-G, Etbr, nuclei and cell bodies both DNA and RNA label
Storage:
The stock solution can be stored for up to 6 months at 2-8°C protected from light. No preservatives. Use sterile technique when handling and proper laboratory procedures.
Purification:
Thin layer chromatography using alumina plates and a solvent system of ethanol and water (3:1) revealed the presence of two fluorescent isomers. No amount of starting material was detected.
Amylo-Glo RTD Ready to Dilute Staining reagent is designed to stain amyloid plaques in tissue sections. This novel marker has several advantages over other conventional markers such as Thioflavin S and Congo Red because of its unique chemical and spectral properties. (L. Schmued et al. (2012) J.Neuroscience Methods 209:120- 126). Using Amylo-Glo results in a very bright blue UV excitable stain under physiological conditions that will not bleed through when illuminated with other filters. Its brightness makes it ideal for low magnification quantification studies, while its unique excitation/emission profile and mild staining conditions makes it ideal for combination for multiple immunofluorescent labeling studies. Amylo-Glo RTD is compatible with fresh, frozen, and formalin-fixed immunohistochemistry or cytochemistry, and it is particularly good for confocal and multiple labeling because of its high fluorescent intensity and high resistance to photo-bleaching. Moreover because Amylo-Glo fluoresces in the UV channel, double and triple labeling experiments can be performed very easily (see protocol).
Product Type:
Staining Reagent
Format:
The reagents in the Amyloid Plaque Stain Reagent (100x) are all supplied in a liquid format and are ready-to-dilute.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Application Details:
Staining of amyloid plaques in human and animal tissues, see included protocol
Alternative Names:
AmyloGlo
Biosensis Brand:
Biosensis® RTD
Detection Method:
Fluorescence
Excitation/Emission:
Excitation Peak: 334 nm; Emission Peak: 533 nm - unbound, 438 nm when bound to amyloid. To visualize Amylo-glo in tissue, UV light is required. For example, Amylo-Glo tissue can be examined using an epifluoresent microscope with UV (Nikon UV-2A) filter cube. Excitation (325-375 nm) Emission (400-450 nm) is typical. Also note, it is not uncommon for Amylo-Glo to appear light yellow when examined by eye, yet appear a light blue color when photographed.
Shelf Life:
6 months after date of receipt (unopened vial).
Use:
For research use only.
Kit Components:
5 mL of 100X Amylo-Glo RTD (A-G RTD) solution
Product references:
Silvin A et al. (2022) "Dual ontogeny of disease-associated microglia and disease inflammatory macrophages in aging and neurodegeneration" Immunity. [Epub ahead of print]; Application: IHC/IF Species: Mouse Shrader JM et al. (2022) "Distinct Brain Proteomic Signatures in Cerebral Small Vessel Disease Rat Models of Hypertension and Cerebral Amyloid Angiopathy" J Neuropathol Exp Neurol. [Epub ahead of print]; Application: IHC/IF Species: Rat Zagorski K et al. (2022) "Immunogenicity of MultiTEP-Platform-Based Recombinant Protein Vaccine, PV-1950R, Targeting Three B-Cell Antigenic Determinants of Pathological ?-Synuclein" Int J Mol Sci. [Epub ahead of print]; Application: IHC/IF Species: Mouse Shabestari SK et al. (2022) "Absence of microglia promotes diverse pathologies and early lethality in Alzheimers disease mice" Cell Rep. 39(11):110961; Application: IHC/IF Species: Mouse Davis J et al. (2022) "rTg-D: A novel transgenic rat model of cerebral amyloid angiopathy Type-2." Cerebral Circulation - Cognition and Behavior [Epub ahead of print]; Application: IHC/IF Species: Rat Salvadores N et al. (2022) "A? oligomers trigger necroptosis-mediated neurodegeneration via microglia activation in Alzheimer's disease." Acta Neuropathol Commun. 10(1):31; Application: IHC/IF Species: Human Javonillo DI et al. (2022) "Systematic Phenotyping and Characterization of the 3xTg-AD Mouse Model of Alzheimer's Disease." Front Neurosci. 15:785276; Application: IHC/IF Species: Mouse Hohsfield LA et al. (2022) "MAC2 is a long-lasting marker of peripheral cell infiltrates into the mouse CNS after bone marrow transplantation and coronavirus infection." Glia. [Epub ahead of print]; Application: IHC/IF Species: Mouse Tsay HJ et al. (2021) "EK100 and Antrodin C Improve Brain Amyloid Pathology in APP/PS1 Transgenic Mice by Promoting Microglial and Perivascular Clearance Pathways." Int J Mol Sci. 22(19):10413; Application: IHC/IF Species: Mouse Henningfield CM et al. (2021) "Microglia-specific ApoE knock-out does not alter Alzheimer's disease plaque pathogenesis or gene expression." Glia. [Epub ahead of print]; Application: IHC/IF Species: Mouse Da Mesquita S et al. (2021) "Meningeal lymphatics affect microglia responses and anti-A? immunotherapy." Nature. 593(7858):255-260; Application: IHC/IF Species: Mouse Lauterborn JC et al. (2021) "Increased excitatory to inhibitory synaptic ratio in parietal cortex samples from individuals with Alzheimer's disease. Nat Commun. 12(1):2603; Application: IHC/IF Species: Human Kim JH et al. (2021) "Gamma subunit of complement component 8 is a neuroinflammation inhibitor." Brain. 144(2):528-552; Application: IHC/IF Species: Mouse Claes C et al. (2021) "Plaque-associated human microglia accumulate lipid droplets in a chimeric model of Alzheimer's disease." Mol Neurodegener. 16(1):50; Application: IHC/IF Species: Mouse Crapser JD. (2021) "Investigating microglial regulation of the extracellular matrix in health and neurodegenerative disease." PhD Thesis ; Application: IHC/IF Species: Human Baglietto-Vargas D et al. (2021) "Generation of a humanized A? expressing mouse demonstrating aspects of Alzheimer's disease-like pathology." Nature Communications. 2(1):2421; Application: IHC/IF Species: Mouse Mistrik M et al. (2021) "Microthermal-induced subcellular-targeted protein damage in cells on plasmonic nanosilver-modified surfaces evokes a two-phase HSP-p97/VCP response." Nature Communications. 12, Article Number 719; Application: ICC/IF Species: Human Lemoine L et al. (2020) "Regional binding of tau and amyloid PET tracers in Down syndrome autopsy brain tissue." Mol Neurodegener. 15(1):68; Application: IHC/IF Species: Human Hascup KN et al. (2020) "Riluzole attenuates glutamatergic tone and cognitive decline in A?PP/PS1 mice." J Neurochem. [Epub ahead of print]; Application: IHC/IF Species: Mouse Holloway OG et al. (2020) "Microglia Demonstrate Local Mixed Inflammation and a Defined Morphological Shift in an APP/PS1 Mouse Model. J Alzheimers Dis. 77(4):1765-81; Application: IHC/IF Species: Mouse McQuade A et al. (2020) "Gene expression and functional deficits underlie TREM2-knockout microglia responses in human models of Alzheimer s disease. Nat Commun. 11(1):5370; Application: IHC/IF Species: Mouse Hascup KN et al. (2020) "Hippocampal alterations in glutamatergic signaling during amyloid progression in A?PP/PS1 mice." Sci Rep. 10(1):14503; Application: IHC/IF Species: Mouse Crapser JD et al. (2020) "Microglia facilitate loss of perineuronal nets in the Alzheimer's disease brain." EBioMedicine. 58:102919; Application: IHC/IF Species: Mouse Abe Y et al. (2020) "Behavioral and electrophysiological evidence for a neuroprotective role of aquaporin-4 in the 5xFAD transgenic mice model." Acta Neuropathol Commun. 8(1):67; Application: IHC/IF Species: Mouse Zhu X et al. (2020) "Robust neuroinflammation and perivascular pathology in rTg-DI rats, a novel model of microvascular cerebral amyloid angiopathy." J Neuroinflammation. 17(1):78; Application: IHC/IF Species: Rat Majewski L et al. (2020) "Transgenic Mice Overexpressing Human STIM2 and ORAI1 in Neurons Exhibit Changes in Behavior and Calcium Homeostasis but Show No Signs of Neurodegeneration." Int J Mol Sci. 21(3); Application: IHC/IF Species: Mouse Davtyan H et al. (2019) "Testing a MultiTEP-based combination vaccine to reduce A? and tau pathology in Tau22/5xFAD bigenic mice." Alzheimers Res Ther. 11(1):107; Application: IHC/IF Species: Mouse Yeh SHH et al. (2019) "A high-sucrose diet aggravates Alzheimer's disease pathology, attenuates hypothalamic leptin signaling, and impairs food-anticipatory activity in APPswe/PS1dE9 mice." Neurbiol. Aging. [In press]; Application: IHC/IF Species: Mouse Bharani KL et al. (2019) "Serum Pro-Bdnf Levels Correlate With Phospho-Tau Staining In Alzheimer's Disease." Neurbiol. Aging. [In press]; Application: IHC/IF Species: Human Hovakimyan A et al. (2019) "A MultiTEP platform-based epitope vaccine targeting the phosphatase activating domain (PAD) of tau: therapeutic efficacy in PS19 mice." Sci Rep. 9(1):15455; Application: IHC/IF Species: Human Hasselmann J et al. (2019) "Development of a Chimeric Model to Study and Manipulate Human Microglia In Vivo." Neuron. [Epub ahead of print]; Application: IHC/IF Species: Mouse Spangenberg E et al. (2019) "Sustained microglial depletion with CSF1R inhibitor impairs parenchymal plaque development in an Alzheimer's disease model." Nat Commun. 10(1):3758 (Supplementary Figure 1); Application: IHC/IF Species: Human Eggers C et al. (2019) "Novel cannabis flavonoid, cannflavin A displays both a hormetic and neuroprotective profile against amyloid _-mediated neurotoxicity in PC12 cells: comparison with geranylated flavonoids, mimulone and diplacone." Biochem Pharmacol. [Epub ahead of print]; Application: IHC/IF Species: Rat Dominguez E (2019) "Microglial Contributions to Alzheimer's Disease Pathogenesis." PhD Thesis, UC Irvine. Application: IHC/IF Species: Mouse Jovic M et al. (2019) "Short-term fish oil supplementation applied in presymptomatic stage of Alzheimer's disease enhances microglial/macrophage barrier and prevents neuritic dystrophy in parietal cortex of 5xFAD mouse model." PLoS One. 14(5):e0216726; Application: IHC/IF Species: Mouse Collins MJ et al. (2019) "Age moderates the effects of traumatic brain injury on beta-amyloid plaque load in APP/PS1 mice." J Neurotrauma. [Epub ahead of print]; Application: IHC/IF Species: Mouse Shukla AK et al. (2018) "CD11a expression distinguishes infiltrating myeloid cells from plaque-associated microglia in Alzheimer's disease." Glia. [Epub ahead of print]; Application: IHC/IF Species: Mouse Feng X et al. (2018) "Quantitative proteomics reveals distinct composition of amyloid plaques in Alzheimer's disease." Alzheimers Dement. [In press]; Application: IHC/IF Species: Human, mouse Davis J et al. (2018) "A Novel Transgenic Rat Model of Robust Cerebral Microvascular Amyloid with Prominent Vasculopathy." Am J Pathol. [Epub ahead of print]; Application: IHC/IF Species: Rat Palombo F et al. (2017) "Detection of A? plaque-associated astrogliosis in Alzheimer's disease brain by spectroscopic imaging and immunohistochemistry." Analyst. [Epub ahead of print]; Application: IF Species: Mouse Abud EM (2017) "Generation of Human Microglia from Induced Pluripotent Stem Cells to Study Innate Immunity in Neurological Diseases." PhD Thesis. 2017; Application: IF Species: Mouse Abud EM et al. (2017) "iPSC-Derived Human Microglia-like Cells to Study Neurological Diseases." Neuron. 2017; 49(2):278-93 Application: IF Species: Mouse Solomon IH et al. (2017) "Brain and liver pathology, amyloid deposition, and interferon responses among older HIV-positive patients in the late HAART era." BMC Infect Dis. 2017; 17(1):151 Application: IF Species: Human Xu F et al. (2016) "Cerebral vascular amyloid seeds drive amyloid _-protein fibril assembly with a distinct anti-parallel structure." Nat Commun. 2016; 7:13527. Application: IF Species: Mouse Katsouri L et al. (2016) "PPARγ-coactivator-1_ gene transfer reduces neuronal loss and amyloid-_ generation by reducing _-secretase in an Alzheimer's disease model ." Proc Natl Acad Sci USA. 2016; 113(43):12292-97. Application: IF Species: Mouse Esposito G et al. (2016) "Autologous transplantation of intestine-isolated glia cells improves neuropathology and restores cognitive deficits in _ amyloid-induced neurodegeneration." Sci Rep. 2016; 6: 22605. Application: IF Species: Rat Marsh SE et al. (2016) "The adaptive immune system restrains Alzheimer's disease pathogenesis by modulating microglial function." Proc Natl Sci USA. Feb 16. pii: 201525466. Application: IF Species: Hu Fibrillar amyloid visualization. Kim YH et al. (2015) "A 3D human neural cell culture system for modeling Alzheimer's disease." Nat Protoc. Jul;10(7):985-1006. Application: IF Species: Hu , Human neural stem-cell-derived three-dimensional (3D) culture system. Nijholt DA et al. (2015) "Pregnancy Zone Protein is Increased in the Alzheimer's Disease Brain and Associates with Senile Plaques." J Alzheimer's Disease. 46(1):227-38. Application: IF Species: Hu Kamphuis W et al. (2015) "GFAP and vimentin deficiency alters gene expression in astrocytes and microglia in wild-type mice and changes the transcriptional response of reactive glia in mouse model for Alzheimer's disease." Glia. Jun;63(6):1036-56. Application: IF Species: Mouse Choi SH et al. (2014) "A three-dimensional human neural cell culture model of Alzheimer's disease." Nature Oct 12. doi: 10.1038/nature1380. Application: IF Species: Hu , Human neural stem-cell-derived three-dimensional (3D) culture system. Niedowicz DM et al. (2014). "Obesity and diabetes cause cognitive dysfunction in the absence of accelerated beta-amyloid deposition in a novel murine model of mixed or vascular dementia." Acta Neuropathol Commun. 2014 Jun 10;2:64.
Specificity:
Amyloid plaques both intraneuronal and vascular
Storage:
The stock solution can be stored for up to 6 months after date of receipt at 2-8°C protected from light. No preservatives. Use sterile technique when handling and proper laboratory procedures.
Purification:
Thin layer chromatography using alumina plates and a solvent system of ethanol and water (3:1) revealed the presence of two fluorescent isomers. No amount of starting material was detected.
The causes and effects of neuronal degeneration are of major interest to a wide variety of neuroscientists. Paralleling this growing interest is an increasing number of methods applicable to the detection of neuronal degeneration. Fluoro-Jade C stains all degenerating neurons regardless of specific insult or mechanism of cell death. Fluoro-Jade C exhibits the greatest signal to background ratio, as well as the highest resolution. This translates to a stain of maximal contrast and affinity for degenerating neurons. This makes it ideal for localising not only degenerating nerve cell bodies but also distal dendrites, axons and terminals. The dye is highly resistant to fading and is compatible with virtually all histological processing and staining protocols. Note: This product is equivalent to discontinued product AG325 from Merck-Millipore.
Product Type:
Staining Reagent
Format:
Dry, Coffee brown to brick red powder; hygroscopic powder keep dessicated.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
FC,ICC
Application Details:
Following our detailed protocol, Fluoro-Jade B labels degenerating neurons which are visualised with blue light excitation, while DAPI (not included) counter stains cell nuclei, visualised with ultra-violet illumination. The Fluoro-Jade C dye can be used on all kinds of preserved tissues, including fresh-frozen, paraformaldehyde or formalin fixed, and formalin fixed, paraffin-embedded tissues.
Alternative Names:
FJC, Fluoro-Jade
Biosensis Brand:
Biosensis®
Detection Method:
Fluorescence
Excitation/Emission:
FJC visualization is accomplished using blue light or a 488 nm Laser. <br>Excitation Peak: 495 nm<br>Emission Peak: 521 nm<br>Filter system for visualizing: Fluorescein/FITC
Shelf Life:
6 months after date of receipt (unopened vial).
Use:
For research use only.
Kit Components:
Materials Provided: 30 mg Fluoro-Jade C, dry powder Detailed protocol Equipment and Reagents Required: Distilled water ACS grade Ethanol (200 proof) for slide & solution preparation 1% sodium hydroxide in 80% ethanol (basic alcohol solution) 0.1% Acetic Acid solution (in water) 70% ethanol in distilled water 0.06% (KMnO4) potassium permanganate solution DAPI powder or 100X solution (working range is 0.5-5 µg/mL) Xylene liquid Staining dishes/Coplin jars Cover slips DPX mounting media or another permanent mounting medium. Non-polar media are preferred over aqueous mounting media such as glycerin/water to obtain high- contrast images (refer to Appendix B in the protocol for a comparative analysis). Traditional fluorescent mounting mediums are not recommended because of their high pH. Slide warmer Convection oven
Specificity:
Degenerating neurons, and neuronal degeneration. There is no specific staining in normal healthy brain. Note: Some researchers under some conditions report blood vessel staining with Fluoro Jade. This may be because Fluoro Jade is an analogue of eosin (which stains blood cells). In general, good perfusion and preparation of the tissue should help prevent blood vessel staining but it may not be possible to eliminate it entirely. In our experience it is generally possible to distinguish neuronal from blood vessels staining by eye.
Storage:
The powdered dye can be stored desiccated at room temperature in the dark. Storage in a desiccator is recommended as FJB is hydroscopic. The 0.01% stock solution will remain stable for 3 months when stored in a refrigerator, in the dark. The 0.0001-0.0004% working solution in 0.1% acetic acid should be used within 4 hours of preparation. Diluted FJB dye solutions are not stable and should not be stored. The other diluted solutions can be reused and stored for up to 48 hours if refrigerated and protected from light. Best results require freshly diluted solutions.
Purification:
Silica TLC (acetanitrile/water, 6/4) revealed the presence of 2 fluorescent spots, presumably corresponding to the mono and di sulphate homologues. The presence of precursors or free fluorescein was not detected.
The causes and effects of neuronal degeneration are of major interest to a wide variety of neuroscientists. Paralleling this growing interest is an increasing number of methods applicable to the detection of neuronal degeneration. The fluorescent dye Fluoro-Jade B (FJB), like its more purified brother Fluoro-Jade C (FJC), is an anionic fluorescein derivative useful for the histological staining of neurons undergoing degeneration. Fluoro-Jade B differs from FJC in that it is a slightly less refined chemical formulation and thus it does not quite provide the same level of signal to noise or high resolution as FJC. Nonetheless FJB is still widely used and works very well as a marker of degenerating neurons and even glia (see Damjanac M et al., Brain Res. 2007;1128(1):40-9). FJB operates nearly identically in protocol to that of FJC, and Fluoro-Jade B is compatible with several other labeling procedures including immunofluorescent and fluorescent Nissl techniques. Fluoro-Jade B stains all degenerating neurons regardless of specific insult or mechanism of cell death. Fluoro-Jade B exhibits the greatest signal to background ratio, as well as the highest resolution. This translates to a stain of maximal contrast and affinity for degenerating neurons. This makes it ideal for localising not only degenerating nerve cell bodies but also distal dendrites, axons and terminals. The dye is highly resistant to fading and is compatible with virtually all histological processing and staining protocols. Note: This product is equivalent to discontinued product AG310 from Merck-Millipore.
Product Type:
Staining Reagent
Format:
Dry, Coffee brown to brick red powder; hygroscopic powder keep dessicated.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
FC,ICC
Application Details:
Following our detailed protocol, Fluoro-Jade C labels degenerating neurons which are visualised with blue light excitation, while DAPI (not included) counter stains cell nuclei, visualised with ultra-violet illumination. The Fluoro-Jade C dye can be used on all kinds of preserved tissues, including fresh-frozen, paraformaldehyde or formalin fixed, and formalin fixed, paraffin-embedded tissues.
Alternative Names:
FJB, Fluoro-Jade
Biosensis Brand:
Biosensis®
Detection Method:
Fluorescence
Excitation/Emission:
FJB visualization is accomplished using blue light or a 488 nm Laser. <br>Excitation Peak: 495 nm<br>Emission Peak: 521 nm<br>Filter system for visualizing: Fluorescein/FITC
Shelf Life:
6 months after date of receipt (unopened vial).
Use:
For research use only.
Kit Components:
Materials Provided: 30 mg Fluoro-Jade B, dry powder Detailed protocol Equipment and Reagents Required: Distilled water ACS grade Ethanol (200 proof) for slide & solution preparation 1% sodium hydroxide in 80% ethanol (basic alcohol solution) 0.1% Acetic Acid solution (in water) 70% ethanol in distilled water 0.06% (KMnO4) potassium permanganate solution DAPI powder or 100X solution (working range is 0.5-5 µg/mL) Xylene liquid Staining dishes/Coplin jars Cover slips DPX mounting media or another permanent mounting medium. Non-polar media are preferred over aqueous mounting media such as glycerin/water to obtain high- contrast images (refer to Appendix B in the protocol for a comparative analysis). Traditional fluorescent mounting mediums are not recommended because of their high pH. Slide warmer Convection oven
Product references:
Ikeda A et al. (2022) "Alteration of the neuronal and glial cell profiles in Neu1-deficient zebrafish" Glycoconj ; [Epub ahead of print]; Application: ICC/FC Species: Zebrafish
Choi I et al. (2022) "Interleukin-17A Mediates Hippocampal Damage and Aberrant Neurogenesis Contributing to Epilepsy-Associated Anxiety" Front. Mol. Neurosci. ; [Epub ahead of print]; Application: ICC/FC Species: Mouse
Cui Y et al. (2022) "Modified Citrus Pectin Alleviates Cerebral Ischemia/Reperfusion Injury by Inhibiting NLRP Inflammasome Activation via TLR4/NF-?B Signaling Pathway in Microglia" J Inflamm. Res. ; 15: 3369-3385; Application: ICC/FC Species: Mouse
Specificity:
Degenerating neurons, and neuronal degeneration. There is no specific staining in normal healthy brain. Note: Some researchers under some conditions report blood vessel staining with Fluoro Jade. This may be because Fluoro Jade is an analogue of eosin (which stains blood cells). In general, good perfusion and preparation of the tissue should help prevent blood vessel staining but it may not be possible to eliminate it entirely. In our experience it is generally possible to distinguish neuronal from blood vessels staining by eye.
Storage:
The powdered dye can be stored desiccated at room temperature in the dark. Storage in a desiccator is recommended as FJB is hydroscopic. The 0.01% stock solution will remain stable for 3 months when stored in a refrigerator, in the dark. The 0.0001-0.0004% working solution in 0.1% acetic acid should be used within 4 hours of preparation. Diluted FJB dye solutions are not stable and should not be stored. The other diluted solutions can be reused and stored for up to 48 hours if refrigerated and protected from light. Best results require freshly diluted solutions.
Purification:
Thin layer chromatograpy using cellulose plates and a solvent system of n-propinol, water, and ammonium hydroxide (6:5:2) revealed the presence of two fluorescent isomers and two trace non-fluorescent bands. No amount of fluorescein or Fluoro-Jade was present.
The causes and effects of neuronal degeneration are of major interest to a wide variety of neuroscientists. Paralleling this growing interest is an increasing number of methods applicable to the detection of neuronal degeneration. Fluoro-Jade C stains all degenerating neurons regardless of specific insult or mechanism of cell death. Fluoro-Jade C exhibits the greatest signal to background ratio, as well as the highest resolution. This translates to a stain of maximal contrast and affinity for degenerating neurons. This makes it ideal for localising not only degenerating nerve cell bodies but also distal dendrites, axons and terminals. The dye is highly resistant to fading and is compatible with virtually all histological processing and staining protocols.
Product Type:
Staining Reagent
Format:
The reagents in the Fluoro Jade kit (10X) are all supplied in a liquid format and are ready-to-dilute.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
FC,ICC,IHC-Frozen,IHC-Paraffin-embedded
Application Details:
The Fluoro-Jade C 'Ready to Dilute' (RTD) Staining Kit provides an easy to use assortment of Fluoro-Jade C, DAPI, sodium hydroxide and potassium permanganate in liquid form. Following our detailed protocol, Fluoro-Jade C labelled degenerating neurons are visualised with blue light excitation while DAPI counter stained cell nuclei are visualised with ultra-violet illumination. The Fluoro-Jade C Staining Kit can be used on all kinds of preserved tissues, including fresh-frozen, paraformaldehyde or formalin fixed, and formalin fixed, paraffin-embedded tissues.
Alternative Names:
FJC
Biosensis Brand:
Biosensis® RTD
Detection Method:
Fluorescence
Excitation/Emission:
FJC visualization is accomplished using blue light or a 488 nm Laser. Excitation Peak: 495 nm Emission Peak: 521 nm Filter system for visualizing: Fluorescein/FITC
Shelf Life:
Unopened kit 6 months at 2-8ºC protected from light. See Storage instructions for working solutions recommendations.
Use:
For research use only.
Kit Components:
Materials provided: Sodium Hydroxide, Solution A (Dilute 1:10 prior to use) - 20 mL Potassium Permanganate, Solution B (Dilute 1:10 prior to use) - 20 mL Fluoro-Jade C, Solution C (Dilute 1:10 prior to use) - 20 mL DAPI, Solution D (Add to diluted Fluoro-Jade C) - 20 mL Equipment and Reagents required: Gelatin coated microscope slides Staining dishes/Coplin jars Cover slips DPX mounting media Slide warmer Convection oven Distilled water Ethanol Xylene Number of slides processed: The actual number of slides processed by this kit will depend largely upon the vessel that is used to incubate the slides. If using a standard Coplin Jar, its capacity is 50 mL and typically holds 5 slides per jar. If using such a device, then 80-100 slides stained per 50 ml of working solution (or, 5 ml of stock solution) could be processed in one day. Note the diluted dye is NOT stable and will not store overnight. It is best to use freshly diluted dye each time an experimental batch is started. Final working concentrations of FJC: 0.0001% Final working concentration of KMnO4: 0.06%
Product references:
Total Number of References: 153 Latest Publications (2020-2022):
Li L et al. (2022) "A selective degeneration of cholinergic neurons mediated by NRADD in an Alzheimer's disease mouse model" Cell Insight. [Epub ahead of print] . Application: IF. Species: Mouse. Karino K et al. (2022) "Inhibitor of nuclear factor kappa-B kinase epsilon contributes to neuropsychiatric manifestations in lupus-prone mice through microglial activation" Arthritis Rheumatol. [Epub ahead of print] . Application: IF. Species: Mouse. Chen J et al. (2022) "Flufenamic acid improves survival and neurologic outcome after successful cardiopulmonary resuscitation in mice" J Neuroinflammation. 19(1):214 . Application: IF. Species: Mouse. Zou Y et al. (2022) "Learning and memory impairment and transcriptomic profile in hippocampus of offspring after maternal fructose exposure during gestation and lactation" Food Chem Toxicol. [Epub ahead of print] . Application: IF. Species: Rat. Jin P et al. (2022) "Aprepitant attenuates NLRC4-dependent neuronal pyroptosis via NK1R/PKC? pathway in a mouse model of intracerebral hemorrhage" J Neuroinflammation. 19(10):198 . Application: IF. Species: Mouse. Koike-Kumagai M et al. (2022) "Sirolimus relieves seizures and neuropsychiatric symptoms via changes of microglial polarity in tuberous sclerosis complex model mice" Neuropharmacology. [Epub ahead of print] . Application: IF. Species: Mouse. Wang D et al. (2022) "Mesenchymal stromal cell treatment attenuates repetitive mild traumatic brain injury-induced persistent cognitive deficits via suppressing ferroptosis" Neuroinflammation. 19(1):185 . Application: IF. Species: Mouse. Seo Y et al. (2022) "Mesenchymal stem cells target microglia via galectin-1 production to rescue aged mice from olfactory dysfunction" Biomed Pharmacother. 153:113347 . Application: IF. Species: Mouse. Duan R et al. (2022) "Recurrent de novo single point variant on the gene encoding Na+/K+ pump results in epilepsy" Prog Neurobiol. 216:102310 . Application: IF. Species: Mouse. Liu P et al. (2022) "Suppression of phosphodiesterase IV enzyme by Roflumilast ameliorates cognitive dysfunction in aged rats after sevoflurane anesthesia via PKA-CREB and MEK/ERK pathways" Eur J Neurosci. [Epub ahead of print] . Application: IF. Species: Rat. Boucher ML et al. (2022) "Titrating the Translational Relevance of a Low-Level Repetitive Head Impact Model" Front Neurol. 13:857654 . Application: IF. Species: Mouse. Qian L et al. (2022) "Interleukin-35 attenuates blood-brain barrier dysfunction caused by cerebral ischemia-reperfusion injury through inhibiting brain endothelial cell injury" Ann Transl Med. 10.21037 . Application: IF. Species: Mouse. Buentello DC et al. (2022) "Use of standard U-bottom and V-bottom well plates to generate neuroepithelial embryoid bodies" PLoS One. 17(5): e0262062 . Application: IF. Species: Human. Jin P et al. (2022) "Activation of LRP6 with HLY78 Attenuates Oxidative Stress and Neuronal Apoptosis via GSK3?/Sirt1/PGC-1? Pathway after ICH" Oxid Med Cell Longev. 2022: 7542468 . Application: IF. Species: Mouse. Wang J et al. (2022) "Irisin protects against sepsis-associated encephalopathy by suppressing ferroptosis via activation of the Nrf2/GPX4 signal axis" Free Radic Biol Med. [Epub ahead of print] . Application: IF. Species: Mouse. Tang T et al. (2022) "Ginkgetin Promotes M2 Polarization of Microglia and Exert Neuroprotection in Ischemic Stroke via Modulation of PPAR? Pathway" Neurochem Res. [Epub ahead of print] . Application: IF. Species: Rat. Zhang Z et al. (2022) "Inhibiting Microglia-Derived NLRP3 Alleviates Subependymal Edema and Cognitive Dysfunction in Posthemorrhagic Hydrocephalus after Intracerebral Hemorrhage via AMPK/Beclin-1 Pathway" Oxid. Med. Cell. Longev. [Epub ahead of print] . Application: IF. Species: Rat. Ren R et al. (2022) "Kynurenine/Aryl Hydrocarbon Receptor Modulates Mitochondria-Mediated Oxidative Stress and Neuronal Apoptosis in Experimental Intracerebral Hemorrhage" Antioxid Redox Signal. [Epub ahead of print] . Application: IF. Species: Mouse. Deforzh E et al. (2022) "Promoter and enhancer RNAs regulate chromatin reorganization and activation of miR-10b/HOXD locus, and neoplastic transformation in glioma" Mol Cell. [Epub ahead of print] . Application: IF. Species: Human, Mouse. Chen X et al. (2022) "Mechanism of Baicalein in Brain Injury After Intracerebral Hemorrhage by Inhibiting the ROS/NLRP3 Inflammasome Pathway" Inflammation. 45(2):590-602 . Application: IF. Species: Rat. Komatsu A et al. (2022) "Ammonia induces amyloidogenesis in astrocytes by promoting amyloid precursor protein translocation into the endoplasmic reticulum" J Bio; Chem. [Epub ahead of print] . Application: IF. Species: Mouse. Jin P et al. (2022) "Activation of LRP6 with HLY78 Attenuates Oxidative Stress and Neuronal Apoptosis via GSK3 ?/Sirt1/PGC-1 ? Pathway after ICH" Oxid Med Cell Longev. 7542468 . Application: IF. Species: Mouse. Hong Y et al. (2022) "Ultrasound stimulation improves inflammatory resolution, neuroprotection, and functional recovery after spinal cord injury" Sci Rep. 12(1):3636 . Application: IF. Species: Rat. Li J et al. (2022) "Inhibition of LRRK2-Rab10 Pathway Improves Secondary Brain Injury After Surgical Brain Injury in Rats" Front Surg. 8:749310 . Application: IF. Species: Rat. Yamashima T et al. (2022) "Hydroxynonenal Causes Lysosomal and Autophagic Failure in the Monkey." J Alzheimers Dis Parkinsonism. 12:529 . Application: IF. Species: Monkey. Salvadores N et al. (2022) "A? oligomers trigger necroptosis-mediated neurodegeneration via microglia activation in Alzheimer's disease." Acta Neuropathol Commun. 10(1):31 . Application: IF. Species: Mouse. Shi M et al. (2022) "Downregulation of TREM2/NF-?B signaling may damage the blood-brain barrier and aggravate neuronal apoptosis in experimental rats with surgically injured brain." Brain Res Bull. [Epub ahead of print] . Application: IF. Species: Rat. Zhao Y et al. (2022) "ATAD3A oligomerization promotes neuropathology and cognitive deficits in Alzheimers disease models." Nat Commun. 13(1):1121 . Application: IF. Species: Mouse. Fan X et al. (2022) "Inhibiting Sphingosine 1-Phosphate Receptor Subtype 3 Attenuates Brain Damage During Ischemia-Reperfusion Injury by Regulating nNOS/NO and Oxidative Stress." Front Neurosci. 16:838621 . Application: IF. Species: Mouse. Yu S et al. (2022) "BMS-470539 Attenuates Oxidative Stress and Neuronal Apoptosis via MC1R/cAMP/PKA/Nurr1 Signaling Pathway in a Neonatal Hypoxic-Ischemic Rat Model." Oxid Med Cell Longev. 2022:4054938 . Application: IF. Species: Rat. Kim EC et al. (2021) "Spontaneous seizure and memory loss in mice expressing an epileptic encephalopathy variant in the calmodulin-binding domain of Kv7.2." Proc Natl Acad Sci USA. 118(51):e2021265118 . Application: IF. Species: Mouse. Zhang Y et al. (2021) "GSK-3? inhibition elicits a neuroprotection by restoring lysosomal dysfunction in neurons via facilitation of TFEB nuclear translocation after ischemic stroke." Brain Res. [Epub ahead of print] . Application: IF. Species: Rat. Kondoh D et al. (2021) "Cotton rats (Sigmodon hispidus) with a high prevalence of hydrocephalus without clinical symptoms." Neuropathology. [Epub ahead of print] . Application: IF. Species: Rat. Iwasa K et al. (2021) "A peripheral lipid sensor GPR120 remotely contributes to suppression of PGD2-microglia-provoked neuroinflammation and neurodegeneration in the mouse hippocampus." J Neuroinflammation. 18(1):304 . Application: IF. Species: Mouse. Rodriguez-Masso SR et al. (2021) "The Bradykinin B2 Receptor Agonist (NG291) Causes Rapid Onset of Transient BloodBrain Barrier Disruption Without Evidence of Early Brain Injury." Front Neurosci. 15:791709 . Application: IF. Species: Rat. Li N et al. (2021) "Postcooling But Not Precooling Benefits Motor Recovery by Suppressing Cell Death after Surgical Spinal Cord Injury in Rats." World Neurosurg. [Epub ahead of print] . Application: IF. Species: Rat. Estrada H et al. (2021) "High-resolution fluorescence-guided transcranial ultrasound mapping in the live mouse brain. Sci Adv. 7(50):eabi5464 . Application: IF. Species: Mouse. Gu R et al. (2021) "Rh-CXCL-12 Attenuates Neuronal Pyroptosis after Subarachnoid Hemorrhage in Rats via Regulating the CXCR4/NLRP1 Pathway." Oxid Med Cell Longev. 2021:6966394 . Application: IF. Species: Rat. Huang L et al. (2021) "Docosahexaenoic acid reduces hypoglycemia-induced neuronal necroptosis via the peroxisome proliferator-activated receptor ?/nuclear factor-?B pathway." Brain Res. [Epub ahead of print] . Application: IF. Species: Mouse. Yaguchi A et al. (2021) "Efficient protein incorporation and release by a jigsaw-shaped self-assembling peptide hydrogel for injured brain regeneration." Nat Commun. 12(1):6623 . Application: IF. Species: Mouse. Liu Y et al. (2021) "Neuroprotection of minocycline by inhibition of extracellular matrix metalloproteinase inducer expression following intracerebral hemorrhage in mice." Neurosci Lett. [Epub ahead of print] . Application: IF. Species: Mouse. Lam V et al. (2021) "Synthesis of human amyloid restricted to liver results in an Alzheimer disease-like neurodegenerative phenotype." PLoS Biol. 19(9):e3001358 . Application: IF. Species: Mouse. Wu Z et al. (2021) "Melibiose Confers a Neuroprotection against Cerebral Ischemia/Reperfusion Injury by Ameliorating Autophagy Flux via Facilitation of TFEB Nuclear Translocation in Neurons." Life. 11(9), 948 . Application: IF. Species: Rat. Fang Y et al. (2021) "Pituitary adenylate cyclase-activating polypeptide attenuates mitochondria-mediated oxidative stress and neuronal apoptosis after subarachnoid hemorrhage in rats." Free Radic Biol Med. 174:236-248 . Application: IF. Species: Rat. Huan PS et al. (2021) "3,6'-Dithiopomalidomide Ameliorates Hippocampal Neurodegeneration, Microgliosis and Astrogliosis and Improves Cognitive Behaviors in Rats with a Moderate Traumatic Brain Injury." Int J Mol Sci. 22(15):8276 . Application: IF. Species: Mouse. Han M et al. (2021) "Localized Modification of Water Molecule Transport After Focused Ultrasound-Induced BloodBrain Barrier Disruption in Rat Brain." Front Neurosci. 15:685977 . Application: IF. Species: Rat. Gong Y et al. (2021) "Inhibition of the p?SPAK/p?NKCC1 signaling pathway protects the blood?brain barrier and reduces neuronal apoptosis in a rat model of surgical brain injury." Mol Med Rep. 24(4):717 . Application: IF. Species: Rat. Zhu L et al. (2021) "Neuroprotective effects of salidroside on ageing hippocampal neurons and naturally ageing mice via the PI3K/Akt/TERT pathway." Phytother Res. [Epub ahead of print] . Application: IF. Species: Mouse. Huang Y et al. (2021) "Kisspeptin-54 attenuates oxidative stress and neuronal apoptosis in early brain injury after subarachnoid hemorrhage in rats via GPR54/ARRB2/AKT/GSK3? signaling pathway." Free Radic Biol Med. 171:99-111 . Application: IF. Species: Rat. Gong Y et al. (2021) "Inhibition of the NKCC1/NF-?B Signaling Pathway Decreases Inflammation and Improves Brain Edema and Nerve Cell Apoptosis in an SBI Rat Model." Front Mol Neurosci. 14:641993 . Application: IF. Species: Rat. Caron NS et al. (2021) "Mutant Huntingtin Is Cleared from the Brain via Active Mechanisms in Huntington Disease." J Neurosci. 41(4):780-796 . Application: IF. Species: Human. Liu L et al. (2021) "A Novel Netrin-1-Derived Peptide Enhances Protection against Neuronal Death and Mitigates of Intracerebral Hemorrhage in Mice." Int J Mol Sci. 22(9):4829 . Application: IF. Species: Mouse. Zalewska K et al. (2021) "Corticosterone Administration Alters White Matter Tract Structure and Reduces Gliosis in the Sub-Acute Phase of Experimental Stroke." Int J Mol Sci. 22(13):6693 . Application: IF. Species: Mouse. Agrawal RR et al. (2021) "Neurometabolic Alterations After Traumatic Brain Injury: Links to Mitochondria-Associated ER Membranes and Alzheimers Disease." PhD Thesis . Application: IF. Species: Mouse. Zhou H et al. (2021) "AXL kinase-mediated astrocytic phagocytosis modulates outcomes of traumatic brain injury." J Neuroinflammation. 18(1):154 . Application: IF. Species: Mouse. Ousta A et al. (2021) "Microglial Activation and Neurological Outcomes in a Murine Model of Cardiac Arrest." Neurocrit Care. [Epub ahead of print] . Application: IF. Species: Mouse. Horinokita H et al. (2021) "Possible involvement of progranulin in the protective effect of elastase inhibitor on cerebral ischemic injuries of neuronal and glial cells." Mol Cell Neurosci. 113:103625 . Application: IF. Species: Human. Ho MH et al. (2021) "CCL5 via GPX1 activation protects hippocampal memory function after mild traumatic brain injury." Redox Biol. 46:102067 . Application: IF. Species: Mouse. Lian C et al. (2021) "Pentraxin 3 secreted by human adipose-derived stem cells promotes dopaminergic neuron repair in Parkinson's disease via the inhibition of apoptosis." FASEB J. 35(7):e21748 . Application: IF. Species: Mouse. Li Z et al. (2021) "The combination of deferoxamine and minocycline strengthens neuroprotective effect on acute intracerebral hemorrhage in rats." Neurol Res. [Epub ahead of print] . Application: IF. Species: Rat. Zhou K et al. (2021) "Dihydrolipoic acid enhances autophagy and alleviates neurological deficits after subarachnoid hemorrhage in rats." Exp Neurol. 342:113752 . Application: IF. Asuni GP et al. (2021) "Neuronal apoptosis induced by morphine withdrawal is mediated by the p75 neurotrophin receptor." J Neurochem. [Epub ahead of print] . Application: IF. Deng S et al. (2021) "Albumin Reduces Oxidative Stress and Neuronal Apoptosis via the ERK/Nrf2/HO-1 Pathway after Intracerebral Hemorrhage in Rats." Oxid. Med. Cell. Longev. 2021, Article ID 8891373 . Application: IF. Wu MY et al. (2021) "Possible mechanisms of the PERK pathway on neuronal apoptosis in a rat model of surgical brain injury." Am J Transl Res. 13(2):732-742 . Application: IF. Cai G et al. (2021) "Mesenchymal stem cell-derived exosome miR-542-3p suppresses inflammation and prevents cerebral infarction." Stem Cell Res Ther. 12(1)2 . Application: IF. Xu W et al. (2021) "Melanocortin 1 receptor attenuates early brain injury following subarachnoid hemorrhage by controlling mitochondrial metabolism via AMPK/SIRT1/PGC-1_ pathway in rats." Theranostics. 11(2):522-39 . Application: IF. Wu M et al. (2020) "The Blood Component Iron Causes Neuronal Apoptosis Following Intracerebral Hemorrhage via the PERK Pathway." Front. Neurol. 11:588548 . Application: IF. Wu D et al. (2020) "Activated WNK3 induced by intracerebral hemorrhage deteriorates brain injury maybe via WNK3/SPAK/NKCC1 pathway." Exp Neuro. 332:113386 . Application: IF. Fang Y et al. (2020) "HIF-1_ Mediates TRAIL-Induced Neuronal Apoptosis via Regulating DcR1 Expression Following Traumatic Brain Injury." Front Cell Neurosci. 14:192 . Application: IF. Lin CT et al. (2020) "3,6 -dithiopomalidomide reduces neural loss, inflammation, behavioral deficits in brain injury and microglial activation." Elife. 9:e54726 . Application: IF. Wu H et al. (2020) "Upregulated Nmnat2 causes neuronal death and increases seizure susceptibility in temporal lobe epilepsy." Brain Res Bull. [Epub ahead of print] . Application: IF. Zahedi K et al. (2020) "Ablation of polyamine catabolic enzymes provokes Purkinje cell damage, neuroinflammation, and severe ataxia." J Neuroinflammation. 17(1):301 . Application: IF. Hu X et al. (2020) "Rh-CSF1 Attenuates Oxidative Stress and Neuronal Apoptosis via the CSF1R/PLCG2/PKA/UCP2 Signaling Pathway in a Rat Model of Neonatal HIE." Oxid Med Cell Longev. 2020:6801587 . Application: IF. Hu H et al. (2020) "Transient receptor potential melastatin 2 contributes to neuroinflammation and negatively regulates cognitive outcomes in a pilocarpine-induced mouse model of epilepsy." Int Immunopharmacol. 87:106824 . Application: IF. Wang S et al. (2020) "Aging exacerbates impairments of cerebral blood flow autoregulation and cognition in diabetic rats." Geroscience. [Epub ahead of print] . Application: IF. Chen PY et al. (2020) "Stearic Acid Methyl Ester Affords Neuroprotection and Improves Functional Outcomes after Cardiac Arrest." Prostag Leukotr Ess. [In Press] . Application: IF. Gamdzyk M et al. (2020) "cGAS/STING Pathway Activation Contributes to Delayed Neurodegeneration in Neonatal Hypoxia-Ischemia Rat Model: Possible Involvement of LINE-1." Mol Neurobiol. 57(6): 2600-19 . Application: IF. Species: Rat Tang H et al. (2020) "Delayed Recanalization After MCAO Ameliorates Ischemic Stroke by Inhibiting Apoptosis via HGF/c-met/STAT3/Bcl-2 Pathway in Rats." Exp Neurol. [Epub ahead of print] . Application: IF. Species: Rat Ocak U et al. (2020) "Inhibition of mast cell tryptase attenuates neuroinflammation via PAR-2/p38/NF?B pathway following asphyxial cardiac arrest in rats." J Neuroinflammation. 17(1):144 . Application: IF. Species: Rat Huang J et al. (2020) "IRE1? inhibition attenuates neuronal pyroptosis via miR-125/NLRP1 pathway in a neonatal hypoxic-ischemic encephalopathy rat model." J Neuroinflammation. 17(1):152 . Application: IF. Species: Rat Fouda MA et al. (2020) "Estrogen-dependent hypersensitivity to diabetes-evoked cardiac autonomic dysregulation: Role of hypothalamic neuroinflammation." Life Sci. 2020 Mar 31:117598. [Epub ahead of print] . Application: IF. Species: Rat Zhou Z et al. (2020) "Sodium butyrate attenuated neuronal apoptosis via GPR41/G??/PI3K/Akt pathway after MCAO in rats." J Cerebr Blood F Met. [Epub ahead of print]. Application: IF. Species: Rat Enam SF et al. (2020) "Engineering Cytokine and Macrophage Enrichment at Sites of Injury." PhD Thesis . Application: IF. Species: Mouse
Specificity:
Degenerating neurons, and neuronal degeneration. There is no specific staining in normal healthy brain. Note: Some researchers under some conditions report blood vessel staining with Fluoro Jade. This may be because Fluoro Jade is an analogue of eosin (which stains blood cells). In general, good perfusion and preparation of the tissue should help prevent blood vessel staining but it may not be possible to eliminate it entirely. In our experience it is generally possible to distinguish neuronal from blood vessels staining by eye.
Storage:
The unopened kit can be stored for up to 6 months at 2-8ºC after the date of receipt. The kit and components should be stored protected from light. Diluted FJC dye solutions are not stable and should be used within 4 hours of making. The other diluted solutions can be reused and stored for up to 48 hours if refrigerated and protected from light. Best results require freshly diluted solutions. We recommend using aseptic techniques when handling the reagents to avoid bacterial growth and contamination.<br><br>The FJC Ready to dilute kit is shipped ambient and stable at room temperature during transport. Refrigerate upon arrival, do not freeze.
The causes and effects of neuronal degeneration are of major interest to a wide variety of neuroscientists. Paralleling this growing interest is an increasing number of methods applicable to the detection of neuronal degeneration. Fluoro-Jade C stains all degenerating neurons regardless of specific insult or mechanism of cell death. Fluoro-Jade C exhibits the greatest signal to background ratio, as well as the highest resolution. This translates to a stain of maximal contrast and affinity for degenerating neurons. This makes it ideal for localising not only degenerating nerve cell bodies but also distal dendrites, axons and terminals. The dye is highly resistant to fading and is compatible with virtually all histological processing and staining protocols.
Product Type:
Staining Reagent
Format:
The reagents in the Fluoro Jade kit (10X) are all supplied in a liquid format and are ready-to-dilute.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
FC,ICC,IHC-Frozen,IHC-Paraffin-embedded
Application Details:
The Fluoro-Jade C 'Ready to Dilute' (RTD) Staining Kit provides an easy to use assortment of Fluoro-Jade C, DAPI, sodium hydroxide and potassium permanganate in liquid form. Following our detailed protocol, Fluoro-Jade C labelled degenerating neurons are visualised with blue light excitation while DAPI counter stained cell nuclei are visualised with ultra-violet illumination. The Fluoro-Jade C Staining Kit can be used on all kinds of preserved tissues, including fresh-frozen, paraformaldehyde or formalin fixed, and formalin fixed, paraffin-embedded tissues.
Alternative Names:
FJC
Biosensis Brand:
Biosensis® RTD
Detection Method:
Fluorescence
Excitation/Emission:
FJC visualization is accomplished using blue light or a 488 nm Laser. Excitation Peak: 495 nm Emission Peak: 521 nm Filter system for visualizing: Fluorescein/FITC
Shelf Life:
Unopened kit 6 months at 2-8ºC protected from light. See Storage instructions for working solutions recommendations.
Use:
For research use only.
Kit Components:
Materials provided: Sodium Hydroxide, Solution A (Dilute 1:10 prior to use) - 40 mL Potassium Permanganate, Solution B (Dilute 1:10 prior to use) - 40 mL Fluoro-Jade C, Solution C (Dilute 1:10 prior to use) - 40 mL DAPI, Solution D (Add to diluted Fluoro-Jade C) - 40 mL Equipment and Reagents required: Gelatin coated microscope slides Staining dishes/Coplin jars Cover slips DPX mounting media Slide warmer Convection oven Distilled water Ethanol Xylene Number of slides processed: The actual number of slides processed by this kit will depend largely upon the vessel that is used to incubate the slides. If using a standard Coplin Jar, its capacity is 50 mL and typically holds 5 slides per jar. If using such a device, then 80-100 slides stained per 50 ml of working solution (or, 5 ml of stock solution) could be processed in one day. Note the diluted dye is NOT stable and will not store overnight. It is best to use freshly diluted dye each time an experimental batch is started. Final working concentrations of FJC: 0.0001% Final working concentration of KMnO4: 0.06%
Product references:
Total Number of References: 153 Latest Publications (2020-2022):
Li L et al. (2022) "A selective degeneration of cholinergic neurons mediated by NRADD in an Alzheimer's disease mouse model" Cell Insight. [Epub ahead of print] . Application: IF. Species: Mouse. Karino K et al. (2022) "Inhibitor of nuclear factor kappa-B kinase epsilon contributes to neuropsychiatric manifestations in lupus-prone mice through microglial activation" Arthritis Rheumatol. [Epub ahead of print] . Application: IF. Species: Mouse. Chen J et al. (2022) "Flufenamic acid improves survival and neurologic outcome after successful cardiopulmonary resuscitation in mice" J Neuroinflammation. 19(1):214 . Application: IF. Species: Mouse. Zou Y et al. (2022) "Learning and memory impairment and transcriptomic profile in hippocampus of offspring after maternal fructose exposure during gestation and lactation" Food Chem Toxicol. [Epub ahead of print] . Application: IF. Species: Rat. Jin P et al. (2022) "Aprepitant attenuates NLRC4-dependent neuronal pyroptosis via NK1R/PKC? pathway in a mouse model of intracerebral hemorrhage" J Neuroinflammation. 19(10):198 . Application: IF. Species: Mouse. Koike-Kumagai M et al. (2022) "Sirolimus relieves seizures and neuropsychiatric symptoms via changes of microglial polarity in tuberous sclerosis complex model mice" Neuropharmacology. [Epub ahead of print] . Application: IF. Species: Mouse. Wang D et al. (2022) "Mesenchymal stromal cell treatment attenuates repetitive mild traumatic brain injury-induced persistent cognitive deficits via suppressing ferroptosis" Neuroinflammation. 19(1):185 . Application: IF. Species: Mouse. Seo Y et al. (2022) "Mesenchymal stem cells target microglia via galectin-1 production to rescue aged mice from olfactory dysfunction" Biomed Pharmacother. 153:113347 . Application: IF. Species: Mouse. Duan R et al. (2022) "Recurrent de novo single point variant on the gene encoding Na+/K+ pump results in epilepsy" Prog Neurobiol. 216:102310 . Application: IF. Species: Mouse. Liu P et al. (2022) "Suppression of phosphodiesterase IV enzyme by Roflumilast ameliorates cognitive dysfunction in aged rats after sevoflurane anesthesia via PKA-CREB and MEK/ERK pathways" Eur J Neurosci. [Epub ahead of print] . Application: IF. Species: Rat. Boucher ML et al. (2022) "Titrating the Translational Relevance of a Low-Level Repetitive Head Impact Model" Front Neurol. 13:857654 . Application: IF. Species: Mouse. Qian L et al. (2022) "Interleukin-35 attenuates blood-brain barrier dysfunction caused by cerebral ischemia-reperfusion injury through inhibiting brain endothelial cell injury" Ann Transl Med. 10.21037 . Application: IF. Species: Mouse. Buentello DC et al. (2022) "Use of standard U-bottom and V-bottom well plates to generate neuroepithelial embryoid bodies" PLoS One. 17(5): e0262062 . Application: IF. Species: Human. Jin P et al. (2022) "Activation of LRP6 with HLY78 Attenuates Oxidative Stress and Neuronal Apoptosis via GSK3?/Sirt1/PGC-1? Pathway after ICH" Oxid Med Cell Longev. 2022: 7542468 . Application: IF. Species: Mouse. Wang J et al. (2022) "Irisin protects against sepsis-associated encephalopathy by suppressing ferroptosis via activation of the Nrf2/GPX4 signal axis" Free Radic Biol Med. [Epub ahead of print] . Application: IF. Species: Mouse. Tang T et al. (2022) "Ginkgetin Promotes M2 Polarization of Microglia and Exert Neuroprotection in Ischemic Stroke via Modulation of PPAR? Pathway" Neurochem Res. [Epub ahead of print] . Application: IF. Species: Rat. Zhang Z et al. (2022) "Inhibiting Microglia-Derived NLRP3 Alleviates Subependymal Edema and Cognitive Dysfunction in Posthemorrhagic Hydrocephalus after Intracerebral Hemorrhage via AMPK/Beclin-1 Pathway" Oxid. Med. Cell. Longev. [Epub ahead of print] . Application: IF. Species: Rat. Ren R et al. (2022) "Kynurenine/Aryl Hydrocarbon Receptor Modulates Mitochondria-Mediated Oxidative Stress and Neuronal Apoptosis in Experimental Intracerebral Hemorrhage" Antioxid Redox Signal. [Epub ahead of print] . Application: IF. Species: Mouse. Deforzh E et al. (2022) "Promoter and enhancer RNAs regulate chromatin reorganization and activation of miR-10b/HOXD locus, and neoplastic transformation in glioma" Mol Cell. [Epub ahead of print] . Application: IF. Species: Human, Mouse. Chen X et al. (2022) "Mechanism of Baicalein in Brain Injury After Intracerebral Hemorrhage by Inhibiting the ROS/NLRP3 Inflammasome Pathway" Inflammation. 45(2):590-602 . Application: IF. Species: Rat. Komatsu A et al. (2022) "Ammonia induces amyloidogenesis in astrocytes by promoting amyloid precursor protein translocation into the endoplasmic reticulum" J Bio; Chem. [Epub ahead of print] . Application: IF. Species: Mouse. Jin P et al. (2022) "Activation of LRP6 with HLY78 Attenuates Oxidative Stress and Neuronal Apoptosis via GSK3 ?/Sirt1/PGC-1 ? Pathway after ICH" Oxid Med Cell Longev. 7542468 . Application: IF. Species: Mouse. Hong Y et al. (2022) "Ultrasound stimulation improves inflammatory resolution, neuroprotection, and functional recovery after spinal cord injury" Sci Rep. 12(1):3636 . Application: IF. Species: Rat. Li J et al. (2022) "Inhibition of LRRK2-Rab10 Pathway Improves Secondary Brain Injury After Surgical Brain Injury in Rats" Front Surg. 8:749310 . Application: IF. Species: Rat. Yamashima T et al. (2022) "Hydroxynonenal Causes Lysosomal and Autophagic Failure in the Monkey." J Alzheimers Dis Parkinsonism. 12:529 . Application: IF. Species: Monkey. Salvadores N et al. (2022) "A? oligomers trigger necroptosis-mediated neurodegeneration via microglia activation in Alzheimer's disease." Acta Neuropathol Commun. 10(1):31 . Application: IF. Species: Mouse. Shi M et al. (2022) "Downregulation of TREM2/NF-?B signaling may damage the blood-brain barrier and aggravate neuronal apoptosis in experimental rats with surgically injured brain." Brain Res Bull. [Epub ahead of print] . Application: IF. Species: Rat. Zhao Y et al. (2022) "ATAD3A oligomerization promotes neuropathology and cognitive deficits in Alzheimers disease models." Nat Commun. 13(1):1121 . Application: IF. Species: Mouse. Fan X et al. (2022) "Inhibiting Sphingosine 1-Phosphate Receptor Subtype 3 Attenuates Brain Damage During Ischemia-Reperfusion Injury by Regulating nNOS/NO and Oxidative Stress." Front Neurosci. 16:838621 . Application: IF. Species: Mouse. Yu S et al. (2022) "BMS-470539 Attenuates Oxidative Stress and Neuronal Apoptosis via MC1R/cAMP/PKA/Nurr1 Signaling Pathway in a Neonatal Hypoxic-Ischemic Rat Model." Oxid Med Cell Longev. 2022:4054938 . Application: IF. Species: Rat. Kim EC et al. (2021) "Spontaneous seizure and memory loss in mice expressing an epileptic encephalopathy variant in the calmodulin-binding domain of Kv7.2." Proc Natl Acad Sci USA. 118(51):e2021265118 . Application: IF. Species: Mouse. Zhang Y et al. (2021) "GSK-3? inhibition elicits a neuroprotection by restoring lysosomal dysfunction in neurons via facilitation of TFEB nuclear translocation after ischemic stroke." Brain Res. [Epub ahead of print] . Application: IF. Species: Rat. Kondoh D et al. (2021) "Cotton rats (Sigmodon hispidus) with a high prevalence of hydrocephalus without clinical symptoms." Neuropathology. [Epub ahead of print] . Application: IF. Species: Rat. Iwasa K et al. (2021) "A peripheral lipid sensor GPR120 remotely contributes to suppression of PGD2-microglia-provoked neuroinflammation and neurodegeneration in the mouse hippocampus." J Neuroinflammation. 18(1):304 . Application: IF. Species: Mouse. Rodriguez-Masso SR et al. (2021) "The Bradykinin B2 Receptor Agonist (NG291) Causes Rapid Onset of Transient BloodBrain Barrier Disruption Without Evidence of Early Brain Injury." Front Neurosci. 15:791709 . Application: IF. Species: Rat. Li N et al. (2021) "Postcooling But Not Precooling Benefits Motor Recovery by Suppressing Cell Death after Surgical Spinal Cord Injury in Rats." World Neurosurg. [Epub ahead of print] . Application: IF. Species: Rat. Estrada H et al. (2021) "High-resolution fluorescence-guided transcranial ultrasound mapping in the live mouse brain. Sci Adv. 7(50):eabi5464 . Application: IF. Species: Mouse. Gu R et al. (2021) "Rh-CXCL-12 Attenuates Neuronal Pyroptosis after Subarachnoid Hemorrhage in Rats via Regulating the CXCR4/NLRP1 Pathway." Oxid Med Cell Longev. 2021:6966394 . Application: IF. Species: Rat. Huang L et al. (2021) "Docosahexaenoic acid reduces hypoglycemia-induced neuronal necroptosis via the peroxisome proliferator-activated receptor ?/nuclear factor-?B pathway." Brain Res. [Epub ahead of print] . Application: IF. Species: Mouse. Yaguchi A et al. (2021) "Efficient protein incorporation and release by a jigsaw-shaped self-assembling peptide hydrogel for injured brain regeneration." Nat Commun. 12(1):6623 . Application: IF. Species: Mouse. Liu Y et al. (2021) "Neuroprotection of minocycline by inhibition of extracellular matrix metalloproteinase inducer expression following intracerebral hemorrhage in mice." Neurosci Lett. [Epub ahead of print] . Application: IF. Species: Mouse. Lam V et al. (2021) "Synthesis of human amyloid restricted to liver results in an Alzheimer disease-like neurodegenerative phenotype." PLoS Biol. 19(9):e3001358 . Application: IF. Species: Mouse. Wu Z et al. (2021) "Melibiose Confers a Neuroprotection against Cerebral Ischemia/Reperfusion Injury by Ameliorating Autophagy Flux via Facilitation of TFEB Nuclear Translocation in Neurons." Life. 11(9), 948 . Application: IF. Species: Rat. Fang Y et al. (2021) "Pituitary adenylate cyclase-activating polypeptide attenuates mitochondria-mediated oxidative stress and neuronal apoptosis after subarachnoid hemorrhage in rats." Free Radic Biol Med. 174:236-248 . Application: IF. Species: Rat. Huan PS et al. (2021) "3,6'-Dithiopomalidomide Ameliorates Hippocampal Neurodegeneration, Microgliosis and Astrogliosis and Improves Cognitive Behaviors in Rats with a Moderate Traumatic Brain Injury." Int J Mol Sci. 22(15):8276 . Application: IF. Species: Mouse. Han M et al. (2021) "Localized Modification of Water Molecule Transport After Focused Ultrasound-Induced BloodBrain Barrier Disruption in Rat Brain." Front Neurosci. 15:685977 . Application: IF. Species: Rat. Gong Y et al. (2021) "Inhibition of the p?SPAK/p?NKCC1 signaling pathway protects the blood?brain barrier and reduces neuronal apoptosis in a rat model of surgical brain injury." Mol Med Rep. 24(4):717 . Application: IF. Species: Rat. Zhu L et al. (2021) "Neuroprotective effects of salidroside on ageing hippocampal neurons and naturally ageing mice via the PI3K/Akt/TERT pathway." Phytother Res. [Epub ahead of print] . Application: IF. Species: Mouse. Huang Y et al. (2021) "Kisspeptin-54 attenuates oxidative stress and neuronal apoptosis in early brain injury after subarachnoid hemorrhage in rats via GPR54/ARRB2/AKT/GSK3? signaling pathway." Free Radic Biol Med. 171:99-111 . Application: IF. Species: Rat. Gong Y et al. (2021) "Inhibition of the NKCC1/NF-?B Signaling Pathway Decreases Inflammation and Improves Brain Edema and Nerve Cell Apoptosis in an SBI Rat Model." Front Mol Neurosci. 14:641993 . Application: IF. Species: Rat. Caron NS et al. (2021) "Mutant Huntingtin Is Cleared from the Brain via Active Mechanisms in Huntington Disease." J Neurosci. 41(4):780-796 . Application: IF. Species: Human. Liu L et al. (2021) "A Novel Netrin-1-Derived Peptide Enhances Protection against Neuronal Death and Mitigates of Intracerebral Hemorrhage in Mice." Int J Mol Sci. 22(9):4829 . Application: IF. Species: Mouse. Zalewska K et al. (2021) "Corticosterone Administration Alters White Matter Tract Structure and Reduces Gliosis in the Sub-Acute Phase of Experimental Stroke." Int J Mol Sci. 22(13):6693 . Application: IF. Species: Mouse. Agrawal RR et al. (2021) "Neurometabolic Alterations After Traumatic Brain Injury: Links to Mitochondria-Associated ER Membranes and Alzheimers Disease." PhD Thesis . Application: IF. Species: Mouse. Zhou H et al. (2021) "AXL kinase-mediated astrocytic phagocytosis modulates outcomes of traumatic brain injury." J Neuroinflammation. 18(1):154 . Application: IF. Species: Mouse. Ousta A et al. (2021) "Microglial Activation and Neurological Outcomes in a Murine Model of Cardiac Arrest." Neurocrit Care. [Epub ahead of print] . Application: IF. Species: Mouse. Horinokita H et al. (2021) "Possible involvement of progranulin in the protective effect of elastase inhibitor on cerebral ischemic injuries of neuronal and glial cells." Mol Cell Neurosci. 113:103625 . Application: IF. Species: Human. Ho MH et al. (2021) "CCL5 via GPX1 activation protects hippocampal memory function after mild traumatic brain injury." Redox Biol. 46:102067 . Application: IF. Species: Mouse. Lian C et al. (2021) "Pentraxin 3 secreted by human adipose-derived stem cells promotes dopaminergic neuron repair in Parkinson's disease via the inhibition of apoptosis." FASEB J. 35(7):e21748 . Application: IF. Species: Mouse. Li Z et al. (2021) "The combination of deferoxamine and minocycline strengthens neuroprotective effect on acute intracerebral hemorrhage in rats." Neurol Res. [Epub ahead of print] . Application: IF. Species: Rat. Zhou K et al. (2021) "Dihydrolipoic acid enhances autophagy and alleviates neurological deficits after subarachnoid hemorrhage in rats." Exp Neurol. 342:113752 . Application: IF. Asuni GP et al. (2021) "Neuronal apoptosis induced by morphine withdrawal is mediated by the p75 neurotrophin receptor." J Neurochem. [Epub ahead of print] . Application: IF. Deng S et al. (2021) "Albumin Reduces Oxidative Stress and Neuronal Apoptosis via the ERK/Nrf2/HO-1 Pathway after Intracerebral Hemorrhage in Rats." Oxid. Med. Cell. Longev. 2021, Article ID 8891373 . Application: IF. Wu MY et al. (2021) "Possible mechanisms of the PERK pathway on neuronal apoptosis in a rat model of surgical brain injury." Am J Transl Res. 13(2):732-742 . Application: IF. Cai G et al. (2021) "Mesenchymal stem cell-derived exosome miR-542-3p suppresses inflammation and prevents cerebral infarction." Stem Cell Res Ther. 12(1)2 . Application: IF. Xu W et al. (2021) "Melanocortin 1 receptor attenuates early brain injury following subarachnoid hemorrhage by controlling mitochondrial metabolism via AMPK/SIRT1/PGC-1_ pathway in rats." Theranostics. 11(2):522-39 . Application: IF. Wu M et al. (2020) "The Blood Component Iron Causes Neuronal Apoptosis Following Intracerebral Hemorrhage via the PERK Pathway." Front. Neurol. 11:588548 . Application: IF. Wu D et al. (2020) "Activated WNK3 induced by intracerebral hemorrhage deteriorates brain injury maybe via WNK3/SPAK/NKCC1 pathway." Exp Neuro. 332:113386 . Application: IF. Fang Y et al. (2020) "HIF-1_ Mediates TRAIL-Induced Neuronal Apoptosis via Regulating DcR1 Expression Following Traumatic Brain Injury." Front Cell Neurosci. 14:192 . Application: IF. Lin CT et al. (2020) "3,6 -dithiopomalidomide reduces neural loss, inflammation, behavioral deficits in brain injury and microglial activation." Elife. 9:e54726 . Application: IF. Wu H et al. (2020) "Upregulated Nmnat2 causes neuronal death and increases seizure susceptibility in temporal lobe epilepsy." Brain Res Bull. [Epub ahead of print] . Application: IF. Zahedi K et al. (2020) "Ablation of polyamine catabolic enzymes provokes Purkinje cell damage, neuroinflammation, and severe ataxia." J Neuroinflammation. 17(1):301 . Application: IF. Hu X et al. (2020) "Rh-CSF1 Attenuates Oxidative Stress and Neuronal Apoptosis via the CSF1R/PLCG2/PKA/UCP2 Signaling Pathway in a Rat Model of Neonatal HIE." Oxid Med Cell Longev. 2020:6801587 . Application: IF. Hu H et al. (2020) "Transient receptor potential melastatin 2 contributes to neuroinflammation and negatively regulates cognitive outcomes in a pilocarpine-induced mouse model of epilepsy." Int Immunopharmacol. 87:106824 . Application: IF. Wang S et al. (2020) "Aging exacerbates impairments of cerebral blood flow autoregulation and cognition in diabetic rats." Geroscience. [Epub ahead of print] . Application: IF. Chen PY et al. (2020) "Stearic Acid Methyl Ester Affords Neuroprotection and Improves Functional Outcomes after Cardiac Arrest." Prostag Leukotr Ess. [In Press] . Application: IF. Gamdzyk M et al. (2020) "cGAS/STING Pathway Activation Contributes to Delayed Neurodegeneration in Neonatal Hypoxia-Ischemia Rat Model: Possible Involvement of LINE-1." Mol Neurobiol. 57(6): 2600-19 . Application: IF. Species: Rat Tang H et al. (2020) "Delayed Recanalization After MCAO Ameliorates Ischemic Stroke by Inhibiting Apoptosis via HGF/c-met/STAT3/Bcl-2 Pathway in Rats." Exp Neurol. [Epub ahead of print] . Application: IF. Species: Rat Ocak U et al. (2020) "Inhibition of mast cell tryptase attenuates neuroinflammation via PAR-2/p38/NF?B pathway following asphyxial cardiac arrest in rats." J Neuroinflammation. 17(1):144 . Application: IF. Species: Rat Huang J et al. (2020) "IRE1? inhibition attenuates neuronal pyroptosis via miR-125/NLRP1 pathway in a neonatal hypoxic-ischemic encephalopathy rat model." J Neuroinflammation. 17(1):152 . Application: IF. Species: Rat Fouda MA et al. (2020) "Estrogen-dependent hypersensitivity to diabetes-evoked cardiac autonomic dysregulation: Role of hypothalamic neuroinflammation." Life Sci. 2020 Mar 31:117598. [Epub ahead of print] . Application: IF. Species: Rat Zhou Z et al. (2020) "Sodium butyrate attenuated neuronal apoptosis via GPR41/G??/PI3K/Akt pathway after MCAO in rats." J Cerebr Blood F Met. [Epub ahead of print]. Application: IF. Species: Rat Enam SF et al. (2020) "Engineering Cytokine and Macrophage Enrichment at Sites of Injury." PhD Thesis . Application: IF. Species: Mouse
Specificity:
Degenerating neurons, and neuronal degeneration. There is no specific staining in normal healthy brain. Note: Some researchers under some conditions report blood vessel staining with Fluoro Jade. This may be because Fluoro Jade is an analogue of eosin (which stains blood cells). In general, good perfusion and preparation of the tissue should help prevent blood vessel staining but it may not be possible to eliminate it entirely. In our experience it is generally possible to distinguish neuronal from blood vessels staining by eye.
Storage:
The unopened kit can be stored for up to 6 months at 2-8ºC after the date of receipt. The kit and components should be stored protected from light. Diluted FJC dye solutions are not stable and should be used within 4 hours of making. The other diluted solutions can be reused and stored for up to 48 hours if refrigerated and protected from light. Best results require freshly diluted solutions. We recommend using aseptic techniques when handling the reagents to avoid bacterial growth and contamination.<br><br>The FJC Ready to dilute kit is shipped ambient and stable at room temperature during transport. Refrigerate upon arrival, do not freeze.
Black-Gold II is a novel haloaurophosphate complex which localises myelin within the central nervous system. The Black Gold II Ready-to-Dilute (RTD) Staining Kit allows you to localise myelin, both individual fibres and tracts, along with the option of co-localising cell bodies via the Toluidine Blue counter stain. Black Gold II labelled myelinated fibres appear nearly black while the Toluidine Blue O labelled cellular Nissl bodies are blue under bright field illumination. Black Gold II can demonstrate and characterise specific myelin changes associated with exposure to diverse neurotoxicants including kainic acid, domoic acid, 3-nitropropionic acid, Fluoro-Gold and isoniazid. Black Gold II can also be combined with other histochemical markers including Nissl stains, retrogradely transported fluorescent tracers and fluorescent markers of neuronal degeneration. The advantages associated with the Black-Gold II include high resolution, high contrast, short histochemical processing time, versatility and consistent reproducibility.
Product Type:
Staining Reagent
Format:
The reagents in the Black Gold kit (10X) are all supplied in a liquid format and are ready-to-dilute.
Species Reactivity:
Mammals
Applications:
IHC-Frozen,IHC-non-Paraffin-embedded
Application Details:
Black Gold II is a high resolution myelin stain with amyloid plaque counter stain. Its use is tailored to studies using formalin or paraformaldehyde fixed, non-paraffin embedded, non-solvent processed brain tissue. It can be used with both thick and thin sections. For thick sections, gelatin coated slides or slides specially designed to bind tissues sections should be use to avoid section loss. Free-floating sections can be used as well but sections are easier to handle and transfer when mounted on slides. A suggested method for thick sections is provided as a guide: Either frozen or vibratome sections are cut at a thickness of 20-50 ?m and collected in 0.1 M neutral phosphate buffer. The sections are then typically mounted on 1% gel-coated slides and then air dried on a slide warmer (at 50°C) for at least an hour until throughly dried and adhered to the slide. The sections can be stained loose, although the sections are easier to handle when mounted on slides. The mounted sections were rehydrated in distilled water for 2 minutes before being processed in the staining solutions.
Alternative Names:
BlackGold, Black and Gold
Biosensis Brand:
Biosensis® RTD
Detection Method:
Colorimetric
Shelf Life:
Unopened kit 6 months at 2-8ºC protected from light. See Storage instructions for working solutions recommendations.
Use:
For research use only.
Kit Components:
Black-Gold II (Dilute 1:10 prior to use) - 10 mL Sodium Thiosulfate, fixative (Dilute 1:10 prior to use) - 10 mL Toluidine Blue O (Dilute 1:10 prior to use) - 10 mL Acetic Acid (Dilute 1:10 prior to use) - 10 mL
Product references:
Lee J et al. (2022) PRMT1 is required for the generation of MHC-associated microglia and remyelination in the central nervous system. Life Sci Alliance. [Epub ahead of print] Germundson DL & Nagamoto-Combs K. (2022) Potential Role of Intracranial Mast Cells in Neuroinflammation and Neuropathology Associated with Food Allergy. Cells. 11(4):738. Kihara Y et al. (2021) Ponesimod inhibits astrocyte-mediated neuroinflammation and protects against cingulum demyelination via S1P1-selective modulation. FASEB J. 36(2):e22132. Toomey LM et al. (2021) Cuprizone feed formulation influences the extent of demyelinating disease pathology. Sci Rep. 11(1):22594. Del Fiacco M et al. (2018) TRPV1-Like Immunoreactivity in the Human Locus K, a Distinct Subregion of the Cuneate Nucleus. Cells. 2018 Jul 8;7(7). pii: E72. Ying YL et al. (2014) Adult neural precursor cells from the subventricular zone contribute significantly to oligodendrocyte regeneration and remyelination. J Neurosci. 2014 Oct 15;34(42):14128-46
Specificity:
Black-Gold II is a novel haloaurophosphate complex which localises myelin within the central nervous system.
Storage:
The kit can be transported at room temperature. Once received, the kit canbe stored for up to 12 months at 2-8°C protected from light. Diluted solutionscan be stored up to one month at 2-8°C protected from light.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
Non-immune
Country Of Origin:
Normal Llama Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Country Of Origin:
Normal Llama Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Dog Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Dog Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Cross Reactivity:
Serum may may contain anti-feline calicivirus antibodies. Not suitable as negative control within calicivirus assay.
Country Of Origin:
Normal Cat Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Cross Reactivity:
Serum may may contain anti-feline calicivirus antibodies. Not suitable as negative control within calicivirus assay.
Country Of Origin:
Normal Cat Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Pig Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Pig Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Donkey serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Donkey serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Horse Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Horse Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 5.5 ml of deionized water. (Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Syrian Hamster Serum was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Syrian Hamster Serum was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 5.5 ml of deionized water. (Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Guinea Pig Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Guinea Pig Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Chicken Serum (unspecified gender) was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Chicken Serum (unspecified gender) was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Bovine Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Bovine Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 5.5 ml of deionized water. (Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Rat Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Rat Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Sheep Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Sheep Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Goat Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Goat Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 5.5 ml of deionized water. (Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
Non-immune Ku-Ming (KM) Mouse Strain
Country Of Origin:
Normal Mouse Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
Non-immune Ku-Ming (KM) Mouse Strain
Country Of Origin:
Normal Mouse Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Human Serum/Plasma was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Human Serum/Plasma was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Sheep
Immunogen:
Purified Rabbit IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rabbit IgG · light chains on all rabbit immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rabbit serum proteins
Country Of Origin:
Sheep serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Sheep
Immunogen:
Purified Rabbit IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rabbit IgG · light chains on all rabbit immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rabbit serum proteins
Country Of Origin:
Sheep serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Sheep
Immunogen:
Purified Rabbit IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rabbit IgG · light chains on all rabbit immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rabbit serum proteins
Country Of Origin:
Sheep serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rabbit IgG · light chains on all rabbit immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rabbit serum proteins
Country Of Origin:
Sheep serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Human Complement C5
Purity:
> 95% based on SDS-PAGE
Host:
Sheep
Immunogen:
Human Complement C5
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human Complement C5
Country Of Origin:
Sheep serum was obtained from healthy animals of UK origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Human Alpha-2-HS Glycoprotein
Purity:
> 95% based on SDS-PAGE
Host:
Sheep
Immunogen:
Human Alpha-2-HS Glycoprotein
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human Alpha-2-HS Glycoprotein
Country Of Origin:
Sheep serum was obtained from healthy animals of UK origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Human Alpha-1-Antichymotrypsin
Purity:
> 95% based on SDS-PAGE
Host:
Sheep
Immunogen:
Human Alpha-1-Antichymotrypsin
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human Alpha-1-Antichymotrypsin
Country Of Origin:
Goat serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
C1-inhibitor (C1-inh, C1 esterase inhibitor) is a protease inhibitor belonging to the serpin superfamily. Its main function is the inhibition of the complement system to prevent spontaneous activation.
Concentration:
> 4.5 mg/ml (E 1% at 280 nm = 13.0)
Conjugate:
Unconjugated
Form:
Clear, colorless liquid, 0.2 µm filtered
Purification:
Affinity purified using solid phase Human C1 Inhibitor
Purity:
> 95% based on SDS-PAGE
Host:
Sheep
Immunogen:
Human C1 Inhibitor
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human C1 Inhibitor
Country Of Origin:
Sheep serum was obtained from healthy animals of UK origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Sheep Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Storage:
2-8 °C
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Sheep Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Normal sheep serum from non-immunized animal, Sheep Polyclonal Antibody
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Sheep
Species Reactivity:
Non-Reactive (Negative Control)
Immunogen:
None. Sheep serum is obtained from non-immunized animals.
Applications:
Negative Control
Antibody Isotype:
Mixed
Application Details:
Use as negative control for IgG-purified sheep primary antibodies and at matching concentration.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Uncharacterized serum control
Storage:
Store lyophilized sheep whole serum at -20°C to -80°C protected from moisture. After reconstitution, divide whole serum nto useful aliquots and keep aliquots at -20°C to -80°C for a higher stability. Working aliquots can be kept at 2-8°C for up to 1 month. Avoid repetitive freeze/thaw cycles.
Normal sheep IgG from non-immunized animal, Sheep Polyclonal Antibody
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4, without preservatives.
Host Animal:
Sheep
Species Reactivity:
Non-Reactive (Negative Control)
Immunogen:
None. Sheep IgG is obtained from non-immunized animals.
Applications:
Negative Control
Antibody Isotype:
IgG
Application Details:
Use as negative control for IgG-purified sheep primary antibodies and at matching concentration.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Uncharacterized serum control
Storage:
Store lyophilized sheep IgG at -20°C to -80°C protected from moisture. After reconstitution divide IgG into useful aliquots and keep aliquots at -20°C to -80°C for a higher stability. Working aliquots can be kept at 2-8°C for up to 1 month. Avoid repetitive freeze/thaw cycles.
Sheep anti-Catenin beta Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Catenin beta is an adherens junction protein and has a role in the regulation of cell adhesion and in signal transduction through the Wnt pathway. At least 2 isoforms are produced by alternative splicing.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from 10 mM sodium HEPES (pH 7.5), 150 mM NaCl, and 0.05 % sodium azide.
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (C-SNQLAWFDTDL) corresponding to the amino acid region 771-781 of human Catenin beta coupled to carrier protein KLH.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunoprecipitation. A concentration of 1.0 µg/mL is recommended for WB. Human Catenin beta (isoform 1) has a predicted length of 781 residues and MW of 86 kDa. A concentration of 5 µg/500 µg of lysate is recommended for immunoprecipitation. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB against the antigen. This antibody was also validated for immunoprecipitation in rat liver lysate (data not shown). Human; mouse; rat;
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Catenin beta is an adherens junction protein and has a role in the regulation of cell adhesion and in signal transduction through the Wnt pathway. At least 2 isoforms are produced by alternative splicing.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from 10 mM sodium HEPES (pH 7.5), 150 mM NaCl, and 0.05 % sodium azide.
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (C-QSYLDSGIHSGATTTAPSL) corresponding to the amino acid region 28-46 of human Catenin beta coupled to carrier protein KLH. This antibody was designed to detect the active form of Catenin beta . The antibody exhibits a strong preference for dephosphorylated beta catenin protein by western blot but the antibody may show cross reactivity with phosphorylated catenin beta under certain conditions.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunocytochemistry. A concentration of 2.0 µg/mL is recommended for WB. Human Catenin beta (isoform 1) has a predicted length of 781 residues and MW of 86 kDa. It has been observed as a 92 kDa band in SDS-reducing gels. A concentration of 4.0 µg/mL is recommended for Immunocytochemistry. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB against the antigen. Human; mouse; rat;
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Nerve growth factor (NGF) is synthesized as a precursor (proNGF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proNGF is synthesized in target tissues and glia, transported retrogradely and may be released. This antibody is raised in sheep to detect the prodomain of NGF not the mature peptide.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
The recombinant prodomain fragment of human nerve growth factor
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, Immunofluorescence, ELISA, Western Blot, biological neutralization of proNGF. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
pro-brain nerve growth factor; proNGF; NGF;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Sugimoto J et al. (2021). Fabry disease-associated globotriaosylceramide induces mechanical allodynia via activation of signaling through proNGF p75NTR but not mature NGF TrkA. Eur. J. Pharmacol. 895. Application: Neutralising ( in-vivo ). Ryu JC et al. (2018). Role of proNGF/p75 signaling in bladder dysfunction after spinal cord injury. J Clin Invest. [Epub ahead of print]. Application: Western Blotting.
Specificity:
The specificity of this antibody has been confirmed by WB. It does NOT crossreact with proBDNF, proNT-3 or mature NGF. Confirmed to react with purified human proNGF and crossreact with mouse and rat proNGF
Storage:
Maintain lyophilized antibody at 2-8°C for up to 12 months after date of receipt. After reconstitution keep undiluted aliquots at -20°C for up to 6 months for higher stability or at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Brain derived neurotrophic factor (BDNF) is synthesized as a precursor (proBDNF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proBDNF is synthesized in neurons and glia (eg., microglia), transported anterogradely and retrogradely and may be released in an activity dependent manner. This antibody is raised in sheep to detect the prodomain of BDNF and not the mature peptide.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
The recombinant prodomain fragment of human brain-derived neurotrophic factor
Applications:
ELISA,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
ELISA, Western Blot, biological neutralization of proBDNF, Immunocytochemistry/Immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Proform brain derived neurotrophic factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed to react with purified human proBDNF, crossreact with mouse and rat proBDNF Cross reactivity with other species than human, mouse and rat has not yet been tested
Storage:
After reconstitution keep aliquots at -20ºC for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Alpha-synuclein Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
Alpha synuclein is an abundant 140 amino acid neuronal protein, expressed primarily at presynaptic terminals in the central nervous system. Alpha synuclein has been associated with several neurodegenerative diseases. A point mutation in the gene coding for the alpha-synuclein protein was the first discovery linking this protein to a rare familial form of Parkinson's disease (PD). Subsequently, other mutations in the alpha-synuclein gene have been identified in familial PD. The aggregated proteinaceous inclusions called Lewy bodies found in PD and cortical Lewy body dementia (LBD) were discovered to be predominantly alpha-synuclein. Aberrant aggregation of alpha-synuclein has been detected in an increasing number of neurodegenerative diseases, collectively known as synucleopathies. Alpha-synuclein exists physiologically in both soluble and membrane-bound states, in unstructured and alpha-helical conformations, respectively. The physiological function of alpha-synuclein appears to require its translocation between these subcellular compartments and interconversion between the 2 conformations. Abnormal processing of alpha-synuclein is predicted to lead to pathological changes in its binding properties and function.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (PQEGILEDMPVDPC) of human alpha synuclein protein (aa: 108-120) conjugated to diphtheria toxoid has been used as the immunogen.
Applications:
IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
IHC. Recommended to be used at a concentration of 1 µg/mL for immunohistochemistry (Paraffin sections). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Immunihistochemical analysis of human and rat brain indicates a high level of specificity for this antiserum. Specificity was also confirmed by western blot. This antiserum is known to react with human and rat alpha synuclein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified and dialysed against PBS. Contains 0.02% sodium azide.
Sheep anti-Beta-synuclein Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Beta-synuclein is a non-amyloid component of senile plaques found in Alzheimer disease. It could act as a regulator of SNCA aggregation. It protects neurons from staurosporine and 6 hydroxy dopamine -stimulated capspase activation in a p53-dependent manner. It localises to the cytoplasm and it is predominantly expressed in the brain where it is most concentrated in presynaptic nerve terminals. This protein is phosphorylated. This protein is also associated with the disease Brain iron accumulation type 1 (NBIA1).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Affinity purified and dialysed against PBS. Contains 0.02% sodium azide.
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (IEPLMEPEGSYEDPPQE) of human beta synuclein protein (aa: 108-125) conjugated to diptheria toxid has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
IgG
Application Details:
IHC. A working concentration of 1 µg/mL is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
SNCB
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Known to be specific for beta synuclein. This antiserum is known to react with beta synuclein of human, rat and other rodents.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Alpha synuclein is an abundant 140 amino acid neuronal protein, expressed primarily at presynaptic terminals in the central nervous system. Alpha synuclein has been associated with several neurodegenerative diseases. A point mutation in the gene coding for the alpha-synuclein protein was the first discovery linking this protein to a rare familial form of Parkinson's disease (PD). Subsequently, other mutations in the alpha-synuclein gene have been identified in familial PD. The aggregated proteinaceous inclusions called Lewy bodies found in PD and cortical Lewy body dementia (LBD) were discovered to be predominantly alpha-synuclein. Aberrant aggregation of alpha-synuclein has been detected in an increasing number of neurodegenerative diseases, collectively known as synucleopathies. Alpha-synuclein exists physiologically in both soluble and membrane-bound states, in unstructured and alpha-helical conformations, respectively. The physiological function of alpha-synuclein appears to require its translocation between these subcellular compartments and interconversion between the 2 conformations. Abnormal processing of alpha-synuclein is predicted to lead to pathological changes in its binding properties and function.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (CMPVDPDNEAYEMPSEE) of human alpha synuclein protein (aa: 116-131) conjugated to diphtheria toxoid has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC): 1-4 µg/mL (paraffin sections)<br>Western Blotting (WB): 0.5 - 2.0 µg/mL. Fixing of proteins on membrane with 0.4% formaldehyde (30 min at room temperature) recommended, see Lee & Kamitani, 2011.<br>Flow Cytometry: 2 µg antibody per ~10^6 cells, methanol-fixed.<br>Immunocytochemistry (ICC): 1-4 µg/mL, 4% formaldehyde-fixed cells.<br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Kuo Y.M. et al. (2010) Extensive enteric nervous system abnormalities in mice transgenic for artificial chromosomes containing Parkinson disease-associated alpha-synuclein gene mutations precede central nervous system changes. Hum Mol Genet. May 1;19(9):1633-50 Pelkonen A. et al. (2010) Stimulated dopamine overflow and alpha-synuclein expression in the nucleus accumbens core distinguish rats bred for differential ethanol preference. J Neurochem. 2010 Aug;114(4):1168-76. Alves et al. (2008) Striatal and nigral pathology in a lentiviral rat model of Machado-Joseph disease Hum Mol Genet. 2008 Jul 15;17(14):2071-83.
Specificity:
This antiserum specifically detects alpha synuclein. This antibody is known to react with alpha synuclein of human, mouse, rat and other rodents.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified and dialysed against phosphate buffered saline (PBS).
FUNCTION: Involved in redox regulation of the cell. Can reduce hydrogen peroxide and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. SUBUNIT: Homotetramer. May interact with HTR2A. SUBCELLULAR LOCATION: Cytoplasm. Lysosome. Also found in lung secretory organelles. MISCELLANEOUS: The active site is the redox-active Cys-47 oxidized to Cys-SOH. Cys-SOH may rapidly react with a Cys-SH of the other subunit to form an intermolecular disulfide with a concomitant homodimer formation. The enzyme may be subsequently regenerated by reduction of the disulfide by thioredoxin . MISCELLANEOUS: Irreversibly inactivated by overoxidation of Cys-47 (to Cys-SO(3)H) upon oxidative stress. SIMILARITY: Belongs to the ahpC/TSA family. Rehydrin subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Rat recombinant Peroxiredoxin-6
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works superbly in Immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 100 to 1: 1000 depending on tissue and detection method. For western blotting a dilution range of 1: 500 to 1: 2000 is recommended. A dilution of 1: 1000 to 1: 2000 is recommended for ELISA. This antiserum stains the cytoplasm of epithelial cells in the rat and mouse lung and rat and human brain astrocytes. It stains human brain astrocytes in Parkinson's and Alzheimer 's disease and the central core of some Lewy bodies in Parkinson's disease and dementia with Lewy bodies. Other tissues have not yet been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
This antibody has been shown to be specific for Peroxiredoxin-6 protein. Rat, human and mouse, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Glutathione peroxidase 1 has a role in detoxification of hydrogen peroxide and is one of the most important antioxidant enzymes in humans. It exists as a homotetramer which localises to the cytoplasm. It belongs to the glutathione peroxidase family. Glutathione peroxidase 1 is one of few proteins in higher vertebrates to contain selenocysteine, which occurs at the active site of glutathione peroxidase and is coded by UGA, that normally functions as a translation termination codon. This protein has a polyalanine sequence polymorphism in the N-terminal region, which includes three alleles with five, six or seven alanine repeats. The allele with five alanine repeats is significantly associated with breast cancer risk. Two alternatively spliced isoforms have been identified.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (RRYSRRFQTIDIEPDIEALL) corresponding to the amino acids 175-194 of human lutathione peroxidase 1 ( GPx-1) conjugated to diphtheria toxin has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. This antibody works superbly in Immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 2000 to 1: 20000 depending on tissue and detection method. For western blotting a dilution range of 1: 10000 to 1: 100000 is recommended. For ELISA, a dilution of 1: 2000 to 1: 20000 is recommended. This antiserum has extremely high titre, it stains human and rat brain microglia intensely and to some extent also stains neurons. Other tissues have not yet been tested. On Western blotting under reducing conditions recognises a 22kD protein in human brain tissue and Sigma glutathione peroxidase (G-4013) isolated from human erythrocytes. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
This antibody has been shown to be specific for glutathione peroxidase 1 (GPx-1) protein. Human and rat, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Sheep anti-C-reactive protein Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
C-reactive protein has several roles associated with host defence such as; promoting agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. COFACTOR: Binds 2 calcium ions per subunit. C-reactive protein exists as a homopentamer. Pentaxin (or Pentraxin) have a discoid arrangement of 5 non-covalently bound subunits. There are 2 alternatively spliced isoforms. C-reactive protein is found in plasma and its concentration increases greatly during acute phase response to tissue injury, infection or other inflammatory stimuli. It is induced by IL-1 and IL-6.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with 0.01% Thimerosal
Host Animal:
Sheep
Species Reactivity:
Human
Immunogen:
Human recombinant C-Reactive protein
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. Extremely high titre antibody. For western blot a dilution of 1: 10,000 to 1: 100000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
CRP; PTX1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
It has been shown to be specific for C-reactive protein by WB. Human, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent.
LRRK2 is a member of the leucine-rich repeat kinase family. It role is yet unknown but it may play a role in the phoshorylation of proteins central to parkinson diseases. LRRK2 contains an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a mLK-like domain and a WD40 domain. LRRK2 is present in the cytoplasm but also associates with the mitochondrial outer membrane. Defects in LRRK2 are the cause of Parkinson disease 8 (PARK8). Parkinson disease is characterised by bradykinesia, resting tremor, muscular rigidity and postural instability, as well as by a clinically significant response to treatment with levodopa. The pathology involves the loss of dopaminergic neurons in the substantia nigra and the presence of Lewy bodies (intraneuronal accumulations of aggregated proteins), in surviving neurons in various areas of the brain. PARK8 is an autosomal-dominant late-onset parkinsonism, characterized by onset from 50 to 65 years, with slow progression and relatively benign course.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human
Immunogen:
A synthetic peptide (LKRKRKILSSDDSLRSS; aa 946-962) as part of human LRRK2 protein conjugated to the Blue Carrier Protein has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution range of 1:500-1:10000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Sheep anti-Gamma-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Gamma synuclein belongs to the synuclein family which are believed to be involve in the pathogenesis of neurodegenerative diseases. High levels of gamma synuclein have been identified in andvanced breast carcinomas suggesting a correlation between gamma synuclein overexpression and breast tumor development. Gama synuclein plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway. SUBUNIT: May be a centrosome-associated protein. SUBCELLULAR LOCATION: Cytoplasm; perinuclear region. Centrosome. Spindle. Associated with centrosomes in several interphase cells. In mitotic cells, localized to the poles of the spindle. TISSUE SPECIFICITY: Highly expressed in brain, particularly in the substantia nigra. Also expressed in the corpus callosum, heart, skeletal muscle, ovary, testis, colon and spleen. Weak expression in pancreas, kidney and lung. PTM: Phosphorylated. Phosphorylation by GRK5 appears to occur on residues distinct from the residue phosphorylated by other kinases. DISEASE: Brain iron accumulation type 1 (NBIA1, also called Hallervorden-Spatz syndrome), a rare neuroaxonal dystrophy, is histologically characterized by axonal spheroids, iron deposition, Lewy body (LB)-like intraneuronal inclusions, glial inclusions and neurofibrillary tangles. SNCG is found in spheroids but not in inclusions.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (EKEEVAEEAQSGGD) as part of human gamma synuclein protein (114-127) conjugated to diphteria toxid has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, WB. A concentration of 2-5 µg/mL is recommended for both applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Persyn; Breast cancer-specific gene 1 protein; Synoretin; SR; SNCG
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Immunohistochemical/western blot anlysis indicate a high level of specificity for this antiserum for gamma synuclein. This antiserum is known to react with human and rat gamma synuclein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified and dialysed against PBS. Contains 0.02% sodium azide.
SUMO-1 binds to a wide range of target proteins as part of a post-translational modification system. Unlike ubiquitin, it does not seem to target protein for degradation, but is involved in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis, apoptosis, protein stability and signal transduction. SUBUNIT: Covalently attached to a number of proteins such as PmL, RANGAP1, HIPK2, SP100, p53, p73alpha, MDM2, JUN and DNMT3B. Also interacts with HIF1A, HIPK2, HIPK3, CHD3, PIAS1, EXOSC9, TDG, RAD51 and RAD52. SUBCELLULAR LOCATION: Nucleus; nuclear membrane. Nucleus; nucleoplasm; nuclear speckle. Cytoplasm. SIMILARITY: Belongs to the ubiquitin family. SMT3 subfamily. SIMILARITY: Contains 1 ubiquitin-like domain. PTM: Cleavage of the last four amino acids of the carboxy-terminus of the precursor form by SENP1 or SENP2 is necessary for function. Several pseudogenes have been reported as well as a number of alternatively spliced isoforms.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (AKPSTEDLGDKKEGEY) as part of human SUMO-1 peptide (aa: 6-21) conjugated to diphtheria toxoid has been used as the immunogen. This antigen is homologous with SUMO-1 of rat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1:2000 to 1:4000 is recommended for immunohistochemistry and 1:4000 to 1:8000 for western blot. Cell lysate from Hela and NIH-3T3 cell lysates may be used as a positive control, and for IHC, lung carcinoma may be used. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Small ubiquitin-related modifier 1; Ubiquitin-like protein SMT3C; SMT3 homolog 3; Ubiquitin-homology domain protein PIC1; Ubiquitin-like protein UBL1; GAP-modifying protein 1; GMP1; Sentrin; SUMO1; SMT3C; SMT3H3; UBL1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum recognises human SUMO-1 and not ubiquitin. This antiserum is known to cross react with rat and human SUMO-1.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Connexin-40 (Cx40) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
FUNCTION: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low molecular weight diffuse from one cell to a neighboring cell. SUBUNIT: A connexon is composed of a hexamer of connexins. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein. TISSUE SPECIFICITY: Highly expressed in lung. SIMILARITY: Belongs to the connexin family. Alpha-type (group II) subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Rat
Immunogen:
A synthetic peptide consisting of amino acids 254 to 270 of the C-terminus of rat Cx40 (Cx40/254) conjugated to diphtheria toxoid has been used as the immunogen.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
<br><b>Immunohistochemistry</b>: Antibody detects Cxn 40 in rat tissues and arterial endothelial cells. The authors report that the density of Cx40 plaques was significantly greater in the caudal artery (CA) than in the thoracic aorta (ThA), whereas no such difference was seen for Cx37 and Cx43. Expression of Cx40 was absent from the media of both thoracic and caudal artery tissues (see Rummery, NM et al 2002 for more staining specifics). <br><b>Published Method</b>: Unfixed 10 µm thick sections cryosections or lightly fixed (2% paraformaldehyde in 0.1 mol/L sodium phosphate buffer) whole mount sections have been tested, see Rummery, NM et al 2002). Pretreatments include pre-incubation for 30 minutes in a blocking solution of 2% bovine serum albumin (BSA), 0.2% Triton-X in PBS, followed by primary antibody incubation. Antibody was used at 1:100 to 1:250 for 1 hour in the original work but Biosensis recommends optimizing the conditions for the best results. Original detection was via Cy3- conjugated anti-goat immunoglobulins (Jackson Immunoresearch Laboratories Inc, PA, 1:100) in 0.01% Triton-X in PBS, but other secondary conditions should work as well once optimized. In the original work the specificity of each antibody was tested by incubation either without primary antibody or with primary antibody that had previously been pre-incubated for 1 hour at room temperature with 10-fold excess by weight of the peptide against which the antibody was raised. (Adapted from Rummery, NM et al 2002).<br><b>Western Blot</b>: <U>Antibody is not recommended for western blots by Biosensis</u>, however, it does react in westerns with Cxn 40 specific material. The authors report that the antibody develops numerous bands in westerns blots, only some of which are removed upon peptide treatment (see Rummery, NM et al 2002). The Cx40/254 antibody specifically recognized a band of 40 kDa from lung, caudal artery (CA), and thoracic aorta (ThA) but not liver (online Figure VIIA, +/- peptide). In the lung, however, a band at 45 kDa also appeared to be reduced with Cxn 40 peptide addition.<br><b>Published Method</b>: Brain, heart, liver, lung, thoracic aorta and caudal arteries were removed from 5-6 week old Wistar rats and snap frozen in liquid nitrogen Tissues were ground under liquid nitrogen in a mortar and pestle and resuspended in 1mL of lysis buffer (1 mM NaHCO3 pH 7.05, 10 mM EDTA, 10 mM Iodoacetamide, 10 mM tetra-sodium pyrophosphate, 1 mM PMSF and 1 µg/mL each of antipain, aprotinin, pepstatin-A, chymostatin and leupeptin). Tissues were further disrupted by grinding in a polytron blender. Unbroken cells and large debris were removed by centrifugation at 1000 g for 5 minutes at 4oC, the supernatant was then removed and centrifuged at 3000 g for 5 minutes. The pellet was discarded, and the supernatant centrifuged at 20000 g for 15 minutes at 4°C. The supernatant was discarded, and the membrane-enriched pellet was resuspended in lysis buffer. Protein concentration was measured using the Bio-Rad protein assay kit. Membrane-bound connexins were subsequently solubilized by incubation in 2x SDS sample buffer (5% SDS, 125 mM Tris-Cl (pH 6.8), 20% glycerol, 2 mM _- mercaptoethanol, 0.1% (w/v) bromophenol blue) for 60 minutes at 37°C. Aliquots containing 5 µg of protein were separated by SDS-PAGE on 12% polyacrylamide gels and blotted onto PVDF membranes. Blots were probed with sheep antibodies against Cx40 (1:1000, Cx40/254) and detected via ECL using anti-Goat poly HRP secondary antibodies 1:4000, 1 hr. (<I>adapted from Rummery, NM et al 2002</I>).Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Gap junction alpha-5 protein; Cx40; Gja5; Cxn-40
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Original Reference Rummery NM, Hickey H, McGurk G, Hill CE. (2002) "Connexin37 is the major connexin expressed in the media of caudal artery. Arterioscler Thromb Vasc Biol. 22(9):1427-32. PMID: 12231561 This antibody is referred to as Cx40/254 in Rummery, NM et al 2002.
Specificity:
It is reported that the Cx40/254 antibody did not cross react with rat Cx43 but may with Cx45 in Western blots only (Rummery, NM et al 2002).
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Connexin-45 (Cx45) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Connexin-45 is a component of gap junctions, which are composed of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low molecular weight diffuse from one cell to a neighboring cell. SUBUNIT: A connexon is composed of a hexamer of connexins. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein. SIMILARITY: Belongs to the connexin family. Alpha-type (group II) subfamily. Alternatively spliced isoforms have been described.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human
Immunogen:
A synthetic peptide (QAYSHQN NPHGPRE) as part of human Connexin-45 protein (aa: 354-367) conjugated to diphtheria toxoid has been used as the immunogen.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
<b>Immunohistochemistry:</b> Antibody detects sparse Cxn45-IR in caudal artery and heart tissue (see Rummery, NM et al 2002 for more staining specifics). Antibody was used at 1:100 to 1:250, but Biosensis recommends optimal dilutions/concentrations should be determined by the end user. In the original work the specificity of the antibody was shown by incubation either without primary antibody or with primary antibody that had previously been pre-incubated for 1 hour at room temperature with 10-fold excess by weight of the peptide against which the antibody was raised.<br><br><b>Western Blot:</b> Antibody is not recommended for western blotting by Biosensis, however, it does react in westerns with Cxn 45 specific material. The authors report that the antibody develops numerous bands in westerns blots, only some of which are removed upon peptide treatment (see Rummery, NM et al 2002). The Cx45/354 antibody revealed the presence of a specific 45-kDa band in all tissues tested, although it was very weak in the arteries. A higher molecular weight band, which was blocked by peptide, was also seen in the brain (see Rummery, NM et al 2002, online Figure VIIB, -/+ peptide).
Alternative Names:
Gap junction gamma-1 protein; Gap junction alpha-7 protein; Cx45; GJC1; GJA7
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Original Reference Rummery NM, Hickey H, McGurk G, Hill CE. (2002) "Connexin37 is the major connexin expressed in the media of caudal artery. Arterioscler Thromb Vasc Biol. 22(9):1427-32. PMID: 12231561 This antibody is referred to as Cx45/354 in Rummery, NM et al 2002.
Specificity:
Western blotting of cell membranes of COS cells transiently transfected with cDNA encoding Connexin-45 shows a singular band of molecular weight 47 kDa which is abolished by preincubation with the immunising peptide. No such band is detected in western blots of membranes from non-transfected cells or cells transfected with cDNA encoding Connexin-37 or Connexin-40. This antiserum reacts to human Connexin-45.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Seems to promotes the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human, mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Primate,Rat
Immunogen:
Recombinant human NT4
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA (1 site), Western Blot, inhibition of biological activity in vitro/in vivo. Recommended to be used at a concentration of 2-10 µg/mL for immunohistochemistry, ELISA and Western blot and inhibition of biological activity in vitro. Use neat for in vivo studies at 2-10 µg/mL (ED50). Note that the concentration of NT4 is generally low in most tissues nevertheless, neonatal testes of rat can be used as a good positive control. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Beros J et al. (2021) Age Related Response of Neonatal Rat Retinal Ganglion Cells to Reduced TrkB Signaling in vitro and in vivo. Front Cell Dev Biol. 9:671087. Application: Rat, Block/Inhibit. Beros J (2020) Pretreatment of ovaries with collagenase before vitrification keeps the ovarian reserve by maintaining cell-cell adhesion integrity in ovarian follicles. PhD Thesis Application: Rat, Block/Inhibit. Feron F et al. (2008) Neurotrophin expression in the adult olfactory epithelium. Brain Res. 1196:13-21 Application: Rat, IHC.
Specificity:
Less than 1% cross-reactivity against NGF, recombinant human BDNF and 5% to NT3 has been shown by dot blot. Known to react with NT4 from rat and human, mouse and monkey.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Primate,Rat
Immunogen:
Recombinant human NT4
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA (1 site), Western Blot, dot blot, inhibition of biological activity in vitro/in vivo. Recommended to be used at a dilution of 1:500 to 1:2000 for immunohistochemistry, ELISA and Western blot. 1:10 to 1:50 for inhibition of biological activity in vitro. Use neat for in vivo studies at 5-10 µL/g body weight. Note that the concentration of NT4 is generally low in most tissues nevertheless, neonatal testes of rat can be used as a good positive control. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Less than 1% cross-reactivity against NGF, recombinant human BDNF and 5% to NT3 has been shown by 1-site ELISA. Known to react with NT4 from rat and human, mouse and monkey.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
Recombinant human NT3
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. This antiserum will neutralise NT3 but not other neurotrophins. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% to mouse NGF, recombinant human BDNF and 5% to NT4/5 has been shown by 1-site ELISA. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
Recombinant human NT3
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA, WB, dot blot, inhibition of biological activity. A dilution of 1:200 to 1:2000 is recommended for IHC, ELISA and western blot. For inhibition of biological activity: 1:10-50 for in vitro, 5-10 µL/g body weight for in vivo. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% to mouse NGF, recombinant human BDNF and 5% to NT4/5 has been shown by 1-site ELISA. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human, mouse and rat NT3 protein conjugated to BSA
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human, mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A dilution of 1:500 to 1:2000 is recommended for IHC, western blot. For inhibition of biological activity: 1:10-50 for in vitro, 5-10 µL/g body weight for in vivo. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. It stimulates division and differentiation of sympathetic and embryonic sensory neurons. SUBUNIT: Homodimer, associated by noncovalent forces. SUBCELLULAR LOCATION: Secreted protein. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Avian,Human,Mouse,Rat
Immunogen:
Native mouse beta NGF purified from submaxillary salivary gland (95% purity by PAGE)
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, 1-site ELISA, WB, immunoblot, inhibition of biological activity. A concentration of 1-3 µg/mL is recommended for IHC, western blot and immunoblot, ELISA, inhibition of biological activity in vitro. Use neat for in vivo studies at 2-10 µg/mL (ED50). This antiserum completely inhibits neuronal survival and the outgrowth actions of murine NGF in chicken DRG in vitro. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Beta-nerve growth factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Feron F et al (2008) Neurotrophin expression in the adult olfactory epithelium. Brain Res. 1196:13-21 Application: IHC ; Species: Rat
Specificity:
A cross reactivity of less than 1% to recombinant human BDNF, NT3, NT4/5 by ELISA has been shown. This antiserum is known to cross react with mouse, rat, human and avian NGF but not bovine NGF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. It stimulates division and differentiation of sympathetic and embryonic sensory neurons. SUBUNIT: Homodimer, associated by noncovalent forces. SUBCELLULAR LOCATION: Secreted protein. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Avian,Human,Mouse,Rat
Immunogen:
Native mouse beta NGF purified from submaxillary salivary gland (95% purity by PAGE)
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, 1-site ELISA, WB, immunoblot, inhibition of biological activity. A concentration of 1-3 µg/mL is recommended for IHC, western blot and immunoblot, ELISA, inhibition of biological activity in vitro. Use neat for in vivo studies at 2-10 µg/mL (ED50). This antiserum completely inhibits neuronal survival and the outgrowth actions of murine NGF in chicken DRG in vitro. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Beta-nerve growth factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
A cross reactivity of less than 1% to recombinant human BDNF, NT3, NT4/5 by ELISA has been shown. This antiserum is known to cross react with mouse, rat, human and avian NGF but not bovine NGF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. It stimulates division and differentiation of sympathetic and embryonic sensory neurons. SUBUNIT: Homodimer, associated by noncovalent forces. SUBCELLULAR LOCATION: Secreted protein. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Avian,Human,Mouse,Rat
Immunogen:
Native mouse beta NGF purified from submaxillary salivary gland (95% purity by PAGE)
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, 1-site ELISA, WB, immunoblot, inhibition of biological activity. A dilution of 1:1000-1:5000 is recommended for IHC, western blot and immunoblot; 1:15000 for ELISA; for inhibition of biological activity: 1:10-50 for in vitro, 5-10 µL/g body weight for in vivo. This antiserum completely inhibits neuronal survival and the outgrowth actions of murine NGF in chicken DRG in vitro. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Beta-nerve growth factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
A cross reactivity of less than 1% to recombinant human BDNF, NT3, NT4/5 by ELISA has been shown. This antiserum is known to cross react with mouse, rat, human and avian NGF but not bovine NGF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. SUBUNIT: Heterodimer. Interacts with DSIPI; this interaction inhibits the binding of active AP1 to its target DNA. Interacts with MAFB. SUBCELLULAR LOCATION: Nucleus. INDUCTION: C-fos expression increases upon a variety of stimuli, including growth factors, cytokines, neurotransmitters, polypeptide hormones, stress and cell injury. SIMILARITY: Belongs to the bZIP family. Fos subfamily. SIMILARITY: Contains 1 bZIP domain
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Hamster,Human,Rabbit,Rat
Immunogen:
A synthetic peptide (MFSGFNADYEASSSRC; aa 2-17) conjugated to diphtheria toxoid has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from cFos protein human, rat, mouse, hamster and cat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IH on PFA fixed, frozen tissues. Not yet tested on formalin fixed, paraffin embedded tissue but expected to react. Affinity purified antibody is extremely powerful. A concentration of 1 -5 µg/mL is recommended most uses with short (1-8 hour) incubations. If using enhanced brightfield or amplified detection methods dilutions and long primary antibody incubations dilutions will need to be increased substantially to inhibit background staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.<br><br>Not recommended for western blotting applications. Mouse monoclonal antibody M-1752-100 or rabbit polyclonal antibody R-1751-50 are excellent alternatives for western blotting.
Alternative Names:
Proto-oncogene protein cFOS; c-FOS
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum shows a high level of specificity for cFOS confirmed by immunohostochemistry. This antiserum is known to react with rat, rabbit and hamster cFOS.
Storage:
Store lyophilized product at 2-8°C. After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Pan-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Detects human alpha-, beta-, and gamma synuclein proteins. A family of homologous proteins known as alpha-, beta-, and gamma-synuclein are abundantly expressed in brain, especially in the presynaptic terminal of neurons. Although the precise function of these proteins remains unknown, alpha-synuclein has been implicated in synaptic plasticity associated with avian song learning as well as in the pathogenesis of Parkinson's disease (PD), dementia with LBs (DLB), some forms of Alzheimer's disease (AD), and multiple system atrophy (MSA).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (AKEGVVAAAEKTKQGV) as a consensus part of human alpha-, beta-, and gamma synuclein proteins conjugated to diphteria toxoid has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, WB. A concentration of 3 µg/mL is recommended for immunohistochemistry (frozen & paraffin embedded sections) and 1 µg/mL for western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Overlap specific immunohistochemical staining of alpha-, beta- and gamma synucleins This antiserum recognises human and rat alpha-, beta- and gamma synucleins.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified and dialysed against PBS. Contains 0.02% sodium azide.
Sheep anti-Beta-synuclein Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Beta-synuclein is a non-amyloid component of senile plaques found in Alzheimer disease. It could act as a regulator of SNCA aggregation. It protects nerurons from staurosporine and 6 hydroxy dopamine -stimulated capspase activation in a p53-dependent manner. It localises to the cytoplasm and it is predominantly expressed in the brain where it is most concentrated in presynaptic nerve terminals. This protein is phosphorylated. This protein is also associated with the disease Brain iron accumulation type 1 (NBIA1).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (IEPLMEPEGSYEDPPQE) as part of human beta synuclein protein (aa: 108-125) conjugated to diphteria toxid has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:3000 to 1:8000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
SNCB
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Known to be specific for beta synuclein. This antiserum is know to react with human, rat and other rodent beta synuclein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Ancient ubiquitous protein 1 (AUP1) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
AUP1 contains a domain with homology to the ancient conserved region of the archain 1 gene and a domain thay may be involved in binding ubiquitin-conjugating enzymes. The unprocessed precusor is of 476 amino acids in length and has an estimated molecular weight of 53 kDa. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing.TISSUE SPECIFICITY: Ubiquitous. SIMILARITY: Belongs to the AUP1 family. SIMILARITY: Contains 1 CUE domain.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Bovine,Human,Rat,Sheep
Immunogen:
A synthetic peptide (HVFLVSCALPDSV) corresponding to the amino acids 48-60 of human ancient ubiquitous protein 1 conjugated to Blue carrier protein has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from bovine, mouse and rat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. Use at a dilution of 1:500 to 1:6000. This antiserum works superbly in both paraffin embedded and frozen tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
AUP1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum is specific for ancient ubiquitous protein 1. This antibody is known to react with bovine, sheep, human and rat ancient ubiquitous protein 1. Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. SUBUNIT: Heterodimer. Interacts with DSIPI; this interaction inhibits the binding of active AP1 to its target DNA. Interacts with MAFB. SUBCELLULAR LOCATION: Nucleus. INDUCTION: C-fos expression increases upon a variety of stimuli, including growth factors, cytokines, neurotransmitters, polypeptide hormones, stress and cell injury. SIMILARITY: Belongs to the bZIP family. Fos subfamily. SIMILARITY: Contains 1 bZIP domain
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Hamster,Human,Rabbit,Rat
Immunogen:
A synthetic peptide (MFSGFNADYEASSSRC; aa 2-17) conjugated to diphtheria toxoid has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from cFos protein human, rat, mouse, hamster and cat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC: Use at an amount of 10 µg/mL with an incubation time of 1-3 days at 4ºC. This antiserum works in paraffin and 4% PFA fixed frozen sections. Penetration is the key to success. Over-fixed tissue is problematic. Not recommended for western blotting applications. Mouse monoclonal antibody M-1752-100 or rabbit polyclonal antibody R-1751-50 are excellent alternatives for western blotting. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
c-Fos; Proto-oncogene protein cFOS; cellular oncogene fos; G0/G1 switch regulatory protein 7; FOS; G0S7
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum shows a high level of specificity for c-FOS confirmed by immunohistochemistry. This antiserum is known to react with rat and rabbit and hamster cFOS.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
CNTF is a survival promoting factor for different types of neurons in vitro and in vivo. The essential structural features for the biological function of human CNTF were investigated by Thier, M. et al. They showed that deletion of 14 N-terminal and 18 C-terminal amino acids significantly increased bioactivity compared to wild-type CNTF. FUNCTION: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. TISSUE SPECIFICITY: Nervous system. PHARMACEUTICAL: CNTF is being tested under the name Axokine by Regeneron Pharmaceuticals for treatment of human motor neuron diseases, such as amyotrophic lateral sclerosis (ALS). As it induces substantial weight loss, preferentially of fat as opposed to lean body mass, it is being used for obesity treatment. SIMILARITY: Belongs to the CNTF family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human CNTF
Applications:
ELISA,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. A dilution of 1:500 to 4000 is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Ciliary neurotrophic factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody specifically detects CNTF shown by western blot. This antiserum to known to react with rat, mouse and human CNTF protein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Sheep anti-Alpha-synuclein Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Alpha synuclein is an abundant 140 amino acid neuronal protein, expressed primarily at presynaptic terminals in the central nervous system. Alpha synuclein has been associated with several neurodegenerative diseases. A point mutation in the gene coding for the alpha-synuclein protein was the first discovery linking this protein to a rare familial form of Parkinson's disease (PD). Subsequently, other mutations in the alpha-synuclein gene have been identified in familial PD. The aggregated proteinaceous inclusions called Lewy bodies found in PD and cortical Lewy body dementia (LBD) were discovered to be predominantly alpha-synuclein. Aberrant aggregation of alpha-synuclein has been detected in an increasing number of neurodegenerative diseases, collectively known as synucleopathies. Alpha-synuclein exists physiologically in both soluble and membrane-bound states, in unstructured and alpha-helical conformations, respectively. The physiological function of alpha-synuclein appears to require its translocation between these subcellular compartments and interconversion between the 2 conformations. Abnormal processing of alpha-synuclein is predicted to lead to pathological changes in its binding properties and function.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (CMPVDPDNEAYEMPSEE) as part of human alpha synuclein (aa: 116-131) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC with 1:1000 to 1:2000 dilution. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Wu W et al. (2022) "Intermediate-length CGG repeat expansion in NOTCH2NLC is associated with pathologically confirmed Alzheimers disease" Neurobiol. Aging 80(1):447-458; Application: IHC Species: Human Cong C et al. (2021) "Contribution of Alzheimer's Disease Neuropathologic Change to the Cognitive Dysfunction in Human Brains with Lewy Body-Related Pathology." J Alzheimers Dis. 80(1):447-458; Application: IHC Species: Human Zhang W et al. (2020) "Contribution of Alzheimer's Disease Neuropathologic Change to the Cognitive Dysfunction in Human Brains with Lewy Body-Related Pathology." Neurobiol. Aging [In press]; Application: IHC Species: Human
Specificity:
Immunohistochemistry shows a high specificity for alpha-synuclein. This antibody is known to react with human, rat and mouse alpha-synuclein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Myelin basic protein (MBP) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Myelin is a membrane characteristic of the nervous tissue and functions as an insulator to increase the velocity of the stimuli being transmitted between a nerve cell body and its target. Myelin isolated from human and bovine nervous tissue is composed of approximately 80% lipid and 20% protein, and 30% of the protein fraction constitutes myelin basic protein (MBP). MBP is an 'intrinsically unstructured' protein with a high proportion (approximately 75%) of random coil, but postulated to have core elements of beta-sheet and alpha-helix. MBP is a major protein in CNS myelin and is expressed specifically in the nervous system. A detailed immunochemical examination of monoclonal and polyclonal antibody responses to MBP and its peptides has revealed the existence of as many as 27 antigenic determinants, many of them conformational. Topological mapping of the potential antigenic determinants onto a model of MBP secondary structure places these determinants within 11 separate regions of the molecule, including those portions that have been found to be encephalitogenic. The message for myelin basic protein is selectively translocated to the ends of the cell processes. Immunization with myelin-associated antigens including MBP significantly promotes recovery after spinal cord contusion injury in the rat model. FUNCTION: Is, with PLP, the most abundant protein component of the myelin membrane in the CNS. Has a role in both the formation and stabilization of this compact multilayer arrangement of bilayers. Each splice variant and charge isomer may have a specialized function in the assembly of an optimized, biochemically functional myelin membrane (By similarity). SUBUNIT: Homodimer (By similarity). SUBCELLULAR LOCATION: Myelin membrane; peripheral membrane protein; cytoplasmic side. Cytoplasmic side of myelin. TISSUE SPECIFICITY: Found in both the central and the peripheral nervous system. PTM: At least 5 charge isomers; C1 (the most cationic, least modified, and most abundant form), C2, C3, C4 and C5 (the least cationic form); are produced as a result of optional posttranslational modifications such as phosphorylation of serine or threonine residues, deamidation of glutamine or asparagine residues, citrullination and methylation of arginine residues. C1 and C2 are unphosphorylated, C3 and C4 are monophosphorylated and C5 is phosphorylated at two positions. SIMILARITY: Belongs to the myelin basic protein family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Guinea Pig,Human,Rat
Immunogen:
A synthetic peptide (YG SLPQKSQRSQ DENPVV, aa: 68-86) as part of guinea pig MBP protein conjugated to KLH
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:1000 to 1:4000 is recommended. Immunostaining for MBP of abnormal appearing oligodendrocytic process and cell bodies in demyelinating areas. This antibody recognises only areas of myelin degeneration when tested in injured spinal cord and lesioned sciatic nerves. It also stains discrete white matter in the brain of multiple system atrophy. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Myelin Basic Protein
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum recognizes MBP in demyelinated nerve tissues. Immunohistochemical analysis of lesioned rat spinal cord indictaes a high level of specificity for this antiserum. This antiserum reacts with human and rat MBP.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
GDNF is a glycosylated, disulfide-bonded homodimer molecule. It was first discovered as a potent survival factor for midbrain dopaminergic neurons and was then shown to rescue these neurons in animal models of Parkinson's disease. GDNF is about 100 times more efficient survival factor for spinal motor neurons than the neurotrophins. FUNCTION: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. DISEASE: Defects in GDNF may be a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, defects in GDNF may be involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. DISEASE: Defects in GDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human GDNF
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. Recommended to be used at a dilution of 1:1000 to 1:3000 for Western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
No cross reactivity with NTN has been observed in western blot analysis. This antibody is known to react with human, mouse and rat GDNF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
GDNF is a glycosylated, disulfide-bonded homodimer molecule. It was first discovered as a potent survival factor for midbrain dopaminergic neurons and was then shown to rescue these neurons in animal models of Parkinson's disease. GDNF is about 100 times more efficient survival factor for spinal motor neurons than the neurotrophins. FUNCTION: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. DISEASE: Defects in GDNF may be a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, defects in GDNF may be involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. DISEASE: Defects in GDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human GDNF
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, WB. A dilution of 1 µg/mL is recommended for both applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
No cross reactivity with NTN has been observed in western blot analysis. This antibody is known to react with human, mouse and rat GDNF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
BDNF belongs to the neurotrophin family and promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. POst translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human BDNF
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, Inhibition of biological activity in vitro/in vivo. Recommended to be used at a dilution of 1:200-2000 for immunohistochemistry on Zamboni's fixed frozen tissue; not recommended for formalin fixed paraffin embedded tissues. 1:10 to 1:50 for inhibition of biological activity in vitro. Use neat for in vivo studies at 5-10 µL/g body weight. Whole serum format will caused immune responses, purified format is preferred for most in vivo work. Not recommended for western blots. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% against mouse NGF, recombinant human NT3 or NT4/5 has been shown by one site ELISA. This antiserum recognises BDNF from rat, mouse and human.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
BDNF belongs to the neurotrophin family and promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. Post translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
Recombinant human BDNF
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, Inhibition of biological activity in vitro/in vivo, ELISA. Recommended to be used at an amount of 1-10 µg/mL for immunohistochemistry on Zamboni's fixed, frozen tissue. Not recommended for paraffin embedded tissues. Primary use is for biological activity in vitro and in vivo. Use neat for in vivo studies at 2-10 µg/mL (ED50). This antibody does not react to BDNF in western blot, thus western blot is not a recommended application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Beros J. et al. (2021) Age Related Response of Neonatal Rat Retinal Ganglion Cells to Reduced TrkB Signaling in vitro and in vivo. Front Cell Dev Biol. 9:671087. Beros J. (2020) Pretreatment of ovaries with collagenase before vitrification keeps the ovarian reserve by maintaining cell-cell adhesion integrity in ovarian follicles. PhD Thesis. Hayashida K., Eisenach JC. (2010) Spinal alpha2-adrenoceptor-mediated analgesia in neuropathic pain reflects brain-derived nerve growth factor and changes in spinal cholinergic neuronal function. Anesthesiology. 2010 Aug;113(2):406-12. Geremia NM. et al. (2010) Endogenous BDNF regulates induction of intrinsic neuronal growth programs in injured sensory neurons. Exp Neurol. 2010 May;223(1):128-42.
Specificity:
A cross reactivity of less than 1% against mouse NGF, recombinant human NT3 or NT4/5 has been shown by one site ELISA. Known to react with BDNF from rat and human.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Neurturin (NTN) is a member of the GDNF family of neurotrophic factors. This protein is a potent survival factor for several populations of central and peripheral neurons in mature and developing rodents. FUNCTION: Supports the survival of sympathetic neurons in culture. May regulate the development and maintenance of the CNS. Might control the size of non-neuronal cell population such as haemopoietic cells. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. DISEASE: Defects in NRTN are a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, and possibly with other loci, defects in NRTN are involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human Neurturin (rh NTN)
Applications:
ELISA,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, immunoblot, 1-site ELISA. Recommended to be used at a dilution of 1:2000-3000 for immunohistochemistry and Western blot, 1: 2000 to 1:4000 for ELISA. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neurturin; NRTN;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Dot blot shows no cross reactivity to GDNF. This antibody is known to react with human, mouse and rat. Not yet tested against other species.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Fibroblast growth factors (FGFs), a heparin binding growth factor, exhibit widespread mitogenic and neurotrophic activities in a variety of different cells including mesenchymal, neuroectodermal and endothelial cells. aFGF (FGF-1) and bFGF (FGF-2) are present in relatively high levels in CNS. aFGF is expressed by a subset of neuronal populations, while bFGF is expressed by astrocytes, both lack signal peptides. Human bFGF is a 17.2 kDa protein containing 155 amino acid residues. FUNCTION: The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors. SUBUNIT: Monomer. Interacts with CSPG4 and FGFBP1. Found in a complex with FGFBP1, FGF1 and FGF2. MISCELLANEOUS: This protein binds heparin more strongly than does aFGF. SIMILARITY: Belongs to the heparin-binding growth factors family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human basic FGF
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC (frozen), WB. Recommended to be used at a dilution of 1: 1000 to 1:2000 for both applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Lee HJ et al (2010) Effects of sevoflurane on collagen production and growth factor expression in rats with an excision wound. Acta Anaesthesiol Scand. 2010 Aug;54(7):885-93.
Specificity:
A high level of specificity for bFGF was shown by immunohistochemistry for this antiserum. This antibody is known to react with human, mouse and rat basic FGF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rat Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rat Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rat Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rat Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Sheep IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.25 M Sodium Chloride, pH 7.6
Reconstitution:
Rehydrate with 1.5 ml of deionized water and centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on Sheep IgG · light chains on all Sheep immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin Sheep serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on sheep IgG · light chains on all sheep immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin sheep serum proteins
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
25 mM Tris, 150 mM NaCl, 5 mM MgCl2, 0.12 mM ZnCl2, 2 mM Sodium Azide (pH7.4)
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 2 mM Sodium Azide
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
2-8 °C, DO NOT FREEZE
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
25 mM Tris, 150 mM NaCl, 5 mM MgCl2, 0.12 mM ZnCl2, 2 mM Sodium Azide (pH7.4)
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 2 mM Sodium Azide
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
25 mM Tris, 150 mM NaCl, 5 mM MgCl2, 0.12 mM ZnCl2, 2 mM Sodium Azide (pH7.4)
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 2 mM Sodium Azide
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
R-Phycoerythrin (R-PE)
Form:
Lyophilized
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
1mg/ml
Conjugate:
DyLight® 650 (Ex = 652 nm; Em = 672 nm)
Form:
Liquid
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 2 mM Sodium Azide
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
DyLight® 550
Form:
Liquid
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
1mg/ml
Conjugate:
DyLight® 488 (Ex = 493 nm; Em = 518 nm)
Form:
Liquid
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store at 2-8°C for use within 1-3 weeks or -20°C for long term storage, avoid repeat freeze thaws.
Specificity:
Mouse IL6
Cross Reactivity:
Not Tested Against Other Species
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified Whole Molecule Mouse IgG
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Llama IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Llama IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
AAQ19986
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
AAQ19986
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
AAQ19986
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
AAQ19986
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human gACRP-30
Cross Reactivity:
Not Tested Against Other Species
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human Omentin
Cross Reactivity:
Not Tested Against Other Species
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Na/K Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store at 2-8°C for use within 1-3 weeks or -20°C for long term storage, avoid repeat freeze thaws.
Specificity:
Human IL6
Cross Reactivity:
Not Tested Against Other Species
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 0.11 ml of deionized water and let stand 30 minutes at room temperature to dissolve. Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Specificity:
Human Resistin
Cross Reactivity:
Not Tested Against Other Species
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human Visfatin
Cross Reactivity:
Not
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Storage:
2-8 °C
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Storage:
2-8 °C
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgM (µ chain)
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (µ) chains on human IgM
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins · light chains on all human immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgM (µ chain)
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (µ) chains on human IgM
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins · light chains on all human immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgM (µ chain)
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (µ) chains on human IgM
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins · light chains on all human immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgM (µ chain)
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (µ) chains on human IgM
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins · light chains on all human immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (µ) chains on human IgM
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins · light chains on all human immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: ¢heavy (γ) chains on human IgG ¢light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: ¢non-immunoglobulin human serum proteins ¢Mouse IgG and serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified human IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
CAA10835
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified human IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
CAA10835
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · goat IgG, F(ab)2 fragment · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · goat IgG, F(ab)2 fragment · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · goat IgG, F(ab)2 fragment · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · goat IgG, F(ab)2 fragment · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · Goat IgG F(ab)'2 fragment
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · Goat IgG F(ab)'2 fragment
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · Goat IgG F(ab)'2 fragment
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · Goat IgG F(ab)'2 fragment
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 0.55 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 0.55 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 0.55 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to:<br>ââ¬Ã¢ non-immunoglobulin goat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Guinea Pig IgG
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Guinea Pig IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on guinea pig IgG · light chains on all guinea pig immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin guinea pig serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Guinea Pig IgG
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Guinea Pig IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on guinea pig IgG · light chains on all guinea pig immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin guinea pig serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Guinea Pig IgG
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Guinea Pig IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on guinea pig IgG · light chains on all guinea pig immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin guinea pig serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Guinea Pig IgG
Purity:
> 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Guinea Pig IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on guinea pig IgG · light chains on all guinea pig immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin guinea pig serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on cat IgG · light chains on all cat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin cat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Chicken IgG/Y, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on chicken IgG/Y · light chains on all chicken immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin chicken serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Chicken IgG/Y, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on chicken IgG/Y · light chains on all chicken immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin chicken serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Chicken IgG/Y, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on chicken IgG/Y · light chains on all chicken immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin chicken serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on chicken IgG/Y · light chains on all chicken immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin chicken serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Bovine IgG (H&L)
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Bovine IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on bovine IgG · light chains on all bovine immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin bovine serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Bovine IgG (H&L)
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Bovine IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on bovine IgG · light chains on all bovine immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin bovine serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Bovine IgG (H&L)
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Bovine IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on bovine IgG · light chains on all bovine immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin bovine serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Bovine IgG (H&L)
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Bovine IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on bovine IgG · light chains on all bovine immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin bovine serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Bovine IgG (H&L)
Purity:
> 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Bovine IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on bovine IgG · light chains on all bovine immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin bovine serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10mM Sodium Phosphate, 0.5 M Sodium Chloride, pH 7.6
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
2 mM Sodium Phosphate, 0.03 M Sodium Chloride, pH 7.8, 10 mg/ml Sucrose
Preservative:
0.04% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Rabbit anti-Beta Amyloid Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
The beta Amyloid peptide is derived from the cleavage of the Amyloid precursor protein and varies in length from 39 to 43 amino acids. Beta amyloid peptides are the major constituents of the plaques and tangles that occur in Alzheimer's disease.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (DAEFRHDSGYEVHH) conjugated to bovine serum albumin (BSA) corresponding to amino acid sequence 1-14 of mature human beta amyloid.
Applications:
ELISA
Antibody Isotype:
Mixed
Application Details:
ELISA. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human beta amyloid, cross reactivity to APP has not bee tested.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
Fox3 is one of a family of mammalian homologues of Fox-1. The Fox proteins are about 46 kDa in size, and each includes a central highly conserved RRM type RNA recognition motif. Much interest has focused on Fox3 as a result of the recent finding that this protein corresponds to NeuN, a neuronal nuclear antigen. NeuN/Fox-3 has a function in RNA splicing and is expressed heavily and specifically in neuronal nuclei and cytoplasm. Our antibody was raised against the N-terminal 100 amino acids of human Fox3 as expressed in and purified from E. coli. We did not use full length Fox3 as immunogen since the three mammalian Fox homologues, namely Fox1, Fox2 and Fox3, include virtually identical RRM motifs. The N-terminal region of the three molecules are much more variable in the three molecules so antibodies specific for each of the three molecules can therefore be generated.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Peptide corresponding to amino acids 5-24 of human FOX3 coupled to KLH.
Applications:
ICC,IHC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:500 - 1:1,000 is recommended for WB. A dilution of 1:5,000 - 1:10,000 is recommended for ICC and IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Feminizing locus on X; Fox-1; Fox3; NeuN; NeuN antigen; Neuronal nuclei antigen; Fox-1 homolog C; RNA binding protein fox-1 homolog 3
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Rabbit Polyclonal Antibody to Neurofilament NF-L C-terminus (Unconjugated), suitable for WB, IF, ICC.
Background Info:
Neurofilaments are the 10nm or intermediate filament proteins found specifically in neurons, and are composed predominantly of three major proteins called NF-L, NF-M and NF-H, though other filament proteins may be included also. The major function of neurofilaments is likely to control the diameter of large axons. NF-L is the neurofilament light or low molecular weight polypeptide and runs on SDS-PAGE gels at 68-70kDa with some variability across species. Antibodies to NF-L are useful for identifying neuronal cells and their processes in cell culture and sectioned material. NF-L antibody can also be useful for the visualization of neurofilament rich accumulations seen in many neurological diseases, such as Lou Gehrigs disease (ALS), giant axon neuropathy, Charcot-Marie Tooth disease and others.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Pig,Rat
Immunogen:
C-terminal synthetic peptide of rat NF-L protein,(GEEEDTKESEEEEKKEESAGEEQAAKKKD) with an N-terminal Cys for coupling to KLH.
Applications:
FC,ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (IHC) and Flow Cytometry (2 ug per 10^6 cells). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:100 - 1:500 is recommended for IC and IH. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neurofilament light polypeptide; 68 kDa neurofilament protein; Neurofilament triplet L protein
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Physical State:
Solid
Product references:
Bacioglu M et al. (2016) Neurofilament light chain in blood and CSF as a marker of disease progression in mouse models and in neurodegenerative diseases. Neuron. 27292537 Application: Mouse and Human.
Specificity:
No cross reactivity with other proteins.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Rabbit anti-Pan-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, FC.
Background Info:
A family of homologous proteins known as alpha-, beta-, and gamma-synuclein are abundantly expressed in brain, especially in the presynaptic terminal of neurons. Although the precise function of these proteins remains unknown, alpha-synuclein has been implicated in synaptic plasticity associated with avian song learning as well as in the pathogenesis of Parkinson's disease (PD), dementia with LBs (DLB), some forms of Alzheimer's disease (AD), and multiple system atrophy (MSA).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.2-7.6, containing 0.1% trehalose without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (AKEGVVAAAEKTKQGV) as a consensus part of human alpha-, beta-, and gamma synuclein proteins has been used as the immunogen.
Applications:
FC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (0.5-2 ?g/mL). Flow Cytometry (10-20 ?g/mL). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Immunogen epitope location:
Amino acids 11-26 of human alpha-synuclein protein.
Immunogen length:
16 amino acids.
Physical State:
Solid.
Specificity:
This antibody recognises human, mouse, rat alpha-, beta- and gamma-synuclein.
Storage:
After reconstitution keep aliquots at -20°C for long-term stability. Working aliquots can be kept at 2-8°C for up to 4 weeks, or longer with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Product Validation Info:
Validated by western blotting and flow cytometry.
Purification:
Purified by affinity chromatography against the peptide immunogen.
Rabbit anti-Beta-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Non-amyloid component of senile plaques found in Alzheimer disease. Could act as a regulator of SNCA aggregation process. Protects neurons from staurosporine and 6-hydroxy dopamine (6OHDA)-stimulated caspase activation in a p53/TP53-dependent manner. Contributes to restore the SNCA anti-apoptotic function abolished by 6OHDA. Not found in the Lewy bodies associated with Parkinson disease (Ref: uniprot.org).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Full-length human recombinant ?-synuclein protein expressed in and purified from E. Coli.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:2,000) and Immunohistochemistry (frozen sections, 1:1,000-1:2,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Beta-synuclein, ?-synuclein
Biosensis Brand:
Biosensis®
Cellular Localisation:
Intracellular, cytosolic.
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Immunogen length:
Full-length recombinant protein.
Physical State:
Solid.
Specificity:
Specific for ?-synuclein, does not cross-react with ?- or ?-synuclein.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Product Validation Info:
Validated by western blotting and immunohistochemical procedures.
Purification:
Affinity-purified from rabbit serum using the immunogen.
Rabbit anti-Microtubule-associated protein Tau (MAPT) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
FUNCTION: Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization. SUBCELLULAR LOCATION: Cytoplasm; cytosol. Cell membrane. Mostly found in the axons of neurons, in the cytosol and in association with plasma membrane components. ALTERNATIVE PRODUCTS: 8 named isoforms produced by alternative splicing. Additional isoforms seem to exist. Isoforms differ from each other by the presence or absence of up to 5 of the 15 exons. One of these optional exons contains the additional tau/MAP repeat. TISSUE SPECIFICITY: Expressed in neurons. Isoform PNS-tau is expressed in the peripheral nervous system while the others are expressed in the central nervous system. DEVELOPMENTAL STAGE: Four-repeat (type II) tau is expressed in an adult-specific manner and is not found in fetal brain, whereas three-repeat (type I) tau is found in both adult and fetal brain. DOMAIN: The tau/MAP repeat binds to tubulin. In Alzheimer disease, the neuronal cytoskeleton in the brain is progressively disrupted and replaced by tangles of paired helical filaments and straight filaments, mainly composed of hyperphosphorylated forms of Microtubule-associated protein Tau. Defects in Microtubule-associated protein Tau are a cause of frontotemporal dementia and parkinsonism linked to chromosome 17, as well as a number of other neurodegenerative diseases.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Pig
Immunogen:
Recombinant human Microtubule-associated protein Tau, purified from E.coli.
Applications:
ELISA,WB
Antibody Isotype:
Mixed
Application Details:
WB and direct ELISA (Human). For WB a dilution of 1:500 is recommended. This antibody has been shown to detect the purified recombinant Tau expressed in E.Coli as well as a number of Tau isoforms in porcine cytosol. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neurofibrillary tangle protein; Paired helical filament-tau; PHF-tau; MAPT; MTBT1; TAU
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Ballaz S, Morales I, Rodriguez M, Obeso JA. (2013) Ascorbate prevents cell death from prolonged exposure to glutamate in an in vitro model of human dopaminergic neurons. J. Neurosci Res. Aug 30 2013 [E print]
Specificity:
Specificity was demonstrated by western blot. 20ng recombinant Tau is easily detected with smaller fragments likely representing degradation products from the purified protein, which has been expressed in E. Coli. This antiserum is known to react with human and pig Microtubule-associated Tau proteins. Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Green fluorescent protein (GFP) Polyclonal Antibody (Unconjugated), suitable for WB, IHC.
Background Info:
The green fluorescent protein (GFP) is a 27 kDa protein isolated originally from the jellyfish Aequoria victoria. It has an endogenous fluorochrome activity with excitation maximum at 395nm and emission maximum at 509 nm, which is similar to that of fluorescein. GFP can be expressed in fluorescent form in essentially any prokaryotic or eukaryotic cell. This GFP rabbit antibody was made against a recombinant GFP construct originating from an Aequoria species which was engineered to improve spectral properties and prevent oligomerization (1). This form of GFP, referred to as AcGFP, is 94% identical to the eGFP developed by Tsien and co-workers. The antibody can be used to verify the expression, size and stability of both AcGFP and eGFP fusion proteins in western blotting experiments and to amplify GFP signals in tissues of transgenic animals.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Species Independent
Immunogen:
Recombinant AcGFP purified from E. coli
Applications:
IHC,WB
Antibody Isotype:
IgG
Application Details:
Immunocytochemistry (1:2,000 - 1:5,000) and Western Blot (1:1,000 - 1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Aequorea victoria green fluorescent protein
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
GFP, cross reactivity with other mutant forms is expected as immunogen was a whole molecule GFP
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
LRRK2 is a member of the leucine-rich repeat kinase family. Its role is yet unknown but it may play a role in the phoshorylation of proteins central to parkinson diseases. LRRK2 contains an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a mLK-like domain and a WD40 domain. LRRK2 is present in the cytoplasm but also associates with the mitochondrial outer membrane. Defects in LRRK2 are the cause of Parkinson disease 8 (PARK8). Parkinson disease is characterised by bradykinesia, resting tremor, muscular rigidity and postural instability, as well as by a clinically significant response to treatment with levodopa. The pathology involves the loss of dopaminergic neurons in the substantia nigra and the presence of Lewy bodies (intraneuronal accumulations of aggregated proteins), in surviving neurons in various areas of the brain. PARK8 is an autosomal-dominant late-onset parkinsonism, characterized by onset from 50 to 65 years, with slow progression and relatively benign course.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (CLKRKRKILSSDDSLRSS) corresponding to amino acids 946 - 962 of the human LRRK2 protein conjugated to diptheria toxin was used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
IgG
Application Details:
IHC. A dilution range of 1:500 to 1:1000 is recommended. Other applications have not yet been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity was demonstrated by immunohistochemistry. The antibody stains positive tangles in inferior temporal cortex of human brain affected by Alzheimer's disease. This antiserum has been successfully tested in human. Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Ubiquitin Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, ICC.
Background Info:
Ubiquitin is a highly conserved 76 amino acid protein with an estimated molecular weight of 8.56 kDa which has a central role in regulated protein degradation. It is a protein modifier which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Several types of polymeric chains can be formed depending on the lysine used for the assembly. Attachment to proteins as a polymer leads to their degradation by the 26S proteosome; a complex, multicatalytic cytosolic and nuclear protease. Attachment to proteins as a monomer or as an alternatively linked polymer does not lead to proteasomal degradation and may be required for numerous functions, including maintenance of chromatic structure, regulation of gene expression, stress response, ribosome biogenesis and DNA repair. Ubiquitin is synthesized as a polyubiquitin precursor with exact head to tail repeats, the number of repeats of which differ between species and strains. In some species there is a final amino-acid after the last repeat, here in bovine a Cys. Some ubiquitin genes contain a single copy of ubiquitin fused to a ribosomal protein (either L40 or S27a).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.2, 100mM NaCl, 15mM sodium azide.
Ubiquitin isolated from cow erythrocytes and conjugated to chicken gammaglobulins with glutaraldehyde.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
This antibody is recommended for IHC, WB and immunoprecipitation. This antibody can be used for labelling formalin-fixed, paraffin-embedded tissue sections at a dilution range of 1:150 to 1:300. This antibody is also useful for investigating neurodegenerative diseases such as Alzheimer 's disease and Parkinson's disease. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
RPS27A; UBA52; UBB; UBC
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been determined by indirect ELISA against ubiquitin conjugated to keyhole limpet haemocyanin. The antibody does not react with kehole limpet haemocyanin alone. Specificity has also been demonstrated by WB against endometrial tissue homogenates. Cross reacts with human, baboon and rat ubiquitin. Other species have not been tested. Ubiquitin protein sequence is 100% conserved in all higher mammals and most eukarotes.
Storage:
After reconstitution keep aliquots at -20°C for higher stability or at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation. Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
C-terminal peptide of human IBA1 protein coupled to KLH.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunohistochemistry (1:2,000-1:5,000); Immunocytochemistry (1:1,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Allograft inflammatory factor 1, AIF-1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human, Rat, Mouse.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Nestin Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Required for brain and eye development. Promotes the disassembly of phosphorylated vimentin intermediate filaments (IF) during mitosis and may play a role in the trafficking and distribution of IF proteins and other cellular factors to daughter cells during progenitor cell division. Required for survival, renewal and mitogen-stimulated proliferation of neural progenitor cells (By similarity). Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Part of recombinant human protein (amino acids 315-630).
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunocytochemistry (1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human. Other species not tested.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Methyl-CpG- binding protein 2 (MeCP2) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Chromosomal protein that binds to methylated DNA. It can bind specifically to a single methyl-CpG pair. It is not influenced by sequences flanking the methyl-CpGs. Mediates transcriptional repression through interaction with histone deacetylase and the corepressor SIN3A. Binds both 5-methylcytosine (5mC) and 5-hydroxymethylcytosine (5hmC)-containing DNA, with a preference for 5-methylcytosine (5mC). Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (REEPVDSRTPVTERVS, aa: 471-486) of C-terminus of human protein.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunohistochemistry (1:1,000) Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
CNPase
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human, Mouse, Rat.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Laminin-111 Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organisation of cells into tissues during embryonic development by interacting with other extracellular matrix components. Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
Laminin-111 isolated from mouse EHS cells
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunohistochemistry (1:1,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Laminin 1, Laminin _1_1_1.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Mouse,reacts with Mouse and Rat, other species not tested. This antibody recognizes laminin isotypes alpha-1 (440 kDa), beta-1 (220 kDa) and gamma-1 (220 kDa). It also binds laminin binding protein at 120 kDa which always co-expresses with laminin.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Ki-67 Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly (PubMed:27362226). Associates with the surface of the mitotic chromosome, the perichromosomal layer, and covers a substantial fraction of the chromosome surface (PubMed:27362226). Prevents chromosomes from collapsing into a single chromatin mass by forming a steric and electrostatic charge barrier: the protein has a high net electrical charge and acts as a surfactant, dispersing chromosomes and enabling independent chromosome motility (PubMed:27362226). Binds DNA, with a preference for supercoiled DNA and AT-rich DNA (PubMed:10878551). Does not contribute to the internal structure of mitotic chromosomes (By similarity). May play a role in chromatin organization (PubMed:24867636). It is however unclear whether it plays a direct role in chromatin organization or whether it is an indirect consequence of its function in maintaining mitotic chromosomes dispersed (Probable). Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant human Ki-67 protein (amino acids 1,111-1,490) expressed in and purified from <i>E. coli.</i>
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:2,000-1:10,000) and Immunocytochemistry (1:1,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
KI-67
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human only. Does not react with Mouse or Rat.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
May participate in RNA metabolism in the myelinating cell, CNP is the third most abundant protein in central nervous system myelin. Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Full-length recombinant human protein
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunocytochemistry (1:1,000-1:2,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human, Rat, Mouse.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Calretinin is a calcium-binding protein which is abundant in auditory neurons. Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Rat
Immunogen:
Full-length recombinant human protein
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:5,000-1:10,000), Immunohistochemistry (1:5,000-1:10,000) and Immunocytochemistry (1:1,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
CR, 29 kDa calbindin
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human, Cow, Rat, Mouse. Antibody is specific for calretinin and does not recognize closely related proteins parvalbumin and calbindin as determined by Western Blotting.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Beta casein protein Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Beta-casein has an important role in determination of the surface properties of the casein micelles. it is cleaved into 3 chains (casoparan, casohypotensin and antioxidant peptide). Casoparan acts as a macrophage activator, increasing the phagocytic activity of macrophages and peroxide release from macrophages. It also acts as a bradykinin-potentiating peptide. Casohypotensin acts as a bradykinin-potentiating peptide and induces hypotension in rats. Acts as a strong competitive inhibitor of endo-oligopeptidase A. Antioxidant peptide has antioxidant activity (ref: uniprot.org.).<br /><br />Bovine milk contains two types of beta-casein protein, A2 or A1. Recent studies have shown that milk containing the A1 beta casein protein can contribute to issues including gastrointestinal discomfort after ingestion. There is some evidence of a link between ingestion of A1 beta casein protein and the development of Type 1 diabetes.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS, pH 7.4, with 0.02% sodium azide as preservative. Refer to the product label for antibody concentration.
Host Animal:
Rabbit
Species Reactivity:
Bovine
Immunogen:
Bovine beta-casein peptides
Applications:
ELISA,WB
Antibody Isotype:
IgG
Application Details:
ELISA and western blotting (1:5,000 - 1: 20,000). Do not use skim milk for blocking and dilution of assay reagents, BSA is recommended. Biosensis recommends that optimal working dilutions should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Physical State:
Liquid.
Product references:
Indyk HE et al. (2021) The determination of intact ?-casein in milk products by biosensor immunoassay. J. Food Compos. Anal. 101:103946 Application: Immunoassay.
Specificity:
Bovine beta-casein. Detects both A1 and A2 beta-casein isoforms.
Storage:
Spin vial briefly before opening and centrifuge to remove any insoluble material. After opening maintain at -20°C in undiluted aliquots for up to 6 months. For short-term storage, keep aliquot at 2-8°C for up to one week. Avoid repeated freeze-thaw cycles.
BDNF belongs to the neurotrophin family and promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. Post translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Immunogen:
A synthetic peptide (C-ELLDEDQKVRPNEE) as a part of human BDNF precursor protein (aa: 69-82) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, WB. 1-5 µg/mL is recommended for both applications, Flow Cytometry (2?g/10^6 cells). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Le Blanc J et al. (2020) Platelets Selectively Regulate the Release of BDNF, But Not That of Its Precursor Protein, proBDNF. Front Immunol. 11:575607 Application: Human, WB. Macias M et al. (2007) Locomotor exercise alters expression of pro-brain-derived neurotrophic factor, brain-derived neurotrophic factor and its receptor TrkB in the spinal cord of adult rats. Eur J Neurosci. 25(8):2425-44 Application: Rat
Specificity:
Used in western blot, this antiserum detects a 35 kDa band corresponding to the molecular weight of proBDNF. No cross reactivity with other proneurotrophins was detected. This antibody is known to react with human, mouse and rat proBDNF and also expected to recognise other mammalian proBDNF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human (aa: 139-149), mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. In the heterodimer, FOS and JUN/AP-1 basic regions each seems to interact with symmetrical DNA half sites. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. In growing cells, activates phospholipid synthesis, possibly by activating CDS1 and PI4K2A. This activity requires Tyr-dephosphorylation and association with the endoplasmic reticulum. SUBUNIT: Heterodimer. Interacts with DSIPI; this interaction inhibits the binding of active AP1 to its target DNA. Interacts with MAFB. SUBCELLULAR LOCATION: Nucleus. INDUCTION: C-fos expression increases upon a variety of stimuli, including growth factors, cytokines, neurotransmitters, polypeptide hormones, stress and cell injury. SIMILARITY: Belongs to the bZIP family. Fos subfamily. SIMILARITY: Contains 1 bZIP domain (Ref: uniprot.org).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Full length, E.coli-derived recombinant human c-FOS protein.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Immunocytochemistry (ICC): 1:2,000-1:10,000.<br><br>Immunohistochemistry (IHC): 1:20,000-1:50,000. This antibody has been shown to work on 4% PFA fixed mouse brain sections. Note that non-specific staining has been observed on tissue sections when using this antibody at dilutions of 1:5,000 or lower.<a class="newA" target="_blank" href="https://www.biosensis.com/documents/enhancedinfo/R-1751-50_IHC Method_as_at_March2018.pdf"> Click here </a> for instructions on use of this antibody in IHC on free-floating brain sections.<br><br>Western blotting (WB): 1:1,000-1:2,000. This antibody detects bands between 50-65 kDa, which only appear in stimulated cells. <br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Cellular oncogene fos; G0/G1 switch regulatory protein 7; cFOS
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Lin King JV (2020). Stinging Sensations: Activation Mechanisms of the Wasabi Receptor, TRPA1. PhD Thesis. Application: IHC (IF) . Species: Mouse. Lin King JV et al. (2019). A Cell-Penetrating Scorpion Toxin Enables Mode-Specific Modulation of TRPA1 and Pain. Cell. [Epub ahead of print]. Application: IHC . Species: Mouse.
Storage:
Store lyophilized, unopened vial at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Activity-regulated gene 3.1 protein homolog (Arg3.1) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Arc (also termed activity-regulated cytoskeleton-associated protein or Arg3.1), is an effector immediate early gene whose upregulation has been demonstrated during events of synaptic plasticity. Arg3.1 expression is detectable in neuronal cell bodies and dendrites in the brain regions including striatum and cortex hippocampus, hypothalamus, amygdala.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide from the C terminal of human Arg3.1 protein (ARC protein) conjugated to Blue Carrier Protein. The sequence is homologous with mouse and rat form of Arg3.1.
Applications:
IHC-Frozen
Antibody Isotype:
IgG
Application Details:
IHC. A concentration of of 2-4 µg/mL is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specific for Arg3.1. Rat and Mouse. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Protein G purified IgG
Target:
Activity-regulated gene 3.1 protein homolog (Arg3.1)
The protein named TrkB (also named Neurotrophic tyrosine kinase receptor type 2 (NTRK2), GP145-TrkB or Tropomyosin-related kinase B is a receptor tyrosine kinase involved in the development and the maturation of the central and the peripheral nervous systems and is important in the regulation of neuron survival, proliferation, migration, differentiation, and synapse formation and plasticity. TrkB may also play a role in neutrophin-dependent calcium signaling in glial cells and mediate communication between neurons and glia. TrkB is the primary receptor for BDNF (brain-derived neurotrophic factor. TrkB also binds NT4 and NT3 but less efficiently. Upon ligand-binding, the receptor undergoes homodimerization, autophosphorylation and activation. TrkB activation recruits, phosphorylates and/or activates several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that each regulate distinct overlapping signaling cascades within cells. Through SHC1, FRS2, SH2B1, SH2B2, these activate the GRB2-Ras-MAPK cascade that regulates, for instance, neuronal differentiation including neurite outgrowth. These same effectors also control the Ras-PI3 kinase-AKT1 signaling cascade that mainly regulates growth and survival. TrkB, via activation of PLCG1 and the downstream protein kinase C-regulated pathways, also controls synaptic plasticity, and thus plays a role in learning and memory by regulating both short term synaptic function and long-term potentiation. PLCG1 also leads to NF-Kappa-B activation and the transcription of genes involved in cell survival. One such consequence is that PLCG1 activation via TrkB is able to suppress anoikis, the apoptosis resulting from loss of cell-matrix interactions. (Reference: www.uniprot.org)
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized.
Host Animal:
Rabbit
Species Reactivity:
Chicken (Predicted),Human,Mouse,Rat
Immunogen:
Synthetic peptide immunogen, SNDDDSA[pS]PLHHIS
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
<b>Western Blotting (0.5 - 2 µg/mL).</b> Cell lysates or membrane preparations prepared from isolated brain or spinal cord tissues are recommended. This antibody works on skim milk blocked membranes, however, best results are obtained with a equal mixture of 2.5% skim milk / 2.5% highly purified BSA as blocking reagent and antibody diluent.<br><b>Immunohistochemistry (1 - 5 µg/mL).</b> Antibody has been shown to work on PFA fixed, frozen sections. TBS is preferred for buffer preparation.<br> Other applications have not been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Detects full-length TrkB phosphorylated at amino acid S479 in humans (S478 in mouse and rat).
Physical State:
Solid
Positive Control:
Retinoic acid- and BDNF-treated NSC34 cells
Product references:
Turnbull MT et al. (2018), Acute Down-regulation of BDNF Signaling Does Not Replicate Exacerbated Amyloid-? Levels and Cognitive Impairment Induced by Cholinergic Basal Forebrain Lesion. Front Mol Neurosci. 2018 Feb 22;11:51. Species: Mouse ; Application: WB, hippocampal lysates. Matusica D et al. (2016), Inhibition of motor neuron death in vitro and in vivo by a p75 neurotrophin receptor intracellular domain fragment. J Cell Sci. 2016 Feb 1;129(3):517-30. doi: 10.1242/jcs.173864. Epub 2015 Oct 26. Species: Mouse ; Application: WB, spinal cord lysates.
Specificity:
Human TrkB (pS478). Antibody has been shown to be specific for TrkB phosphorylated on serine 478 by phospho-peptide absorption dot blots, and on cell lysates from cell lines induced with retinoic acid and BDNF. Antibody detects a clear band in retinoic acid (RA) and BDNF-treated NSC34 cell lysates at ~120 kDa only, demonstrating that the phosphorylated TrkB receptor is being detected. Additional non-specific bands at lower molecular weight may be observed in lysates and homogenates with the antibody and these bands have not been characterized.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Product Validation Info:
Antibody is specific for TrkB serine phosphorylation at amino acid 478/479 (rodents/human). Lambda-phosphatase treatment obliterates positive staining.
The protein named TrkB (also named Neurotrophic tyrosine kinase receptor type 2 (NTRK2), GP145-TrkB or Tropomyosin-related kinase B is a receptor tyrosine kinase involved in the development and the maturation of the central and the peripheral nervous systems and is important in the regulation of neuron survival, proliferation, migration, differentiation, and synapse formation and plasticity. TrkB may also play a role in neutrophin-dependent calcium signaling in glial cells and mediate communication between neurons and glia. TrkB is the primary receptor for BDNF (brain-derived neurotrophic factor. TrkB also binds NT4 and NT3 but less efficiently. Upon ligand-binding, the receptor undergoes homodimerization, autophosphorylation and activation. TrkB activation recruits, phosphorylates and/or activates several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that each regulate distinct overlapping signaling cascades within cells. Through SHC1, FRS2, SH2B1, SH2B2, these activate the GRB2-Ras-MAPK cascade that regulates, for instance, neuronal differentiation including neurite outgrowth. These same effectors also control the Ras-PI3 kinase-AKT1 signaling cascade that mainly regulates growth and survival. TrkB, via activation of PLCG1 and the downstream protein kinase C-regulated pathways, also controls synaptic plasticity, and thus plays a role in learning and memory by regulating both short term synaptic function and long-term potentiation. PLCG1 also leads to NF-Kappa-B activation and the transcription of genes involved in cell survival. One such consequence is that PLCG1 activation via TrkB is able to suppress anoikis, the apoptosis resulting from loss of cell-matrix interactions. (Reference: www.uniprot.org)
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized.
Host Animal:
Rabbit
Species Reactivity:
Chicken (Predicted),Human,Mouse,Rat (Predicted)
Immunogen:
Synthetic peptide immunogen, AKASPV[pY]LDILG
Applications:
WB
Antibody Isotype:
IgG
Application Details:
<b>Western Blotting (0.5 2 µg/mL).</b> High skim milk concentration (5%) causes suppression of pY817 signal, suggesting that 5% skim milk should be avoided as blocking buffer and antibody diluent. Strongest signal is obtained in 5% BSA blocking buffer, however, many non-specific bands are present. An equal mixture of skim milk and BSA (2.5% each) appears to provide the best compromise between signal and noise. However, optimization of blocking condition is recommended for each particular sample, with excess of BSA over skim milk likely to be beneficial for best results.<br><br>Other applications have not been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Detects full-length TrkB phosphorylated at amino acid Y817 in humans (Y816 in mouse and rat).
Physical State:
Solid
Positive Control:
Retinoic acid- and BDNF-treated NSC34 cells
Specificity:
Human TrkB (pY817). Antibody has been shown to be specific for TrkB phosphorylated on tyrosine 817 by phospho-peptide absorption dot blots, and on cell lysates from cell lines induced with retinoic acid and BDNF. Antibody detects a clear band in retinoic acid (RA) and BDNF-treated NSC34 cell lysates at ~120 kDa only, demonstrating that the phosphorylated TrkB receptor is being detected. While not fully tested, this antibody may detect phosphorylated TrkA (pY791/794, human/rodent) and TrkC (pY834/820/859, human/mouse/rat) due to high degree of amino acid homology surrounding the phosphorylation site.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Product Validation Info:
Antibody detects a clear band in retinoic acid (RA) and BDNF-treated NSC34 cell lysates at ~120 kDa only
Rabbit anti-Neuropeptide Y (NPY) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Neuropeptide Y is a 36 amino acid neurotransmitter found in the brain and autonomic nervous system. It has been associated with numerous physiologic processes in the brain, including the regulation of energy balance, memory and learning, and epilepsy. The main effect is increased food intake and decreased physical activity. It is also implicated in the secretion of gonadotrophin-release hormone. It is secreted by the hypothalamus and it is one of the most abundant peptides in the nervous system. It is also found in some chromaffin cells of the adrenal medulla. The sheep form of NPY is 94% homologous with human NPY.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat,Sheep
Immunogen:
Sheep Neuropeptide Y (29-64: NB. includes only the NPY peptide and not either of the flanking peptides) conjugated to keyhole limpet hemocyanin.
Corder KM et al. (2018) Prefrontal cortex-dependent innate behaviors are altered by selective knockdown of Gad1 in neuropeptide Y interneurons. PLoS One. 2018 Jul 19;13(7):e0200809 Application: IHC/IF, frozen sections.
Specificity:
Specificity has been confirmed by direct ELISA against the antigen. Sheep, Human, Mouse & Rat.
Storage:
Maintain lyophilized material at 2-8°C for up to 12 months. After reconstitution keep aliquots at -20°C for up to six months or at 2-8°C with an appropriate antibacterial agent for up to 4 weeks. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified on antigen column. Refer to vial label for antibody concentration after reconstitution.
GPx-P belongs to the glutathione peroxidase family which are responsible for the detoxification of hydrogen peroxide. It protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. GPx-P is secreted in plasma and exists as a homotetramer.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (FEKGDVNGEKEQKFYTFLKN) corresponding to the amino acids 135-154 of human glutathione peroxidase 3 (GPx-P) conjugated to diphtheria toxin has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from glutathione peroxidase 3 (GPx-P) protein in mouse, rat, orangutan and bovine.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC, only. A dilution o f 1: 1000 to 1: 5000 is recommended for immunohistochemistry depending on detection method but end user will need to determine dilution to suit application. Antigen retrieval is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
This antibody has been shown to be specific for glutathione peroxidase 3 protein (GPx-P) through staining and blocking studies. Human and rat, other species have not yet been ested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
BDNF belongs to the neurotrophin family and promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. POst translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from a solution containing PBS pH 7.4, 3% trehalose, with 0.05% sodium azide.
Host Animal:
Rabbit
Species Reactivity:
Human,Other Mammals (Predicted)
Immunogen:
Antibody was raised against a GST-tagged rhBDNF fusion protein and expressed in and purified from E. coli.
Applications:
ELISA
Antibody Isotype:
IgG
Application Details:
<b>Western Blotting (denaturing and reducing):</b> 0.2 to 1 µg/mL. Antibody detects 14 kDa mature BDNF monomer and 32 kDa proBDNF monomer in cell lysate and tissue homonenate. Antibody has only been tested on cell lysate and tissue homogenate of human origin. Acid-treated samples may give cleaner blots, and enhance signals for BDNF. R-1707-100 is not recommended for human serum samples. For human serum analysis, we recommend mouse monoclonal antibody to rhBDNF (M-1744-50/100), or rabbit polyclonal antibody to BDNF peptide 1-10 (R-083-100, whole serum; R-066-500, IgG).<br><br><b>Flow Cytometry:</b> ~2 µg per 10^6 cells, methanol fixation. Note: R-1707-100 cannot be used to distinguish the flow cytometry signal originating from mature BDNF versus proBDNF.<br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Brain-derived neurotrophic factor; Abrineurin
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human, rat and mouse BDNF. Expected to detect BDNF from other species due to sequence homology. No cross-reactivity with other neurotrophins.
Storage:
Store lyophilized antibody at 2-8°C protected from moisture. After reconstitution divide antibody into useful aliquots and keep aliquots at -20°C to -80°C for a higher stability. Working aliquots can be kept at 2-8°C for up to 1 month. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Phospho-calcium/calmodulin-dependent protein kinase type II subunit alpha, Thr253 (alpha-CaMKII, Thr253) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Calcium/calmodulin-stimulated protein kinase II (CaMKII) is composed of four different chains (alpha, beta, gamma, and delta) and is abundantly expressed in neurons. CaMKII is involved in regulating many aspects of neuronal function, including neurotransmitter synthesis and release, modulation of ion channel activity and cellular transport. The enzymatic function of CaMKII is regulated by its multiple phosphorylation sites and targeting to sub-cellular locations through interactions with protein binding partners. Phosphorylation of Thr253 has been identified in vivo and found to alter the interaction of CaMKII with binding partners, but not change its enzymatic activity. Thus, phosphorylation of Thr253 is suggested to modulate functional responses based on its binding partner and subsequently its sub-cellular localization.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Rat
Immunogen:
A synthetic peptide (NKmLpTINPSC) corresponding to the sequence around Thr253 (AA 249-257) in alpha-CaMKII was synthesized, purified to 95% purity by HPLC, analyzed by mass spectroscopy and coupled to diphtheria toxoid.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (1:200 - 1:1000). Other applications have not been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Skelding KA et al (2012) J J Cereb Blood Flow Metab 32 (12), 2181-2192. Skelding KA et al (2010) Cell Signal 22 (5), 759-769. Gurd JW et al (2008) Brain Res 1218, 158-165. Migues PV et al (2006) J Neurochem 98 (1), 289-299.
Specificity:
Rat Predicted from gene analysis to react with human and mouse alpha-CaMKII.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
Phospho-calcium/calmodulin-dependent protein kinase type II subunit alpha, Thr253 (alpha-CaMKII, Thr253)
Glyceraldehyde 3-Phosphate Dehydrogenase (GAPDH) is a metabolic enzyme responsible for catalyzing one step in the glycolytic pathway, the reversible oxidative phosphorylation of glyceraldehyde 3-phosphate. GAPDH may have other roles in the activation of transcription and in the regulation of apoptosis as well as Alzheimer's disease and Huntington's disease. The immunogen used to raise this particular antibody was extensively purified pig GAPDH. This antibody can be used as a loading control for western blotting experiments, allowing comparison between the level of this protein and others in a cell or tissue.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted)
Immunogen:
Full length recombinant human GAPDH expressed in and purified from E. coli
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:10,000-1:30,000 is recommended for WB. A dilution of 1:1,000-1:10,000 is recommended for ICC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rabbit anti-Vimentin Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Vimentin is the major protein subunit of the 10nm or intermediate filaments protein found in many kinds of mesenchymal and epithelia cells. Vimentin is also found in many kinds of cells in tissue culture and in developing neuronal and astrocytic precursor cells in the central nervous system. Vimentin frequently forms copolymers with other intermediate filament proteins, such as GFAP (in many kinds of astrocytes), with desmin (in muscle cells) and neurofilament proteins (in developing neurons). Antibodies to vimentin are useful in studies of stem cells and generally to reveal the filamentous cytoskeleton.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted)
Immunogen:
Recombinant human Vimentin purified from E. coli.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:1,000-5,000 is recommended for ICC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specific for the ~55 kDa Vimentin protein.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Lamin A/C Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
The Lamin proteins are members of the intermediate filament protein family but are located inside the nucleus rather than in the cytoplasm (1). The lamins function as skeletal components tightly associated with the inner nuclear membrane. Originally the proteins of the nuclear cytoskeleton were named Lamin A, B and C, from top to bottom as visualized on SDS-PAGE gels. Subsequently it was found that Lamins A and C were coded for by a single gene (2), while the Lamin B band may contain two proteins encoded by two genes now called Lamin B1 and Lamin B2. Lamin A has a mass of about 74 kDa while Lamin C is 65 kDa. The Lamin A protein includes 98 amino acids missing from Lamin C, while Lamin C has a C-terminal 6 amino acid peptide not present in Lamin A. Apart from these regions Lamin A and C are identical so that antibodies raised against either protein are likely to cross react with the other, as is the case with this monoclonal. Lamin polymerization and depolymerization is regulated by phosphorylation by cyclin dependent protein kinase 1 (CDK1), the key component of "maturation promoting factor", the central regulator of cell division. Activity of this kinase increases during cell division and is responsible for the breakdown of the nuclear lamina. Mutations in the LMNA gene are associated with several serious human diseases, including Emery-Dreifuss muscular dystrophy, familial partial lipodystrophy, limb girdle muscular dystrophy, dilated cardiomyopathy, Charcot-Marie-Tooth disease type 2B1, and Hutchinson-Gilford progeria syndrome. This family of diseases belong to a larger group which are often referred to as Laminopathies, though some laminopathies are associated in defects in Lamin B1, B2 or one or other of the numerous nuclear lamina binding proteins. A truncated version of lamin A, commonly known as progerin, causes Hutchinson-Gilford progeria syndrome, a form of premature aging (3).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Other Mammals (Predicted)
Immunogen:
Full length recombinant human Lamin C
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Immunocytochemistry (ICC) and Western Blotting (WB). A dilution of 1:1,000-1:5,000 is recommended for WB. A dilution of 1:1,000-1:5,000 is recommended for ICC. The optimal dilution should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Lamin A and Lamin C. The antibody reacts with a 74 kDa and 65 kDa band by Western blot on HeLa cell extract. It has also been used successfully for immunocytochemistry on HeLa cell cultures.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Spectrin, alpha II Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
The spectrin family of proteins were originally discovered as major components of the submembraneous cytoskeleton of osmotically lysed red blood cells (1). The lysed blood cells could be seen as clear red blood cell shaped objects in the light microscope and were referred to as red cell "ghosts". The major proteins of these ghosts proved to be actin, ankyrin, band 4.1 and several other proteins, including two major bands running at about 240 kDa and 260 kDa on SDS-PAGE gels. This pair of bands was named "spectrin" since they were discovered in these red blood cell ghosts (1). Later work showed that similar high molecular bands were seen in membrane preparations from other eukaryotic cell types. Work by Levine and Willard described a pair of about ~240-260 kDa molecular weight bands which were transported at the slowest rate along mammalian axons (2). They named these proteins "fodrin" as antibody studies showed that they were localized in the sheath under the axonal membrane, but not in the core of the axon (2; fodros is Greek for sheath). Subsequently fodrin was found to be a member of the spectrin family of proteins, and the spectrin nomenclature is now normally used (3). Spectrins form tetramers of two alpha and two beta subunits, with the alpha corresponding to the lower molecular weight ~240 kDa band and the beta corresponding to the ~260 kDa or in some case much larger band. Most spectrin tetramers are about 0.2microns or 200nm long, and each alpha and beta subunit has a cell type specific expression pattern. The basic structure of each spectrin subunit is the spectrin repeat, which is a sequence of about 110 amino acids which defines a compact domain contain three closely packed alpha-helices. Each spectrin subunit contains multiple copies of this repeat, with 20 in each of the alpha subunits. The beta I-IV subunits each contain 17 spectrin repeats, while the beta V subunit, also known as beta-heavy spectrin, contains 30 of these repeats. The various subunits also contain several other kinds of functional domain, allowing the spectrin tetramer to interact with a variety of protein, ionic and lipid targets. The alpha-subunits each contain one calmodulin like calcium binding region and one Src-homology 3 (SH3) domain, an abundant domain involved in specific protein-protein interactions. The beta subunits all have a N-terminal actin binding domain and may also have one SH3 domain and one pleckstrin homology domain, a multifunctional type of binding domain which in beta I spectrin at least binds the membrane lipid PIP2 (5). Spectrins are believed to have a function in giving mechanical strength to the plasma membrane since the tetramers associate with each other to form a dense submembraneous geodesic meshwork (3). They also bind a variety of other membrane proteins and membrane lipids, and the proteins they bind to are therefore themselves localized in the membrane. Diseases may be associated with defects in one or other of the spectrin subunits (6). For example, some forms of hereditary spherocytosis, the presence of spherical red blood cells which are prone to lysis, can be traced to mutations in some of the spectrin subunits (7). The alpha-II subunit is widely expressed in tissues but, in the nervous system, is found predominantly in neurons. The antibody can therefore be used to identify neurons and fragments derived from neuronal membranes in cells in tissue culture and in sectioned material.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
The antibody was raised against a mix of five recombinant constructs containing the entire C-terminal region of human alpha-II spectrin (amino acids 676-2,400).
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunocytochemistry (IC). Suggested dilution for WB is 1:5,000-10,000 and 1:500-1,000 for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The antibody reacts with a 240 kDa band by Western blot on mouse sciatic nerve extract. Minor bands below may be seen and this likely represents in vivo proteolytic fragments of alpha-II spectrin. It has also been used successfully for immunocytochemistry.
Storage:
Store lyophilized, unopened vial at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C to -80°C for a higher stability. Avoid freeze-thaw cycles.
FUNCTION: Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. SUBUNIT: Homotetramer. SUBCELLULAR LOCATION: Cytoplasm. Lysosome. Also found in lung secretory organelles. MISCELLANEOUS: The active site is the redox-active Cys-47 oxidized to Cys-SOH. Cys-SOH may rapidly react with a Cys-SH of the other subunit to form an intermolecular disulfide with a concomitant homodimer formation. The enzyme may be subsequently regenerated by reduction of the disulfide by thioredoxin . MISCELLANEOUS: Irreversibly inactivated by overoxidation of Cys-47 (to Cys-SO(3)H) upon oxidative stress. SIMILARITY: Belongs to the ahpC/TSA family. Rehydrin subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Rat recombinant Peroxiredoxin-6. The sequence is homologous in human and mouse peroxiredoxin-6.
Applications:
ELISA,ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works superbly in Immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 100 to 1: 1000 depending on tissue and detection method. For western blotting a dilution range of 1: 1000 to 1: 4000 is recommended. A dilution of 1: 1000 to 1: 4000 is recommended for ELISA. This antiserum stains the cytoplasm of epithelial cells in the rat and mouse lung and rat and human brain astrocytes. It stains human brain astrocytes in Parkinson's and Alzheimer 's disease and the central core of some Lewy bodies in Parkinson's disease and dementia with Lewy bodies. Other tissues have not yet been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Walsh B. et al. (2010) Overexpression of Prdx6 and resistance to peroxide-induced death in Hepa1-6 cells: Prdx suppression increases apoptosis. Redox Rep. 2009;14(6):275-84. Gardiner F. et al. (2010) Induction of Prdx1 and Prdx6 in Liver Cellsby Serum and TPA. Intl J. Biol. Vol. 2, No. 1
Specificity:
This antibody has been shown to be specific for Peroxiredoxin-6 protein. Rat, human and mouse, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Rabbit anti-Adenylate cyclase type III (ACIII) Polyclonal Antibody (Unconjugated), suitable for WB, IHC, ICC.
Background Info:
Adenylate cyclases are enzymes which interact with and are activated by the GTP bound alpha subunits of trimeric G-proteins. Activated adenylate cyclases are responsible for the production of the important "second messenger" signalling molecule cyclic-AMP, which is generated from ATP. The type III adenylate cyclase enzyme is localized in the membranes surrounding the cilia in neurons, and our antibody is an excellent marker of neuronal cilia in the brain and in cells in tissue culture. Adenylate cyclase type III is a large complex molecule of, in the human, 1145 amino acids with a deduced molecular weight of 129 kDa. The protein may be variably glycosylated, so that on SDS-PAGE and western blots it runs as a diffuse band of about 160 kDa in cortex and about 200 kDa in olfactory epithelium. The molecule has a complex structure, with 12 transmembrane domains and two cyclase domains. Each cyclase domain is immediately C-terminal to 6 transmembrane segments, but only the second, C-terminal cyclase is believed to be catalytically active.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human (Predicted),Mouse,Other Mammals (Predicted),Rat
Immunogen:
20 amino acid peptide identical to the C-terminus of rat ACIII (amino acids PAAFPNGSSVTLPHQVVDNP)
Applications:
ICC,IHC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:1,000-1:2,000 is recommended for WB. A dilution of 1:5,000-1:10,000 is recommended for ICC and IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The antibody stains a band at about 200 kDa in olfactory epithelium which is rich in cilia. Fewer cilia are found in frontal cortex, and the protein is less heavily glycosylated, and a less prominent band is seen at about 160 kDa. It has also been used successfully for immunocytochemistry on mixed neuron/glia cultures. The antibody has been directly tested for reactivity in rat. It is expected that it will work on human due to homology with the immunogen and possibly other mammal tissues (Human, horse, cow, pig, chicken, mouse).
Storage:
Store lyophilized, unopened vial at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C to -80°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Nicastrin, N-terminal Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Nicastrin, a type 1 membrane glycoprotein, is an essential component of the gamma secretase complex which is critical for the cleavage of the amyloid precursor protein and other membrane proteins. Nicastrin is widely expressed in different tissue types. This antibody detects all processed forms of Nicastrin.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (RGNSVERKIYIPL-C) corresponding to human Nicastrin [32-44] in the N-terminal region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested concentration of 3-10 µg/mL is recommended for WB. Human or mouse brain samples commonly prepared with reducing (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Unprocessed full length human Nicastrin is 709 amino acids, however this protein contains an N-terminal signal peptide which is considered to undergo cleavage during processing and transit to the cell plasma membrane, in addition the protein undergoes glycosylation to produce a glycoprotein of about 145 kDa apparent MW by SDS PAGE. Biosensis recommends that the optimal working dilution should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using peptide absorption.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Nicastrin, Central region Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Nicastrin, a type 1 membrane glycoprotein, is an essential component of the gamma secretase complex which is critical for the cleavage of the amyloid precursor protein and other membrane proteins. Nicastrin is widely expressed in different tissue types. This antibody reacts with immature forms of Nicastrin. Detection of higher mol. wt. mature forms is likely to be blocked by glycosylation in this region of the protein.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (C-QGETFDYIGSSRMVYD) corresponding to human Nicastrin [331-346] in the central region conjugated via additional N-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested concentration of 3-10 µg/mL is recommended for WB. Human or mouse brain samples commonly prepared with reducing (50 mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Unprocessed full length human Nicastrin is 709 amino acids, however this protein contains an N-terminal signal peptide which is considered to undergo removal/cleavage during processing and transit to the cell plasma membrane, in addition the protein undergoes glycosylation to produce a glycoprotein of about 145 kDa apparent MW by SDS PAGE. Biosensis recommends that the optimal working dilution should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using peptide absorption.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Nicastrin, C-terminal Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Nicastrin, a type 1 membrane glycoprotein, is an essential component of the gamma secretase complex which is critical for the cleavage of the amyloid precursor protein and other membrane proteins. Nicastrin is widely expressed in different tissue types. This antibody detects all processed forms of Nicastrin.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (C-NAKADVLFIAPREPGAVSY) corresponding to human Nicastrin [691-709] in the C-terminal region conjugated via additional N-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested concentration of 3-10 µg/mL is recommended for WB. Human or mouse brain samples commonly prepared with reducing (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Unprocessed full length human Nicastrin is 709 amino acids, however this protein contains an N-terminal signal peptide which is considered to undergo cleavage during processing and transit to the cell plasma membrane, in addition the protein undergoes glycosylation to produce a glycoprotein of about 145 kDa apparent MW by SDS PAGE. Biosensis recommends that the optimal working dilution should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using peptide absorption.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Beta-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Beta-synuclein is a soluble cytoplasmic protein associated with synaptic vesicles and a member of the synuclein family. Mutations in alpha-synuclein cause early onset Parkinson's disease. Expression of beta synuclein may modulate alpha-synuclein aggregation found in Parkinson's disease.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (AQEAAEEPLIEPLME-C) corresponding to human _-synuclein [99-113] in the C-terminal domain conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
WB and IHC. A dilution of 1:500 to 1:1,000 is recommended for Western blot. _-synuclein is a soluble protein of 134 amino acids and detected with 17 kDa mobility by western blotting. By IHC the antibody detects synaptic sites in human brain formaldehyde-treated frozen tissue. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using soluble mouse and human brain extracts, reactivity for major product diminished by peptide absorption. Does not detect alpha-synuclein as tested with recombinant protein and does not react with Lewy bodies in human Dementia with Lewy Bodies or Parkinson's disease brain tissue sections.
Storage:
Lyophilized at 2-8°C. After reconstitution, store at -20°C in undiluted aliquots for up to 6 months. The antibody may be stored short term at 2-2-8°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
Rabbit anti-DJ-1/PARK7 Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Autosomal recessive mutations in DJ-1 cause early-onset familial Parkinson's disease. DJ-1 is considered a redox-sensitive cytoplasmic protein found in brain as well as other cell types.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (ASKRALVILAKGAEE-C) corresponding to human DJ-1 [2-16] in the N-terminal domain conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
WB and IHC. Suggested dilution of 1:5,000 is recommended for WB. DJ-1 is a soluble protein of 189 amino acids and detected with 23 kDa mobility by western blotting. The suggested dilution for IHC is 1:100. Detected astrocyte cytoplasmic labelling in human brain formaldehyde-treated tissue. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
PARK7
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using soluble mouse and human brain extracts, reactivity for major product diminished by peptide absorption.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Presenilin 2 loop region Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Autosomal dominant mutations in presenilin 2 are the second major cause of early-onset familial Alzheimer's disease. Presenilin 2 is a multi-transmembrane protein which undergoes endoprotelysis to form an N-terminal fragment of about 29 kDa and C-terminal fragment of about 22 kDa. Presenilin 2 forms the catalytic core of the gamma-secretase complex which cleaves type 1 transmembrane proteins including the amyloid precursor protein to generate the C-terminus of the amyloid beta peptide.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested dilution of 1:1,000 is recommended for WB. Full length presenilin 2 (448 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 22 kDa with this antibody. Human or mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. The suggested dilution for IP is 1:100 . Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
AD3LP, AD5, E5-1, STM-2
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by Western blot using mouse and human brain and knock down of presenilin 2 in vitro using siRNA see ref 6 below. Not reactive with presenilin 1.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
SOD1 binds copper and zinc ions ans is one of two isozymes responsible for destroying free superoxide radicals which are normally produced within the cells and which are toxic to biological systems. SOD1 is a soluble cytoplasmic protein, acting as a homodimer to convert superoxide radicals to molecular oxygen and hydrogen peroxide. Defects in SOD1 are the cause of amyotrophic lateral sclerosis type 1 (ALS1) which is a neurodegenerative disorder affecting upper and lower motor neurons and resulting in fatal paralysis.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A peptide (HEKADDLGKGGNEESTKTG) corresponding to the amino acids 121-139 of human superoxide dismutase (SOD1) conjugated to diphtheria toxin has been used as the immunogen.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. This antibody works superbly in immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 100 to 1: 1000 depending on tissue and detection method. For western blotting a dilution range of 1: 1000 to 1: 4000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Superoxide dismutase; SOD1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody has been shown to be specific for superoxide dismutase (SOD1) protein. Human. Does not detect mouse and rat SOD1.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Rabbit anti-Presenilin 1 loop region Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Presenilin-1 (PSEN1) is a multi-pass membrane protein and component of the gamma-secretase complex. PSEN1 is thought to play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. It may also play a role in hematopoiesis. Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3), a familial early-onset form of Alzheimer disease (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (GDPEAQRRVSKNSKYNA-C) corresponding to human PS1 [301-317] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blot. Suggested dilution of 1:1,000 is recommended for WB. Full length presenilin 1 (467 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 19 kDa. Human or mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Presenilin 1; PS-1; Protein S182; PS1-CTF12; PSEN1; AD3; PS1; PSNL1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by Western blotting using transfected cells, presenilin 1 knock-out mouse cells and mouse and human brain.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
MANF is a trophic factor for midbrain dopamine neurons in vivo. It prevents the 6-OHDA- induced degeneration of dopamine neurons in rodent models of Parkinson's disease (Lindholm et al., 2008, Voutilainen et al., 2009). When administered after 6-OHDA-lesioning it restores the dopaminergic function and prevents degeneration of dopamine neurons in substantia nigra pars compacta.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Concentrated ammonium sulfate in PBS pH 7.4 containing no preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant human MANF protein produced using CHO-based cell line. Immunogen is purified from cell culture supernatant.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western blot (WB) at a suggested dilution of 1:2,000 - 1:6,000. Immunohistochemistry (IHC) and Immunofluorescence (IF). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
ARMET, ARP
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
MANF (Mesencephalic astrocyte-derived neurotrophic factor). No cross-reactivity in MANF-knockout mouse. No cross-reactivity with CDNF in IHC, slightly cross-reacts with purified CDNF in WB. No cross-reactivity with CDNF in IHC, slightly cross-reacts with purified CDNF in WB.
Storage:
Store antibody stock solution at 2-8°C upon receipt. DO NOT FREEZE. This product is an (NH4)2SO4 precipitate. See reconstitution instructions for more information.
CDNF (conserved dopamine neurotrophic factor) is a trophic factor for midbrain dopamine neurons in vivo. It prevents the 6-OHDA- (Lindholm et al. 20007; Voutilainen et al., 2011) and MPTP-induced degeneration (Airavaara et al., 2012) of dopamine neurons in rodent models of Parkinson's disease. When administered after 6-OHDA or MPTP -lesioning it restores the dopaminergic function and prevents degeneration of dopamine neurons in substantia nigra pars compacta.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Concentrated ammonium sulphate in PBS pH 7.4 containing no preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant human CDNF protein produced using CHO-based cell line. Purified from cell culture supernatant.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western blot (WB) at a suggested dilution of 1:6,000 - 1:10,000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
ARMETL1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
CDNF (conserved dopamine neurotrophic factor)
Storage:
Store at 2-8°C upon receipt; Do not freeze. See reconstitution instructions for handling information.
FUNCTION: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. SUBUNIT: Adaptor protein complex 1 (AP-1) is an heterotetramer composed of two large adaptins (gamma1/AP1G1 or gamma2/AP1G2 and beta1A/AP1B1 or beta1B/AP1B1), a medium adaptin (mu1A/AP1M1 or mu1B/AP1M2) and a small adaptin (sigma1A/AP1S1 or sigma1B/AP1S2 or sigma1C/AP1S3). SUBCELLULAR LOCATION: Golgi apparatus. Cytoplasmic vesicle; cytoplasmic vesicle membrane; peripheral membrane protein; cytoplasmic side. Note=Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Widely expressed. DISEASE: Deletion of the AP1B1 gene may play a role in the tumorigenesis of meningiomas. SIMILARITY: Belongs to the adaptor complexes large subunit family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (C-KKGEIFELKAELNSDKKEK) corresponding to the amino acids 11-29 of human AP-1 complex subunit beta-1 conjugated to diphtheria toxin has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from AP-1 complex subunit beta-1 protein in mouse, rat and bovine.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. This antibody works superbly in immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 1000 to 1: 5000 depending on tissue and detection method. For western blotting a dilution range of 1: 100 to 1: 10000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Adapter-related protein complex 1 beta-1 subunit; Beta-adaptin 1; Adaptor protein complex AP-1 beta-1 subunit; Golgi adaptor HA1/AP1 adaptin beta subunit; Clathrin assembly protein complex 1 beta large chain; AP1B1; ADTB1; BAM22
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody has been shown to be specific for AP-1 complex subunit beta-1. Rat and human, other species have not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Rabbit anti-Neurturin (NTN) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
<span itemprop="description">Neurturin (NTN) is a member of the GDNF family of neurotrophic factors. This protein is a potent survival factor for several populations of central and peripheral neurons in mature and developing rodents. FUNCTION: Supports the survival of sympathetic neurons in culture. May regulate the development and maintenance of the CNS. Might control the size of non-neuronal cell population such as haemopoietic cells. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. DISEASE: Defects in NRTN are a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, and possibly with other loci, defects in NRTN are involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.</span>
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Concentrated ammonium sulphate in PBS pH 7.4.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant human NRTN protein produced using CHO-based suspension cell line. Protein was purified from the cell culture supernatant.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western blot (WB) at a suggested dilution of 1:500-1:1,000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Antibody does not show cross-reactivity to other GDNF-family proteins.
Storage:
Store at 2-8°C upon receipt. As product is (NH4)2SO4 (ammonium sulfate) precipitate, mix well by pipetting or vortexing prior to use.
Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans Golgi network to lysosomes. Together with medium and small subunits, adaptins form a heterotetrameric complex called an adaptor whose role is to promote the formation of clathrin-coated pits and vesicles and to recognise sorting signals within the cytosolic tails of transmembrane cargo molecules. Gamma-adaptin protein belongs to the adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network and/or endosomes. SUBCELLULAR LOCATION: Golgi apparatus. Cytoplasmic vesicle, clathrin-coated vesicle membrane.
A synthetic peptide (IRLRELIRTIRTARTQAEER) corresponding to the amino acids 5-24 of human AP-1 complex subunit gamma-1 conjugated to diphtheria toxin has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from AP-1 complex subunit gamma-1 protein in mouse, rat, dog and zebra fish.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. This antibody works in immunohistochemistry on frozen or wax embedded tissue. Antigen retrieval has been used in testing but may not be necessary. Typical working dilution: Light microscopy 1/500 to 1/2000 depending on tissue and detection method; Immunofluorescence 1/50 to 1/200; Western blotting 1/1000 to 1/4000 is recommended depending on detection method. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
AP-1 complex subunit gamma-1; Adapter-related protein complex 1 subunit gamma-1; Gamma1-adaptin; Adaptor protein complex AP-1 subunit gamma-1; Golgi adaptor HA1/AP1 adaptin subunit gamma-1; Clathrin assembly protein complex 1 gamma-1 large chain; AP1G1; ADTG; CLAPG1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody has been shown to be specific for AP-1 Rat and human
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent.
Rabbit anti-mCherry Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
mCherry is an engineered derivative of one of a family of proteins originally isolated from Cnidarians (jelly fish, sea anemones and corals). The mCherry protein was derived from DsRed, a red fluorescent protein from so-called disc corals of the genus Discosoma. DsRed is a 223 amino acid ~28 kDa protein similar in size and properties to GFP, but, obviously, produces a red rather than a green fluorochrome. The original DsRed was engineered extensively in the Tsien lab to prevent it from forming tetramers and dimers and to modify and improve the spectral properties (1-3). The resulting monomeric protein is useful for applications such as Foerster Resonance Energy Transfer (FRET, also known as Fluorescence Resonance Energy Transfer). Several further cycles of mutation, directed modification and evolutionary selection produced mCherry, which is monomeric and has an excitation maximum at 587 nm and and emission maximum at 610 nm (4).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Species Independent
Immunogen:
Recombinant full length mCherry.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunocytochemistry (IC). A dilution of 1:500 to 1:1,000 is recommended for WB. A dilution of 1:250 to 1:500 is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The antibody reacts with a band at ~28-30 kDa corresponding to intact full-length mCherry by Western blot on HEK293 cells transfected with mCherry vector. It has also been used successfully for immunocytochemistry.
Storage:
Store lyophilized, unopened vial at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C to -80°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Growth Associated Protein 43 (GAP-43) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
GAP43 is very abundant protein which is found concentrated in neurons. One group discovered it as one of three proteins which becomes unregulated during the regeneration of the toad optic nerve (1). Three GAPs (Growth associated proteins) were discovered, and the number 43 comes from the apparent SDS-PAGE molecular weight of the one named GAP43. The HGNC name for this protein is, not surprisingly, GAP43. Later work showed that GAP43 does not run on SDS-PAGE in a fashion which accurately reflects its molecular weight, and that GAP43 proteins from different species may run at different apparent molecular weights. Partly due to these features GAP43 were independently discovered by several different groups and therefore has several alternate names, such as protein F1, pp46, neuromodulin, neural phosphoprotein B-50 and calmodulin-binding protein P-57. In each case the number reflects the apparent SDS-PAGE molecular weight, and underlines the unusual properties of this molecule. Mammalian GAP43 proteins contains only 226-243 amino acids, and so the real molecular weight is 23.61-25.14 kDa. GAP43 has been extensively studied and is known to be a major protein kinase C substrate and to bind calmodulin avidly. GAP43 is anchored to the plasma membrane by palmitoylation modifications.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Rat
Immunogen:
C-terminal peptide 217-227 of rat and mouse GAP43, which is KEDPEADQEHA, to which an N terminal Cysteine residue was added to allow chemical coupling to Keyhole Limpet Hemocyanin carrier protein.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A dilution of 1:5,000 - 1:20,000 is recommended. A dilution of 1:500-2,000 is recommended for Immunocytochemistry (ICC). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The antibody reacts with a 43 kDa band by Western blot on bovine cerebellum homogenate. The molecular weight of the protein recognized can vary (~43-57 kDa) depending on the species and the percentage acrylamide used in the SDS-PAGE gel. It has also been used successfully for immunocytochemistry.
Storage:
Store lyophilized, unopened vial at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C to -80°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Clathrin Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Paraffin-embedded.
Background Info:
Clathrin is a major protein component of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice to either the plasma membrane or the trans-Golgi network. These specialised organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. Clathrin triskelions, composed of 3 heavy chains and 3 light chains, are the basic subunits of the clathrin coat. In the presence of light chains, hub assembly is influenced by both the pH and the concentration of calcium. Clathrin localises to the cytoplasmic face of coated pit and vesicle membranes.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Rat
Immunogen:
A synthetic peptide (KAGLLQRALEHFTDLYDIKR) corresponding to the amino acids 619-638 of rat clathrin conjugated to diphtheria toxin has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from clathrin protein in mouse, human and bovine.
Applications:
IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. This antibody works in immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 100 to 1: 4000 depending on tissue and detection method. It is usual to use approximately a 10-fold increase for confocal microscopy i.e. a dilution range of 1: 100 to 1: 400.For western blotting a dilution range of 1: 1000 to 1: 8000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Clathrin heavy chain; Clathrin heavy chain 1; CLH-17; CLTC
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody has been shown to be specific for clathrin. Rat
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent.
Rabbit anti-Tyrosine Hydroxylase (TH) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Tyrosine hydroxylase (TH) is the rate-limiting enzyme in the synthesis of the catecholamines dopamine, epinephrine and norepinephrine. Therefore the regulation of the TH enzyme represents the central means for controlling the synthesis of these important catecholamines. FUNCTION: Plays an important role in the physiology of adrenergic neurons. CATALYTIC ACTIVITY: L-tyrosine + tetrahydrobiopterin + O2 = 3,4-dihydroxy-L-phenylalanine + 4a-hydroxytetrahydrobiopterin. COFACTOR: Fe(2+) ion. ENZYME REGULATION: Phosphorylation leads to an increase in the catalytic activity. PATHWAY: Catecholamine biosynthesis; first step. SUBUNIT: Homotetramer. PTM: In vitro, phosphorylation of Ser-19 increases the rate of Ser-40 phosphorylation, which results in enzyme opening and activation. SIMILARITY: Belongs to the biopterin-dependent aromatic amino acid hydroxylase family. The presence of different DNA sequences at the TH locus confers susceptibility to various disorders of the brain including manic-depression and schizophrenia. Parkinson's disease is also considered a TH deficiency as low dopamine levels are a consistent neurochemical abnormality.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Guinea Pig,Human,Mouse,Rat
Immunogen:
A synthetic peptide (PRFIGRRQSLIEDARK) as part of human Tyrosine Hydroxylase (63-78) conjugated to KLH has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from TH protein in rat (31-47).
Applications:
IHC-Frozen
Antibody Isotype:
IgG
Application Details:
IHC. A concentration of 4-10 µg/mL is recommended for this application. This is a superb antibody for detection of tyrosine hydroxylase containing neurons exhibiting an intense labelling with a negligible background. This antiserum has proven extremely useful for staining of catecholaminergic neurons. It stains nicely and intensely dendritic processes and fine nerve terminals. We recommend mouse or rat brain containing catecholaminergic neurons as a positive control for this antibody, for example brain stem or striatum. Western blotting: A concentration of 5-15 µg/mL is recommended.Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Pierre S.R., Lemmens M.A., Figueiredo-Pereira M.E. (2009) Subchronic infusion of the product of inflammation prostaglandin J2 models sporadic Parkinson's disease in mice J Neuroinflammation. Jul 25;6:18 Takeoka A. et al (2010) Noradrenergic innervation of the rat spinal cord caudal to a complete spinal cord transection: effects of olfactory ensheathing glia J Exp Neurol. 2010 Mar;222(1):59-69. Brown R.E. et al (2008) Characterization of GABAergic neurons in rapid-eye-movement sleep controlling regions of the brainstem reticular formation in GAD67-green fluorescent protein knock-in mice. Eur J Neurosci. 2008 Jan;27(2):352-63. Bisem NJ et al (2012) Mapping of FGF1 in the Medulla Oblongata of Macaca fascicularis. Acta Histochem Cytochem. 2012 Dec 26;45(6):325-34.
Specificity:
IHC on brain shows a pattern of staining specific for TH containing neurons. This antibody is known to react with rat, mouse and guinea pig. Cross reactivity with other species has not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
This gene encodes an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This gene product is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer's disease. Polymorphisms in this gene have been associated with Alzheimer's disease and mild cognitive impairment. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform. [provided by RefSeq, May 2010]
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Guinea Pig,Human,Pig,Rabbit,Rat
Immunogen:
A synthetic peptide (GLFSSYRLPGHTQDTLVAQKSS) as a part of porcine ChAT protein (aa: 167-188) conjugated to KLH
Applications:
ELISA,IHC-Frozen
Antibody Isotype:
IgG
Application Details:
IHC, 1 site ELISA. Use at a concentration of 1 µg/mL. This antiserum will superbly stain both cell bodies and nerve terminal. The optimal dilution should be determined by the end user.
Leong WK, Klaric TS, Lin Y, Lewis MD, Koblar SA.(2013) Upregulation of the neuronal Per-Arnt-Sim domain protein 4 (Npas4) in the rat corticolimbic system following focal cerebral ischemia. Eur J Neurosci. 2013 Feb 22. doi: 10.1111/ejn.12163. [Epub ahead of print] Application: IH; species Rat PubMed ID
Specificity:
This antibody stains cholinergic neurons in human, rat, guinea-pig and rabbit central and peripheral nervous systems. This antiserum is known to react with ChAT of origin: human, rat, guinea-pig and rabbit.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Sequestosome 1 Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Sequestosome 1 is an adapter protein which binds ubiquitin and may regulate the activation of NFKB1 by TNF-alpha, nerve growth factor and interleukin-1. It may regulate signaling cascades through ubiquitination and may also be involved in cell differentiation, apoptosis, immune response and regulation of K(+) channels. It is present as a homooligomer or heterooligomer and localises to the cytoplasm, late endosome and nucleus. In cardiac muscles it localises to the sarcomeric band. It accumulates in neurofibrillary tangles and in Lewy bodies of neurons from individuals with Alzheimer and Parkinson disease respectively. It is also enriched in Rosenthal fibers of pilocytic astrocytoma and in liver cells it accumulates in Mallory bodies associated with alcoholic hepatitis, Wilson disease, indian childhood cirrhosis and in hyaline bodies associated with hepatocellular carcinoma. Sequestosome 1 is ubiquitously expressed and to date, there are 2 named isoforms produced by alternative splicing. Defects in sequestosome 1 cause sporadic and familial Page disease of bone (PDB). This is a metabolic bone disease characterised by focal areas of increased and disorganised bone turn-over due to activated osteoclasts.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Rat
Immunogen:
Peptide IGAALDTIQYSKH corresponding to the C-terminal part of human Sequestosome 1 (aa: 424-436) conjugated to the Blue Carrier Protein has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:500 to 1: 5000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa; ubiquitin-binding protein p62; EBI3-associated protein of 60 kDa; p60; EBIAP; SQSTM1; ORCA; OSIL
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity was confirmed by immunohistochemical analysis on paraffin embedded human brain. This antibody is expected to recognise p60 in mouse, rat and bovine.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Rabbit anti-Autophagy-related protein 7 (ATG7) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
FUNCTION: Functions as an E1 enzyme essential for multisubstrates such as GABARAPL1 and ATG12. Forms intermediate conjugates with GABARAPL1 (GABARAPL2, GABARAP or MAP1ALC3). Formation of the final GABARAPL1-PE conjugate is essential for autophagy. SUBUNIT: Homodimer (By similarity). Interacts with ATG3 and ATG12. The complex, composed of ATG3 and ATG7, plays a role in the conjugation of ATG12 to ATG5. SUBCELLULAR LOCATION: Cytoplasm (Probable). ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Widely expressed, especially in kidney, liver, lymph nodes and bone marrow. DOMAIN: The C-terminal part of the protein is essential for the dimerization and interaction with ATG3 and ATG12. SIMILARITY: Belongs to the ATG7 family. In yeast, ATG7 appears to be required for fusion of peroxisomal and vaculuolar membranes.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (DSTRDRTLDQQC) corresponding to the C-terminal of human APG7 protein conjugated to blue carrier protein has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from APG7 protein in mouse, rat, S. cerevisiae, Macaca mulatta (monkey) and Canis familiaris (dog).
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
Non-reduced western blot : 1:100; IF: acetone or 3.7% PFA fixed cells (HJ Lim et al 2013); 1:100; Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Chiu-Wei Chen, et al (2012) Inhibition of autophagy as a therapeutic strategy of iron-induced brain injury after hemorrhage Autophagy, 8(10):1510. Chien W.S. et al (2011) Suppression of autophagy in rat liver at late stage of polymicrobial sepsis Shock. 2011 Jan 14 Lee J.E. et al (2011) Autophagy Regulates Embryonic Survival During Delayed Implantation Endocrinology. 2011 Mar 1. Ryningen A et al (2012) Inhibition of Mammalian target of rapamycin in human acute myeloid leukemia cells has diverse effects that depend on the environmental in vitro stress. Bone Marrow Res. 2012;2012:329061. Oh HA et al (2013) Uncovering a role for endocannabinoid signaling in autophagy in preimplantation mouse embryos. Mol Hum Reprod. 2013 Feb;19(2):93-101.
Specificity:
IF, WB and ELISA confirmed the specificity for ATG7. Human, rat. Other species not yet tested.
Storage:
Store lyophilized antibody at 2-8ºC. After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Presenilin 1 (PS-1) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Presenilin-1 (PSEN1) is a multi-pass membrane protein and component of the gamma-secretase complex. PSEN1 is thought to play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. It may also play a role in hematopoiesis. Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3), a familial early-onset form of Alzheimer disease (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide corresponding to a region (1-20 aa) from the N-terminus of human Presenilin 1 conjugated to Diptheria toxoid.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
IF and WB. Suggested dilution of 1:2,000 is recommended for WB. On SDS-PAGE, the predominant form detected by this antibody is the N-terminal Presenilin 1 fragment of approx 29 kDa. The uncleaved form of Presenilin 1 migrates to approx 45 kDa. Human and mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3M), SDS (1%) in 62.5 mM Tris-HCl pH 6.8 sample buffer heated to 50C for 15 min. The suggested dilution for IF is 1:100 for acetone or paraformaldehyde fixed cells or tissue. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Presenilin 1; PS-1; Protein S182; PS1-CTF12; PSEN1; AD3; PS1; PSNL1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity confirmed by WB and IF using transfected cells, Presenilin 1 knock-out mouse cells, mouse and human brain.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Autophagy-related protein 9A (ATG9A) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Plays a role in autophagy. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein (Potential). ALTERNATIVE PRODUCTS: 3 named isoforms produced by alternative splicing. SIMILARITY: Belongs to the ATG9 family. IN YEAST: FUNCTION: Involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Recruites ATG23 and ATG8 to the pre-autophagosomal structure. SUBUNIT: Interacts with ATG18, ATG2 and ATG23. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein. Preautophagosomal structure; preautophagosomal structure membrane; multi-pass membrane protein. Note=Pre-autophagosomal and other perivacuolar punctate structures. The proper trafficking of ATG9 between the pre-autophagosomal structure and the other punctate structures requires ATG2, ATG18, ATG23, the ATG1-ATG13 complex and the phosphatidylinositol 3-kinase complex I. SIMILARITY: Belongs to the ATG9 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (CWHRRESDESGE) corresponding to the C-terminal of human APG9A (APG9L1) protein has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from APG9A (APG9L1) protein in mouse, rat, S. cerevisiae, Macaca mulatta (monkey) and Canis familiaris (dog).
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence, WB. A dilution of 1:100 to 1:3000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Autophagy-related protein 9A; APG9-like 1; Autophagy-related protein 9; APG9A; ATG9A; APG9L1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Park YE et al (2009) Autophagic degradation of nuclear components in mammalian cells. Autophagy. 2009 Aug;5(6):795-804.
Specificity:
IHC, WB and ELISA confirmed the specificity for ATG9A (APG9L1) . Human, rat. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Superoxide dismutase [Mn], mitochondrial destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems (Ref: SwissProt).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (KHSLPDLPYDGALEPHINC) of human/rat/mouse mitochondrial manganese Superoxide Dismutase (SOD2), conjugated to Keyhole Limpet Hemocyanin.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
IF, WB. Typical working dilutions for light microscopy are 1:500 to 1:1,000 depending on tissue and detection method. For IF, a dilution range of 1:50 to 1:100 is recommended. For WB, a dilution range of 1: 1,000 to 1: 4,000 is recommended. This antibody clearly detects a protein at approximately 24 kDa on WB of human brain tissue. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Superoxide dismutase [Mn], mitochondrial;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Mitochondrial manganese Superoxide Dismutase (SOD2), no cross reactivity to SOD1
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Peroxiredoxin-5 has a role in intracellular redox signaling.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (VKALNVEPDGTGLTC) corresponding to region (190-204 aa) of human Peroxiredoxin-5 conjugated to KLH. Human, mouse and rat sequences of this peptide are identical.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, IF, WB. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 2,000 is recommended. This antibody clearly detects a protein at approximately 22 kDa on WB of human brain tissue. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human Peroxiredoxin-5 no cross reactivity to other family members
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Peroxiredoxin-4 has a probable role in redox regulation of the cell.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (SRVSVADHSLHLSKAKISK) corresponding to a region (65-83 aa) from human Peroxiredoxin-4 conjugated to diptheria toxin.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF of 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 4,000 is recommended. A dilution of 1: 1,000 to 1: 4,000 is recommended for ELISA. This antibody stains non-ciliated bronchiolar cells in rat lung and what appears to be sebaceous glands in rat skin. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Tam KC et al. (2018) Evidence for the interaction of peroxiredoxin-4 with the store-operated calcium channel activator STIM1 in liver cells. Cell Calcium. 2018 May 15;74:14-28.
Specificity:
Human Peroxiredoxin-4 no cross reactivity to other family members
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Peroxiredoxin-3 has a role in redox regulation of the cell.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (CEVVAVSVDSHFSHLAW) from a region (127-143 aa) on human Peroxiredoxin-3 conjugated to KLH.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF of 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 2,000 is recommended. This antibody detects a protein at approx 23 kDa on WB of human brain tissue which is the mature form of this protein. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Thioredoxin-dependent peroxide reductase, mitochondrial; Antioxidant protein 1; AOP-1; HBC189; Peroxiredoxin III; Prx-III; Peroxiredoxin-3; Protein MER5 homolog; PRDX3; AOP1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Peroxiredoxin-3 no cross reactivity to other family members
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Peroxiredoxin-2 has a role in redox regulation of the cell.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (VVDGAFKEVKLS) corresponding to region (20-31 aa) from human Peroxiredoxin-2 conjugated to diptheria toxin.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF of 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 4,000 is recommended. A dilution of 1: 1,000 to 1: 4,000 is recommended for ELISA. This antibody stains basal cells in rat airways and specific kidney tubule cells. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human Peroxiredoxin-2, no cross reactivity to other family members
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Rabbit anti-Autophagy-related protein 3 (ATG3) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
FUNCTION: GABARAPL1 (GABARAPL2 or GABARAP or MAP1LC3)-modifier protein conjugating enzyme involved in its E2-like covalent binding to PE. ATG7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with ATG3 (E2-like enzyme). Preferred substrate is MAP1LC3A. Formation of the GABARAPL1-PE conjugate is essential for autophagy. SUBUNIT: Interacts with ATG7 and ATG12. The complex, composed of ATG3 and ATG7, plays a role in the conjugation of ATG12 to ATG5. SUBCELLULAR LOCATION: Cytoplasm. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Widely expressed, with a highest expression in heart, skeletal muscle, kidney, liver and placenta. SIMILARITY: Belongs to the ATG3 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide corresponding to a central region of the human ATG3 protein conjugated to Blue Carrier Protein has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from ATG3 protein in mouse, rat, S. cerevisiae, Macaca mulatta (monkey) and Canis familiaris (dog).
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, immunofluorescence. A dilution of 1:50 to 1:3000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Autophagy-related protein 3; APG3; APG3-like; hApg3; Protein PC3-96 ; ATG3; APG3; APG3L
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Ryningen A et al (2012) Inhibition of Mammalian target of rapamycin in human acute myeloid leukemia cells has diverse effects that depend on the environmental in vitro stress. Bone Marrow Res. 2012;2012:329061.
Specificity:
IHC, WB and ELISA confirmed the specificity for ATG3. A 37 kDa band, that corresponds to the molecular weight of ATG3, is detected via western blot analysis. Human, rat, mouse. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Peroxiredoxin-1 has a role in redox regulation of the cell.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (PLVSDPKRTIAQDY) corresponding to the region 103-116 amino acids of human Peroxiredoxin-1 conjugated to diptheria toxin.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF of 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 4,000 is recommended. A dilution of 1: 1,000 to 1: 4,000 is recommended for ELISA. This antibody stains non-ciliated bronchiolar cells in rat airways and specific kidney tubule cells. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Glutathione peroxidase 4 (GPx-4) is involved in protecting cells against membrane lipid peroxidation and cell death.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (VNYTQLVDLHARYAEC) corresponding to the amino acids 78-93 of human glutathione peroxidase 4 (Isoform Mitochondrial) conjugated to KLH has been used as the immunogen. Human, rat and mouse sequences are identical.
Applications:
IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
WB, IHC. Typical working dilution for IHC is 1:200 to 1:1,000 depending on tissue and detection method. For WB, a dilution range of 1:1,000 to 1:2,000 is recommended. GPx-4 exists as a tetramer and can reform into multimeric complexes even under reduced conditions. The reported molecular weight of the GPx-4 monomer is 22 kDa but is reported to rapidly form oligomers, thus higher molecular weight bands greater than 22 kDa are expected. Mitochondrial preparations are also recommended to enhance signal. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human and rat mitochondrial glutathione peroxidase (GPx-4) Human; rat;
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Glutathione peroxidase 1 has a role in detoxification of hydrogen peroxide and is one of the most important antioxidant enzymes in humans. It exists as a homotetramer which localises to the cytoplasm. It belongs to the glutathione peroxidase family. Glutathione peroxidase 1 is one of few proteins in higher vertebrates to contain selenocysteine, which occurs at the active site of glutathione peroxidase and is coded by UGA, that normally functions as a translation termination codon. This protein has a polyalanine sequence polymorphism in the N-terminal region, which includes three alleles with five, six or seven alanine repeats. The allele with five alanine repeats is significantly associated with breast cancer risk. At least two alternatively spliced isoforms have been identified.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (RRYSRRFQTIDIEPDIEALL) corresponding to the amino acids 175-194 of human glutathione peroxidase 1 ( GPx-1) conjugated to diphtheria toxin has been used as the immunogen.
Applications:
ELISA,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB and ELISA. This antibody works superbly in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine IHC are 1: 200 to 1: 1,000 depending on tissue and detection method. For WB a dilution range of 1: 1,000 to 1: 4,000 is recommended. For ELISA, a dilution of 1: 1,000 to 1: 4,000 is recommended. This antiserum has extremely high titre, it stains human and rat glial cells intensely and to some extent also stains neurons. Other tissues have not yet been tested. On WB under reducing conditions recognises a 22kD protein in human brain tissue and Sigma glutathione peroxidase (G-4013) isolated from human erythrocytes. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human and rat cellular selenium dependent glutathione peroxidase. Human; rat;
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Rabbit anti-Autophagy-related protein 16-1 (ATG16 L1) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA, ICC.
Background Info:
ATG16 L1 plays an essential role in autophagy. It is a homooligomer ant interacts with ATG5. Part of either the minor and major complexes respectively composed of 4 sets of ATG12-ATG5 and ATG16L1 (400 kDa) or 8 sets of ATG12-ATG5 and ATG16L1 (800 kDa). APG16 L1 localises to the cytoplasm, in particularly to preautophagosomal structure (PAS) where it is involved in the membrane targeting of ATG5. There are 5 named isoforms produced by alternative splicing. Genetic variation within ATG16 L1 are associated with susceptibility to inflammatory bowel disease type 1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
N-terminal of human ATG16-L1 protein conjugated to Blue Carrier Protein has been used as the immunogen.
Applications:
ELISA,ICC,WB
Antibody Isotype:
Mixed
Application Details:
Non-reduced western blot: 1:100; IP: 1-50-1:100 (5-10 ?L/500uL lysate); ELISA: 1:2000-1:3000 direct detection only, recombinant immunogen.
Alternative Names:
Autophagy-related protein 16-1; APG16-like 1; ATG16L1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Cooney R et al (2009). NOD2 stimulation induces autophagy in dendritic cells influencing bacterial handling and antigen presentation. Nat. Med. Dec 6 2009 Scharl M. et al (2011). Protein tyrosine phosphatase nonreceptor type 2 regulates autophagosome formation in human intestinal cells. Inflamm Bowel Dis. 2011 Oct 10.
Specificity:
Detects human protein via non-reduced WB, and ELISA Human, rat. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Protein painting of fourth Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
Protein painting of fourth (Pof) is a probable RNA-binding protein that binds to the fourth chromosome and may bind a RNA that spreads the fourth chromosome (Ref: Swissprot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS (pH 7.4) with 0.02% Sodium azide added
Host Animal:
Rabbit
Species Reactivity:
Drosophila
Immunogen:
A synthetic peptide from Drosophila melanogaster Protein painting of fourth (22-36 aa) conjugated to KLH.
Applications:
ELISA
Antibody Isotype:
IgG
Application Details:
ELISA. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Zeste-interacting protein 16; Zip16; Pof;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Protein painting of fourth ;Zeste-interacting protein 16;
Storage:
Store lyophilized product at -20°C or below. After reconstitution, keep aliquots for 2-3 weeks at 2-8°C or at -20°C for up to 12 months. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Autophagy-related protein 4 homolog B (APG4B) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Cysteine protease required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form (form II). Form II, with a revealed C-terminal glycine, is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes. ENZYME REGULATION: Inhibited by N-ethylmaleimide. SUBCELLULAR LOCATION: Cytoplasm (Probable). ALTERNATIVE PRODUCTS: 5 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Mainly expressed in the skeletal muscle, followed by brain, heart, liver and pancreas. SIMILARITY: Belongs to the peptidase C54 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (CLERFFDSEDED) corresponding to the C-terminus of human ATG4B protein conjugated to Blue Carrier Protein has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from of ATG4B protein in mouse and rat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence, WB. A dilution of 1:100 to 1:2000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A. J. Smuder et al (2011) Exercise protects against doxorubicin-induced markers of autophagy signaling in skeletal muscle. J Appl Physiol. 2011 Jul 21
Specificity:
IHC, WB and ELISA confirmed the specificity for ATG4B. Human, rat. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Neurturin (NTN) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Neurturin (NTN) is a member of the GDNF family of neurotrophic factors. This protein is a potent survival factor for several populations of central and peripheral neurons in mature and developing rodents. FUNCTION: Supports the survival of sympathetic neurons in culture. May regulate the development and maintenance of the CNS. Might control the size of non-neuronal cell population such as haemopoietic cells. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. DISEASE: Defects in NRTN are a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, and possibly with other loci, defects in NRTN are involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human Neurturin (rh NTN)
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
Immunohistochemistry (IHC) at a suggested dilution of 1:2000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
NRTN; NTN;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity of this product was demonstrated by immunohistochemistry and dot blot showed no cross reactivity with GDNF. This antibody is known to react with human, mouse and rat.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Autophagy-related protein 4 homolog C (ATG4C) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Cysteine protease required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form (form II). Form II, with a revealed C-terminal glycine, is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes. ENZYME REGULATION: Inhibited by N-ethylmaleimide. SUBCELLULAR LOCATION: Cytoplasm (Probable). SIMILARITY: Belongs to the peptidase C54 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (CTVYNSDVIDKQ) corresponding to the C-terminal of human ATG4C protein conjugated to Blue Carrier Protein has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from ATG4C protein in mouse and rat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence and WB. A dilution of 1:100 to 1:2000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Smuder AJ et al. (2011) Exercise protects against doxorubicin-induced markers of autophagy signaling in skeletal muscle. J Appl Physiol (1985). 2011 Oct;111(4):1190-8.
Specificity:
IHC, ELISA and WB confirmed the specificity for ATG4C. Human, rat. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
The elF2c (Argonaute, Ago) protein is a core protein of the RNA-induced silencing complex (RISC).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide corresponding to a sequence (845-860 aa) from the C-terminus of mouse elF2C conjugated to KLH.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,IP,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB), Immunochemistry (IHC) and Immunoprecipitation (IP). The recommended concentration for IHC in formalin fixed and paraffin embedded tissues and formalin/acetone fixed tissues is 1:200-1:500. For WB, the recommended concentration is 1:1,000 to 1:2,000. The elFC2 protein has a predicted length of 860 residues and the MW of the monomer is 94 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Protein argonaute-1; Protein argonaute-2; Protein argonaute-3; Argonaute1; Argonaute2; Argonaute3; mAgo1; mAgo2; Eukaryotic translation initiation factor 2C; eIF-2C 2; eIF-2C 1; eIF2C 2; Piwi/argonaute family protein meIF2C2 Protein slicer; Eif2c2; Ago1; Ago2;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Huang KL, Chadee AB, Chen CY, Zhang Y, Shyu AB. (2013)"Phosphorylation at intrinsically disordered regions of PAM2 motif-containing proteins modulates their interactions with PABPC1 and influences mRNA fate." RNA. 2013 Jan 22. [Epub ahead of print]. Lugli G. et al (2008) Expression of microRNAs and their precursors in synaptic fractions of adult mouse forebrain. J Neurochem. Jul;106(2):650-61. Lugli G. et al (2005) Dicer and eIF2c are enriched at postsynaptic densities in adult mouse brain and are modified by neuronal activity in a calpain-dependent manner. J Neurochem. Aug;94(4):896-905.
Specificity:
Specificity has been confirmed by IHC, WB and IP in mouse brain. This antibody is expected to recognise at least elF2c-1, 2 and 3 since they have identical C-termini. Human; mouse; rat; The Ago proteins are highly conserved so cross-reactivity with other species is expected.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
Rabbit anti-Leptin Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Leptin is secreted by white adipocytes and functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. Leptin has a variety of other roles including endocrine functions, regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing (Ref Entrez Gene).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
Recombinant rat Leptin protein
Applications:
ELISA,WB
Antibody Isotype:
Mixed
Application Details:
WB and ELISA. Suggested dilution of 1:1,000-1:4,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Leptin; Obesity factor; Lep; Ob; Obese protein;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Mouse, Rat
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Leptin Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Leptin is secreted by white adipocytes and functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. Leptin has a variety of other roles including endocrine functions, regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing (Ref Entrez Gene).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant human Leptin protein
Applications:
ELISA,WB
Antibody Isotype:
Mixed
Application Details:
WB and ELISA. Suggested dilution of 1:1,000-1:2,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Leptin; Obesity factor; Lep; Ob; Obese protein;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Leptin
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3 B) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
MAP1LC3B is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. MAP1LC3B is probably involved in formation of autophagosomal vacuoles (autophagosomes). SUBCELLULAR LOCATION: LC3-I: Cytoplasm. LC3-II: Intracytoplasmic membrane; lipid-anchor. Cytoplasmic vesicle; autophagosome; autophagosomal membrane; lipid-anchor. LC3-II binds to the autophagic membranes. TISSUE SPECIFICITY: Most abundant in heart, brain, skeletal muscle and testis. Little expression observed in liver. PTM: The precursor molecule is cleaved by APG4B/ATG4B to form LC3-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form LC3-II. SIMILARITY: Belongs to the MAP1 LC3 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (FEQRVEDVRLIC) corresponding to the N-terminal of human MAP1LC3 B protein conjugated to Blue Carrier Protein has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from mouse and rat MAP1LC3 B protein.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence, WB. A dilution of 1:100 to 1:1000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Theron AE et al. (2013) Molecular crosstalk between apoptosis and autophagy induced by a novel 2-methoxyestradiol analogue in cervical adenocarcinoma cells. Cancer Cell Int. 2013 Aug 27;13(1):87. Pilchowski R. et al. (2011) Specific Protein Patterns Characterize Metastatic Potential of Advanced Bladder Cancer. J Urol. 2011 Jun 16.
Specificity:
IHC, WB and ELISA confirmed the specificity for MAP1LC3 B. Human, rat. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Whole serum
Target:
Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3 B)
Rabbit anti-Endothelin B receptor (ET-BR) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
The Endothelin B receptor is a multi-pass membrane protein that belongs to the G-protein coupled receptor 1 family. It acts as a non-specific receptor for endothelin 1, 2, and 3.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A peptide from human Endothelin B receptor (299-313 aa).
Applications:
WB
Antibody Isotype:
IgG
Application Details:
WB. Suggested dilution of 1:1,000-1:5,000. Human Endothelin B receptor has a predicted length of 442 residues and MW of 50 kDa. Biosensis recommends that the optimal working dilution should be determined by the end user.
Rabbit anti-Acetyl Lysine Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Lysine acetylation of histones and non-histone proteins plays an important part in many cellular processes such as chromatin and nuclear signaling, transcription, gene silencing, cell cycle progression, apoptosis, differentiation, DNA replication and repair.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Rabbit
Species Reactivity:
Species Independent
Immunogen:
Acetylated Lysine OVA
Applications:
WB
Antibody Isotype:
IgG
Application Details:
WB. Suggested dilution of 1:1,000-1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Acetyl-lysine;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Binds to proteins with acetylated lysine residues.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Activity-regulated cytoskeleton-associated protein (Arg3.1) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Arc (also termed activity-regulated cytoskeleton-associated protein or Arg3.1), is an effector immediate early gene whose upregulation has been demonstrated during events of synaptic plasticity. Arg3.1 expression is detectable in neuronal cell bodies and dendrites in the brain regions including striatum and cortex hippocampus, hypothalamus, amygdala.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, containing no preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide from the C terminal of human Arg3.1 protein (ARC protein) conjugated to Blue Carrier Protein. The sequence is homologous with mouse and rat form of Arg3.1.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1: 50 to 1: 1000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specific for Arg3.1. Rat and Mouse. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability. Glycerol (1:1) may be added for an additional stability. Sodium azide or other appropriate antibacterial agent should be added if material is to be kept any length of time at 2-8°C. Avoid repetitive freeze/thaw cycles.
Purification:
Whole serum
Target:
Activity-regulated cytoskeleton-associated protein (Arg3.1)
Rabbit anti-Tyrosine Kinase Receptor A (TrkA) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, ELISA.
Background Info:
TrkA is a member of the neurotrophic tyrosine kinase receptor family. It is a membrane-bound receptor that upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. TrkA is required for high-affinity binding to nerve growth factor (NGF), neurotrophin-3 and neurotrophin-4/5 but not brain-derived neurotrophic factor (BDNF). TrkA leads to cell differentiations and may play a role in specifying sensory neuron subtypes. It has a crucial role in the development and function of the nociceptive reception system as well as establishment of thermal regulation via sweating. SUBUNIT: Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. SUBCELLULAR LOCATION: Cell membrane; single-pass type I membrane protein. Endocytosed to the endosomes upon treatment of cells with NGF. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. Both isoforms have similar biological properties. TISSUE SPECIFICITY: Isoform TrkA-II is primarily expressed in neuronal cells. Isoform TrkA-I is found in non-neuronal tissues. Mutations in TrkA have been associated with congenital insensitivity to pain, anhidrosis, self-mutalating behaviour, mental retardation and cancer.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Extracellular domain of glycosylated human TrkA protein produced in mammalian cells was used as the immunogen.
Applications:
ELISA,IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC (1:1000 dilution), Western Blotting (denaturing and <b>non-reducing</b> SDS-PAGE, 1:1000-1:2500 dilution), 1-site ELISA (1:5000 dilution). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Matusica D et al. (2020) Differentiation of the 50B11 dorsal root ganglion cells into NGF and GDNF responsive nociceptor subtypes. Mol Pain. 16:1744806920970368 Application: Rat, WB. Kobayashi K et al. (2015) Nerve Growth Factor Signals as Possible Pathogenic Biomarkers for Perineural Invasion in Adenoid Cystic Carcinom. Otolaryngol Head Neck Surg. 153(2):218-24 Application: Human, IHC. Uren RT et al. (2014) A novel role of suppressor of cytokine signaling-2 in the regulation of TrkA neurotrophin receptor biology. J Neurochem. 129(4):614-27 Application: Mouse, IF.
Specificity:
Specificity was demonstrated by immunohistochemistry. When used for immunohistochemistry in rat dorsal root ganglia, staining is restricted to the known distribution of TrkA, that is in small, nociceptive neurons. Reacts with human, rat and mouse TrkA. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Tyrosine Kinase Receptor C (TrkC) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
TrkC is a member of the neurotrophic tyrosine receptor kinase family. TrkC is a membrane-bound receptor that upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. TrkC is the receptor for neurotrophin-3 (NT-3). Signalling through TrkC leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. SUBUNIT: Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. SUBCELLULAR LOCATION: Membrane; single-pass type I membrane protein. ALTERNATIVE PRODUCTS: 4 named isoforms produced by alternative splicing. Additional isoforms seem to exist. Mutations in TrkC have been associated with medulloblastomas, secretory breast carcinomas and other cancers.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Extracellular domain of glycosylated human TrkC protein produced in CHO cells was used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:1000 to 1:3000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity was demonstrated by immunohistochemistry. This antibody was used to stain cryostat sections of the rat peripheral sensory ganglia. Reacts with human, rat and mouse TrkC. Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Synthetic human Neurotensin peptide (151-163 aa) conjugated to BSA
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neuromedin N; NTS; NN; NmN; NT; NmN-125;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; rat. Highly conserved and expected to interact with bovine, feline and monkey
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
Rabbit anti-Somatostatin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded, ICC.
Background Info:
Somatostatin is secreted by neuroendocrine neurons in hypothalamus and interacts with somatostatin receptors inhibiting secretion of somatotropin.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic Somatostatin peptide (103-116) conjugated to BSA.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human Somatostatin. Cross reactivity is expected with mouse, rat, other species not yet tested.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for up to six months for a higher stability and at 2-8°C for one week with an appropriate antibacterial agent. Avoid freeze-thaw cycles
Rabbit anti-Sortilin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, ELISA.
Background Info:
FUNCTION: Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi. SUBUNIT: Interacts with LPL and SLC2A4. Interacts with the cytosolic adapter proteins GGA1 and GGA2. Interacts with numerous ligands including the receptor-associated protein LRPAP1/RAP, GM2A and PSAP. Forms a complex with NGFR which binds specifically to the precursor forms of NGFB (proNGFB) and BDNF (proBDNF). SUBCELLULAR LOCATION: Membrane; single-pass type I membrane protein. Localized to membranes of the endoplasmic reticulum, endosomes, Golgi stack, lysosomes and nucleus. A small fraction of the protein is also localized to the plasma membrane. May also be found in SLC2A4/GLUT4 storage vesicles (GSVs) in adipocytes. Localization to the plasma membrane in adipocytes may be enhanced by insulin. TISSUE SPECIFICITY: Expressed at high levels in brain, spinal cord, heart, skeletal muscle, thyroid, placenta and testis. Expressed at lower levels in lymphoid organs, kidney, colon and liver. INDUCTION: During osteoblast differentiation. DOMAIN: The N-terminal propeptide may facilitate precursor transport within the Golgi stack. Intrachain binding of the N-terminal propeptide and the extracellular domain may also inhibit premature ligand binding. DOMAIN: The extracellular domain may be shed following protease cleavage in some cell types. PTM: The N-terminal propeptide is cleaved by furin and possibly other homologous proteases. PTM: Contains 8 intrachain disulfide bonds. PTM: N-glycosylated. SIMILARITY: Contains 9 BNR repeats.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Extracellular domain of glycosylated human sortilin produced in CHO cells was used as the immunogen.
Applications:
ELISA,IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC, 1-site ELISA (1:5000 dilution). A dilution of 1:1000 is recommended for IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity was demonstrated by immunohistochemistry. Reacts with human, rat and mouse Sortilin. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
The hormone Atrial natriuretic peptide (ANP) is produced by cardiomyocites and is secreted into the bloodstream. ANP acts on convoluted tubules in kidney reducing sodium absorption which results in reducing the blood pressure.
Synthetic rat Atrial natriuretic peptide (123-150 aa) conjugated to BSA.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human; mouse; rat. Highly conserved and expected to interact with feline, canine, porcine, bovine, and equine ANP.
Storage:
At least 12 months after purchase at 2 - 8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for up to 6 months for a higher stability and at 2-8°C with an appropriate antibacterial agent for up to 2 weeks.Avoid freeze-thaw cycles
Rabbit anti-Met-Enkephalin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded, ICC.
Background Info:
Human Methionine enkephalin (Met-Enkephalin) is a small 5 amino acid peptide cleaved from the precursor pro-opiomelanocortin (POMC). Met-Enkephalin is an endogenous opioid peptide that interacts with opioid receptors and produces analgesic effects.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic human Met-enkephalin peptide (237-241) conjugated to BSA.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Pro-opiomelanocortin; POMC;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; rat. Met-Enkephalin is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Leu-enkephalin 5.8%; with beta-lipotropin 0.01%; with beta-endorphin 0.01%
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Rabbit anti-Leu-Enkephalin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded, ICC.
Background Info:
Leu-Enkephalin is cleaved from the precursor Proenkephalin-A. Leu-Enkephalin is an endogenous opioid peptide that interacts with opioid receptors and produces analgesic effects.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic human Leu-Enkephalin peptide (230 - 234) conjugated to BSA.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Proenkephalin-A; PENK;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; rat. Leu-Enkephalin is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Met-enkephalin 0.93%; with beta-lipotropin 0.01%; with beta-endorphin 0.01%
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Rabbit anti-Gastrin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded, ICC.
Background Info:
Human Gastrin is a 101 amino acid hormone produced by G cells of the duodenum, stomach and pancreas. It stimulates secretion of hydrochloric acid by parietal cells of the stomach. Gastrin is also secreted into bloodstream.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic human Gastrin peptide (76-85 aa) conjugated to BSA.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human Gastrin , Cross reactivity is expected with mouse, rat, other species not yet tested.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Endomorphins 1 and 2 are endogenous opioid peptides which have the highest affinity for the mu-opioid receptors. Located in various parts of the brain and interacts with mu-opioid receptors and produces analgesia.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic Endomorphin-2 (YPFF) peptide conjugated to BSA. Selectivity towards Endomorphin-2 was achieved by separating fraction of affinity purified antibodies which did not bind to Endomorphin-1.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
EM 2;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Endomorphin-2 peptide
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Rabbit anti-Endomorphin-1 and Endomorphin-2 (E-1/E-2) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded, ICC.
Background Info:
Endomorphins 1 and 2 are endogenous opioid peptides which have the highest affinity for the mu-opioid receptors. Located in various parts of the brain and interacts with mu-opioid receptors and produces analgesia.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Antibodies to human Endomorphins 1 and 2 were made by immunising rabbits with the human Endomorphin-1 peptide (YPWF) and then selecting those antibodies that cross-reacted with both human Endomorphins 1 and 2.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
EM 1; EM 2;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; rat. Endomorphin-1 is highly conserved molecule so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Endomorphin-2 = 70%; Met-enkephalin <0.03%; with Leu-enkephalin 0.01%; with beta-endorphin<0.1%.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Endomorphins 1 and 2 are endogenous opioid peptides which have the highest affinity for the mu-opioid receptors. Located in various parts of the brain and interacts with mu-opioid receptors and produces analgesia.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic human Endomorphin-1 (YPWF) peptide conjugated to BSA. Selectivity towards Endomorphin-1 was achieved by separating fraction of affinity purified antibodies which did not bind to Endomorphin-2.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
EM 1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; rat. Endomorphin-1 is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Endomorphin-2 <5%; Met-enkephalin <0.03%; with Leu-enkephalin 0.01%; with beta-endorphin<0.1%
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Human beta-Lipotropin is a 93 amino acid polypeptide that is cleaved from carboxy-terminal fragment of the precursor pro-opiomelanocortin (POMC). It stimulates melanocytes to produce melanin, and can also be cleaved into smaller peptides including opioid peptides: gamma-lipotropin, alpha-MSH, beta-MSH, gamma-MSH, alpha-endorphin, beta-endorphin, gamma-endorphin and met-enkephalin
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic peptide (179-267 aa) of human beta-Lipotropin conjugated to thyroglobulin was used as the immunogen.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human; mouse; rat. Beta-Lipotropin is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Leu-enkephalin 0.01%; with Met-Enkephalin 0.01%; with beta-endorphin 0.01%
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Human beta-endorphin is a 31 amino acid peptide cleaved from the precursor pro-opiomelanocortin (POMC). It is an endogenous opioid peptide neurotransmitter that interacts with opioid receptors.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic human beta-endorphin peptide (1-31 aa) conjugated to BSA.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. For radioimmunoassay (RIA), a working dilution of 1:10,000 is recommended. Sensitivity - 120 pg/sample; IC50-1 ng/ sample. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
-endorphin; Pro-opiomelanocortin; POMC;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by RIA against the synthetic peptide. Human; mouse; rat. Beta-endorphin is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Met-enkephalin 0.03%; with Leu-enkephalin 0.02%; with beta-lipotropin 0.34%.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Rabbit anti-Adrenocorticotropic hormone (ACTH) Polyclonal Antibody (Unconjugated), suitable for IHC-Paraffin-embedded.
Background Info:
Adrenocorticotropic hormone (ACTH) is cleaved from the precursor pro-opiomelanocortin (POMC). The hormone is produced and secreted by the pituitary gland and stimulates release of cortisol by adrenal glands.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Pig,Rat
Immunogen:
Porcine Adrenocorticotropic hormone (ACTH) conjugated to BSA
Applications:
IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Corticotropin; ACTH; Pro-opiomelanocortin; POMC;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; rat; ACTH is highly conserved so cross-reactivity with other species is expected.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Rabbit anti-Tyrosine Kinase Receptor B (TrkB) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, ELISA.
Background Info:
TrkB is a member of the neurotrophic tyrosine receptor kinase family. It is a membrane-bound receptor and upon neurotrophin binding, it phosphorylates itself as well as MAPK pathways members. TrkB is the receptor for brain-derived neurotrophic factor (BDNF), neurotrophin-3 and neurotrophin-4/5 but not nerve growth factor (NGF). It is Involved in the development and/or maintenance of the nervous system. SUBUNIT: Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. SUBCELLULAR LOCATION: Membrane; single-pass type I membrane protein. ALTERNATIVE PRODUCTS: 4 named isoforms produced by alternative splicing. Additional isoforms seem to exist. TISSUE SPECIFICITY: The different forms are differentially expressed in various cell types. SIMILARITY: Belongs to the Tyr protein kinase family. Insulin receptor subfamily. SIMILARITY: Contains 2 Ig-like C2-type (immunoglobulin-like) domains. SIMILARITY: Contains 2 LRR (leucine-rich) repeats. SIMILARITY: Contains 1 protein kinase domain. Mutations in the TrkB gene have been associated with obesity and mood disorders.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
Extracellular domain of glycosylated mouse TrkB protein produced in CHO cells was used as the immunogen. As shown for similar antisera, it is anticipated that this antibody will block the TrkB receptor binding of corresponding neurotrophin ligand.
Applications:
ELISA,IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IF (1:1000-1:3000), 1-site ELISA (1:10,000 dilution). A dilution of 1:1000 to 1:3000 o/n is recommended for IF. 4% PFA frozen sections tested. Not yet tested on paraffin embedded tissues. Use triton X-100 permeabilizaiton with frozen sections. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rudolph M (2020). Mesolimbic GluA1 AMPA Receptor Signaling in Dopaminergic Neurons Plays a Critical Role in the Induction of Cross-Sensitization to Psychostimulants in Response to Social Stress. PhD Thesis. Application: IHC (IF), frozen sections. Species: Rat. Penzo MA et al. (2015). The paraventricular thalamus controls a central amygdala fear circuit. Nature. [Epub ahead of print]. Application: IHC (IF), 4% PFA, frozen sections. Species: Mouse.
Specificity:
Specificity was demonstrated by immunohistochemistry. This antibody was used to stain cryostat sections of the rat peripheral sensory ganglia. Reacts with rat and mouse TrkB. Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Tyrosine Hydroxylase (TH) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Tyrosine hydroxylase (TH) is the rate-limiting enzyme in the synthesis of the catecholamines dopamine, epinephrine and norepinephrine. Therefore the regulation of the TH enzyme represents the central means for controlling the synthesis of these important catecholamines. FUNCTION: Plays an important role in the physiology of adrenergic neurons. CATALYTIC ACTIVITY: L-tyrosine + tetrahydrobiopterin + O2 = 3,4-dihydroxy-L-phenylalanine + 4a-hydroxytetrahydrobiopterin. COFACTOR: Fe(2+) ion. ENZYME REGULATION: Phosphorylation leads to an increase in the catalytic activity. PATHWAY: Catecholamine biosynthesis; first step. SUBUNIT: Homotetramer. PTM: In vitro, phosphorylation of Ser-19 increases the rate of Ser-40 phosphorylation, which results in enzyme opening and activation. SIMILARITY: Belongs to the biopterin-dependent aromatic amino acid hydroxylase family. The presence of different DNA sequences at the TH locus confers susceptibility to various disorders of the brain including manic-depression and schizophrenia. Parkinson's disease is also considered a TH deficiency as low dopamine levels are a consistent neurochemical abnormality.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (SPRFIGRRQSLIEDARK) as part of human Tyrosine Hydroxylase (aa: 32-47) conjugated to KLH
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
<b>Immunohistochemistry (IHC):</b> 0.5-1 ug/mL. This is a superb antibody for detection of tyrosine hydroxylase containing neurons exhibiting an intense labelling with a negligible background. This antiserum has proven extremely useful for staining of catecholaminergic neurons. It stains nicely and intensely dendritic processes and fine nerve terminals.<br><b>Western Blotting (WB):</b> 0.5-2 ug/mL. This antibody demonstrates clear immunoreactivity for TH at 60 kDa in rat PC12 cell lysate and mouse brain homogenate. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
IHC on brain shows a pattern of staining specific for TH containing neurons. This antibody is known to react with rat. Cross reactivity with other species has not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
MAP1A and MAP1B are microtubule-associated protein which mediate the physical interactions between microtubules and components of the cytoskeleton (probably involved in autophagosome formation). MAP1A and MAP1B each consist of a heavy chain subunit and 3 different light chain subunits (LC1, LC2 and LC3). MAP1LC3A is one of the light chain subunits and can associate with either MAP1A or MAP1B. The precursor form of MAP1LC3A is cleaved by APG4/ATG4B to form the cytosolic form LC3-1. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, LC3-II. MAP1LC3A is most abundant in heart, brain, liver, skeletal muscle and testis but is absent in thymus and peripheral leukocytes.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (RSFADRCKEVQQI) corresponding to the N-terminal of human MAP1LC3 A protein conjugated to Blue Carrier Protein has been used as the immunogen. The sequence is homologous with mouse and rat MAP1LC3 A.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunohistochemistry on 4% PFA fixed or 2% PLP fixation, 1:100-1000 primary antibody dilution. IC, Immunocytochemistry: acetone fixed specimens recommended. 1:100-1:1000 primary antibody dilution. Western Blot: R-146-100 requires samples to be denatured ONLY by boiling in SDS solution, not reduced. No signal is achieved using reduced samples. (Samples treated with DTT or Beta mercaptoethanol). 1:500 overnight 4 degrees is recommended for primary antibody dilution in western blots. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
IHC, WB and ELISA confirmed the specificity for MAP1LC3 A. Human, rat. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Autophagy-related protein 10 (ATG10) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
ATG10 plays a role in autophagy. It is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12-ATG5 conjugations and modificatioon of a soluble form of MAPLC3 1A, a homolog of yeast ATG8, to a membrane bound form. It is also able to directly interact either with ATG5 or ATG7.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A peptide (CLKNSQKINKNV) corresponding to the C-terminal of human ATG10 protein has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence. A dilution of 1:100 to 1:1000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Autophagy-related protein 10; APG10-like; ATG10
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Ryningen A et al (2012) Inhibition of Mammalian target of rapamycin in human acute myeloid leukemia cells has diverse effects that depend on the environmental in vitro stress. Bone Marrow Res. 2012;2012:329061.
Specificity:
IHC, WB and ELISA confirmed the specificity for ATG10. Human. Other species not yet tested.
Storage:
After reconstitution keep aliquots at minus 20ºC for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Gamma-aminobutyric acid receptor-associated protein (GABARAP) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
GABARAP is highly positively charged in its N-terminus and shares sequence homology with MAP1LC3 1A and 1B. This protein clusters neurotransmitter receptors (GABA(A) receptors) by mediating interaction with the cytoskeleton. SUBUNIT: Interacts with GABRG2, TUBA1, ULK1 and NSF. Interacts with beta-tubulin and GPHN. SUBCELLULAR LOCATION: Intracytoplasmic membrane. Cytoskeleton. Largely associated with intracellular membrane structures including the Golgi apparatus and post-synaptic cisternae. Colocalizes with microtubules. TISSUE SPECIFICITY: Heart, brain, placenta, skeletal muscle, kidney and pancreas.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (FEKRRSEGEKIC) corresponding to the N-terminal of human GABARAP protein has been used as the immunogen. The sequence is homologous with mouse and rat form of GABARAP.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence, WB. A dilution of 1:200 to 1:1000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
IHC, WB and ELISA confirmed the specificity for GABARAP. Human, rat. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Whole serum
Target:
Gamma-aminobutyric acid receptor-associated protein (GABARAP)
FUNCTION: Involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1. SUBUNIT: Monomer. Interacts with GABRG2, NSF, GOSR1 and beta-tubulin. Interacts with ULK1. SUBCELLULAR LOCATION: Golgi apparatus. TISSUE SPECIFICITY: Ubiquitous. Expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. Expressed at very low levels in lung, thymus and small intestine. SIMILARITY: Belongs to the MAP1 LC3 family. ESTIMATED MOLECULAR WEIGHT: 13.667 kDa.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (CVESAKIRAKYP) corresponding to the N-terminal of human GABARAP L2 (GABARAPL2) protein has been used as the immunogen. The sequence is homologous with mouse and rat form of GABARAP L2 (GABARAPL2).
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence, WB. A dilution of 1:200 to 1:1000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Gamma-aminobutyric acid receptor-associated protein-like 2; GABA(A) receptor-associated protein-like 2; Ganglioside expression factor 2; GEF-2; General protein transport factor p16; MAP1 light chain 3-related protein; GABARAPL2; FLC3A; GEF2;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
IHC, WB and ELISA confirmed the specificity for GABARAP L2 (GABARAPL2). A 14 kDa band, that corresponds to the molecular weight of GABARAPL2, is detected via western blot analysis. Human, rat. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Beclin-1 Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Beclin-1 plays a central role in autophagy. It may also play a role in antiviral host defense. It is ubiquitously expressed and it localises to the cytoplasm, golgi apparatus membrane, and in dendrites and cell bodies of cerbellar Purkinje cells. The unprocessed precursor has a length of 450 amino acids and an estimated molecular weight of 51.89 kDa.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
C-terminal of human Beclin-1 conjugated to Blue Carrier Protein.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:100 to 1:2000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Coiled-coil myosin-like BCL2-interacting protein; Protein GT197; APG 6; BECN1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specific for Beclin-1. Human, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Ubiquitin C Terminal Hydrolase 1 (UCHL1) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. The enzyme also binds to free monoubiquitin and may prevent its degradation in lysosomes (ref: SWISSPROT).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Chicken,Horse,Human,Mouse,Pig,Rat
Immunogen:
Recombinant full length human Ubiquitin C Terminal Hydrolase 1 (UCHL1) purified from E. coli.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (IC). A dilution of 1:1,000 - 1:2,000 is recommended for WB. A dilution of 1:500-1:1,000 is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB. This antibody detects ~24 kDa UCHL1 enzyme. Suitable control tissue is rat spinal cord or peripheral nerve homogenate. Hu, Rat, Ms, Bov, Por
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Ubiquitin Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Ubiquitin is a highly conserved 76 amino acid protein with an estimated molecular weight of 8.56 kDa which has a central role in regulated protein degradation. It is a protein modifier which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Several types of polymeric chains can be formed depending on the lysine used for the assembly. Attachment to proteins as a polymer leads to their degradation by the 26S proteosome; a complex, multicatalytic cytosolic and nuclear protease. Attachment to proteins as a monomer or as an alternatively linked polymer does not lead to proteasomal degradation and may be required for numerous functions, including maintenance of chromatic structure, regulation of gene expression, stress response, ribosome biogenesis and DNA repair. Ubiquitin is synthesized as a polyubiquitin precursor with exact head to tail repeats, the number of repeats of which differ between species and strains. In some species there is a final amino-acid after the last repeat, here in bovine a Cys. Some ubiquitin genes contain a single copy of ubiquitin fused to a ribosomal protein (either L40 or S27a).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Glutaraldehyde cross-linked ubiquitin.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:500-1,000 is recommended for ICC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB. This antibody detects ~8.5 kDa Ubiquitin. Human. Predicted to react with other mammalian tissues.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Peripherin Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Peripherin is a class-III neuronal intermediate filament protein found in certain classes of neuron, most of which are located in the peripheral nervous system.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Pig,Rat
Immunogen:
Recombinant full length Peripherin protein expressed in and purified from E.coli.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (IC). A dilution of 1:2,000 - 1:10,000 is recommended for WB. A dilution of 1:1,00-1:2,000 is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Peripherin; Prph; Prph1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Ise H. et al (2017) Elucidation of GlcNAc-binding properties of type III intermediate filament proteins, using GlcNAc-bearing polymers. Genes Cell. 2017 Sep; [Epub ahead of print] Sekerkova G. et al (2008) Espin actin-cytoskeletal proteins are in rat type I spiral ganglion neurons and include splice-isoforms with a functional nuclear localization signal. J Comp Neurol. 2008 Aug 20;509(6):661-76.
Specificity:
The specificity of this antibody has been confirmed by WB. This antibody detects ~57 kDa Peripherin protein and a smaller molecule derived from Peripherin at ~48 kDa. Hu, Rat, Ms, Fel, Rb. Predicted to react with other mammalian tissue.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Microtubule-associated protein 1 light chain 3 gamma (MAP1LC3C) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, ICC.
Background Info:
FUNCTION: Probably involved in formation of autophagosomal vacuoles (autophagosomes). SUBUNIT: 3 different light chains, LC1, LC2 and LC3, can associate with MAP1A and MAP1B proteins. SUBCELLULAR LOCATION: LC3-I: Cytoplasm. LC3-II: Intracytoplasmic membrane; lipid-anchor. LC3-II binds to the autophagic membranes. TISSUE SPECIFICITY: Most abundant in placenta, lung and ovary. PTM: The precursor molecule is cleaved by APG4B/ATG4B to form the cytosolic form, LC3-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, LC3-II. SIMILARITY: Belongs to the MAP1 LC3 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (CQEEVAGIRAKF) corresponding to the N-terminal of human MAP1LC3 C conjugated to Blue Carrier Protein has been used as the immunogen. The peptide is homologous with the corresponding sequence deriven from MAP1LC3 C protein in Macaca mulatta (monkey) and Canis familiaris (dog).
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence, WB. A dilution of 1:100 to 1:1000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
IHC and WB confirmed the specificity for MAP1LC3 C . This antibody should recognise MAP1LC3 C only and not the other forms MAP1LC3A and MAP1LC3B. Human, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Whole serum
Target:
Microtubule-associated protein 1 light chain 3 gamma (MAP1LC3C)
Rabbit anti-Neuron specific enolase (NSE) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Enolase is a metalloenzyme that catayzes the reaction between 2-phospho-D-glycerate and phosphoenolpyruvate during glycolysis. Mammalian enolase is composed of 3 subunits; alpha, beta and gamma (Neuron-specific enolase). These subunits can form homodimers or heterodimers. The alpha/gamma heterodimer and the gamma/gamma homodimer are found primarily in neurons.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human Neuron Specific Enolase (NSE) expressed in and purified from E.coli
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:1,000 - 1:2,000 is recommended for WB. A dilution of 1:500 is recommended for ICC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rabbit anti-Neurofilament Medium (NF-M) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, ICC.
Background Info:
Neurofilaments are composed of three intermediate filament proteins: light (~68 kDa), medium (~160 kDa) and heavy (~200 kDa), which are involved in the maintenance of the neuronal caliber. Neurofilament medium runs on SDS-PAGE gels in the range 145-170 kDa, with some variation in different species.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Chicken,Horse,Human,Mouse,Pig,Rat
Immunogen:
A recombinant fusion protein containing the extreme C-terminus of rat NF-M expressed in and purified from E. coli.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:1,000 - 1:5,000 is recommended for WB, ICC and IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neurofilament medium polypeptide; NF-M; 160 kDa neurofilament protein; Neurofilament 3; Neurofilament triplet M protein; Nefm; Nef3; Nfm;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specifically recognizes the medium neurofilament subunit NF-L in WB. Band appears at ~145 kDa in WB from rodent and ~160 kDa for human and bovine WB. Hu, Rat, Ms, Fel, Chk
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Neurofilaments are composed of three intermediate filament proteins: light (~68 kDa), medium (~160 kDa) and heavy (~200 kDa), which are involved in the maintenance of the neuronal caliber. Neurofilament light (NF68 or NF-L) is the most abundant of the three proteins.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Pig,Rat
Immunogen:
Recombinant full length human NF-L protein
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:10,000 - 1:20,000 is recommended for WB. A dilution of 1:2,000 - 1:5,000 is recommended for ICC/IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rabbit anti-Neurofilament Heavy, phosphorylated and non-phosphorylated (pNF-H) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Neurofilaments contain three intermediate filament proteins: light (68 kDa), medium (160 kDa) and heavy (200 kDa). Neurofilament heavy (NF200 or NF-H) is phosphorylated and it is thought that this results in the formation of interfilament cross bridges that are important in the maintenance of axonal caliber.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Other Mammals (Predicted),Rat
Immunogen:
Purified rat NF-H construct containing most of the tandem KSP repeats expressed and purified from E.coli.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (IC). Suggested dilution for WB of 1:5,000-10,000. Suggested dilution for IC is 1:500-1,000. This antibody stains dendritic and perikaryal neurofilaments particularly well. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
NF-200; NF200; NF-H; NEFH; N52; Neurofilament heavy polypeptide; Neurofilament triplet H protein; 200 kDa neurofilament protein; KIAA0845; NFH;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB. This antibody reacts with noth phosphorylated NF-H at approx 200 kDa and non-phosphorylated NF-H at 160 kDa. Rat. Predicted to react with other mammals due to sequence homology.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
Neurofilament Heavy, phosphorylated and non-phosphorylated (pNF-H)
Neurofilaments contain three intermediate filament proteins: light (68 kDa), medium (160 kDa) and heavy (200 kDa). Neurofilament heavy (NF200 or NF-H) is phosphorylated and it is thought that this results in the formation of interfilament cross bridges that are important in the maintenance of axonal caliber.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Horse,Human,Mouse,Pig,Rat
Immunogen:
Native NF-H purified from bovine spinal cord
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunocytochemistry (IHC). Suggested dilution for WB of 1:5,000-10,000. Suggested dilution for ICC/IHC is 1:1,000-1:5,000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
NF-200; NF200; NF-H; NEFH; N52; Neurofilament heavy polypeptide; Neurofilament triplet H protein; 200 kDa neurofilament protein; KIAA0845; NFH;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Hashiguchi S et al. (2019) "Ataxic phenotype with altered CaV3.1 channel property in a mouse model for spinocerebellar ataxia 42." Neurobiol Dis. Jun 20:104516 [Epub ahead of print]. Application: IHC. Species: Human.
Specificity:
The specificity of this antibody has been confirmed by WB. This antibody reacts with phosphorylated NF-H and is seen as a band of approx 200 kDa. Rat. Predicted to react with other mammals due to sequence homology.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Autophagy protein 5 (ATG5) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Required for autophagy. Conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and autophagosome. The conjugate detaches from the membrane immediately before or after autophagosome formation is completed. FUNCTION: May play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity. SUBCELLULAR LOCATION: Cytoplasm. Colocalizes with nonmuscle actin. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Ubiquitous. The mRNA is present at similar levels in viable and apoptotic cells, whereas the protein is dramatically highly expressed in apoptotic cells. INDUCTION: By apoptotic stimuli. PTM: Conjugated to ATG12; which is essential for autophagy, but is not required for association with isolation membrane. SIMILARITY: Belongs to the ATG5 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide corresponding to the C-terminal of human ATG-5L. No immunogenic carrier protein was conjugated to the immunogen. Instead, Adjukine B (see the Adjuvants in biosensis' product list) has been used to orchestrate/boost the immune response.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Flow Cytometry (2 ?g/10^6 cells), IHC, immunofluorescence, WB. Use a dilution of 1:200 to 1:1000 for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Autophagy protein 5; APG5-like; APG 5; APG5; Apoptosis-specific protein; ATG5; APG5L; ASP
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Villanueva-Paz M. et al. (2016) Amitriptyline induces mitophagy that precedes apoptosis in human HepG2 cells. Genes Cancer. 2016;7(7-8):260-277 Garrido-Maraver J. et al (2012) Screening of effective pharmacological treatments for MELAS syndrome using yeasts, fibroblasts and cybrids models of the disease Br J Pharmacol. 2012 Jul 2. De la Mata M. et al (2012) Recovery of MERRF fibroblasts and cybrids pathophysiology by Coenzyme Q10 Neurotherapeutics. 2012 Apr;9(2):446-63. Cotan D. et al. (2011) Secondary coenzyme Q10 deficiency triggers mitochondria degradation by mitophagy in MELAS fibroblasts FASEB J. 2011
Specificity:
IHC and wb confirmed the specificity for ATG5. Human, not yet tested in other species.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues in association with MMP14. PEX, the C-terminal non-catalytic fragment of MMP2, posseses anti-angiogenic and anti-tumor properties and inhibits cell migration and cell adhesion to FGF2 and vitronectin. Ligand for integrinv/beta3 on the surface of blood vessels. MMP2 isoform 2 mediates the proteolysis of CHUK/IKKA and initiates a primary innate immune response by inducing mitochondrial-nuclear stress signaling with activation of the pro-inflammatory NF-kappaB, NFAT and IRF transcriptional pathways. Catalytic activity of MMP2 causes cleavage of gelatin type I and collagen types IV, V, VII, X. Cleaves the collagen-like sequence Pro-Gln-Gly-|-Ile-Ala-Gly-Gln. (Ref: uniprot.org).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Western Blotting (WB): 1:5,000 - 1:10,000. MMP2 appears as two bands at apparent molecular weights of 66 and 72 kDa. Immunohistochemistry (IHC): 1:500-1:1,000.<br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
72 kDa gelatinase; Gelatinase A; MMP-2; TBE-1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human. Expected to react with horse, cow, pig, chicken, rat and mouse MMP2.
Storage:
Store lyophilized, unopened vial at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C to -80°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Myristoylated alanine rich C kinase substrate (MARCKS) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Myristoylated alanine-rich C-kinase substrate (MARCKS) is the most prominent cellular substrate for protein kinase C. This protein binds calmodulin, actin, and synapsin. MARCKS is a filamentous (F) actin cross-linking protein. Ref: SWISSPROT.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant full length MARCKS expressed and purified from E. coli
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (IC). A dilution of 1:10,000 - 20,000 is recommended for WB. A dilution of 1:500-1,000 is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Myristoylated alanine-rich C-kinase substrate; MARCKS; Protein kinase C substrate 80 kDa protein;Marcks; Macs;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB. Does not react with rodent protein.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
Myristoylated alanine rich C kinase substrate (MARCKS)
Neurofilaments can be defined as the intermediate or 10nm diameter filaments found in neuronal cells. They are composed a mixture of subunits which often includes the neurofilament triplet proteins, NF-L, NF-M and NF-H. Neurofilaments may also include peripherin, alpha-internexin, nestin and in some cases vimentin. Alpha-internexin is a ~66 kDa Class IV intermediate filament subunit expressed in large amounts early in neuronal development, but is downregulated in many neurons as development procedes. Many classes of mature neurons contain alpha-internexin in addition to NF-L, NF-M and NF-H. In some mature neurons alpha-internexin is the only neurofilament subunit expressed. Antibodies to alpha-internexin are therefore unique probes to study and classify neuronal types and follow their processes in sections and in tissue culture. In addition the very early developmental expression of alpha-internexin means its presence is an early and convenient diagnostic feature of neuronal progenitors cells and other cell committed to the neuronal lineage.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Cat,Human,Mouse,Other Mammals,Rat
Immunogen:
Recombinant alpha-internexin expressed and purified from E. coli
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:10,000 - 1:20,000 is recommended for WB. A dilution of 1:500-1,000 is recommended for ICC and IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB. This antibody is specific for the 64-66 kDa alpha-internexin protein. Molecular weight will depend on species. Hu, Rat, Ms, Fel, and other mammals
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Autophagy-related protein 12 (ATG12) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Required for autophagy. SUBUNIT: Conjugated to ATG5. SUBCELLULAR LOCATION: Cytoplasm. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Ubiquitous. SIMILARITY: Belongs to the ATG12 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide corresponding to the N-terminal of human ATG12 protein has been used as the immunogen. No immunogenic carrier protein was conjugated to the immunogen. Instead, Adjukine B (see the Adjuvants in biosensis' product list) has been used to orchestrate/boost the immune response.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, immunofluorescence, WB (1-5 µg/mL working concentration), Flow Cytometry (2?g/10^6 cells). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Autophagy-related protein 12; APG12-like; ATG12; APG12; APG12L
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
IHC and WB confirmed the specificity for ATG12. Human, rat
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Glial Fibrillary Acidic Protein (GFAP) Polyclonal Antibody (Unconjugated), suitable for WB, ICC, IHC-Frozen.
Background Info:
GFAP is a 50 kDa intra-cytoplasmic filamentous protein of the cytoskeleton in astrocytes. During the development of the central nervous system, it is a cell-specific marker that distinguishes astrocytes from other glial cells. GFAP immunoreactivity has been shown in immature oligodendrocytes, epiglottic cartilage, pituicytes, papillary meningiomas, myoepithelial cells of the breast and in non-CNS: Schwann cells, salivary gland neoplasms, enteric glia cells, and metastasizing renal carcinomas.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Horse,Human,Mouse,Pig,Rat
Immunogen:
Recombinant full length human GFAP isotype 1 expressed in and purified from E. coli.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:5,000 is recommended for WB, and 1:1,000 - 1:5,000 for ICC and IHC. A dilution of 1:1,000 using fluorescent secondary antibodies or 1:5,000 using peroxidase or other enzyme-linked methods is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Astrocyte; Glial fibrillary acidic protein; GFAP;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Coronin- 1A Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Coronins belong to the WD40 or WD family of proteins. Coronins appear to be particularly involved in binding to actin, actin associated proteins, tubulin and phospholipase C and have been implicated in the mechanisms of chemotaxis and phagocytosis. In mammals there are at least five major coronin proteins, named coronins 1 to 5 in one nomenclature. Another nomenclature divides these five proteins in coronins 1a and 1b, 2a, 2b and 2c (see the Human Genone Organization Gene Nomenclature Committee link for this family). The mammalian coronin family members are abundant components of eukaryotic cells and each type has a restricted cell type specific expression pattern. Coronin 1A is found exclusively in hematopoetic lineage cells such as lymphocytes, macrophages and neutrophils. This antibody is therefore an excellent marker of cells of this lineage and can also be used to study the leading edges particularly of neutrophils. Since the only hematopoetic cells found within the central nervous system are microglia, this antibody is also an excellent marker of this important cell type. Microglia are numerically fairly minor components of the nervous system, but microglial activation is seen in response to a wide variety of damage and disease states, including ALS, Alzheimer's disease and responses to brain tumors. Since coronin 1a is a constitutive component of microglia, the coronin 1a antibody can be used to study both quiescent and activated microglia.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Pig,Rat
Immunogen:
C-terminal peptide of human coronin 1a coupled to KLH
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:2,500-5,000 is recommended for WB. Human Coronin 1A has a predicted length of 461 residues and a MW of 51 kDa. A concentration of 1:500-1:1,000 is recommended for ICC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Coronin-1A; Coronin-like protein A; Clipin-A; Coronin-like protein p57; Tryptophan aspartate-containing coat protein; TACO; CORO1A; CORO1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Stephens A.N. et al (2010) Post-translational modifications and protein-specific isoforms in endometriosis revealed by 2D DIGE. J Proteome Res. 2010 May 7;9(5):2438-49. Ahmed Z. et al (2007) Actin-binding proteins coronin-1a and IBA-1 are effective microglial markers for immunohistochemistry. J Histochem Cytochem. 2007 Jul;55(7):687-700.
Specificity:
The specificity of this antibody has been confirmed by WB and ICC against the antigen. Human, Rat, Mouse and Feline. Predicted to react with other mammalian tissue.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-PRKR-like endoplasmic reticulum kinase (phosphorylated and non phosphorylated) (PERK) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
PERK (PKR-like ER kinase) is a single-pass type I ER membrane protein with a stress-sensing luminal domain connected by a transmembrane segment to a cytoplasmic-kinase domain.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. 50% glycerol
Host Animal:
Rabbit
Species Reactivity:
Mouse
Immunogen:
A recombinant peptide from mouse PERK.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunoprecipitation (IP). A dilution of 1:500 is recommended for WB. A dilution of 30 µL of antibody in a total reaction mixture of 500 µL is recommended for IP. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Feliziani C. et al (2022) Ca2+ signalling system initiated by Endoplasmic reticulum stress stimulates PERK activation Cell Calcium. 2022 [Epub ahead of print] Bollo M. et al (2010) Calcineurin interacts with PERK and dephosphorylates calnexin to relieve ER stress in mammals and frogs PLoS One. 2010 Aug 5;5(8)
Specificity:
This antiserum is known to recognise both phosphorylated and non phosphorylated mouse PERK.
Storage:
Aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
PRKR-like endoplasmic reticulum kinase (phosphorylated and non phosphorylated) (PERK)
Rabbit anti-Adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 2 (APPL2) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
APPL2 is an isoform of APPL1 with 54% identity in their protein sequences. APPL2 has a role in cell proliferation and embryonic development. Recently, it was shown that APPL2 regulates FSH signaling and acts as a negative regulator in adiponectin signaling.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. 15% glycerol
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
Mouse APPL2 protein (amino acids: 619-662) conjugated to GST.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunoprecipitation (IP). A dilution between 1:2500 and 1:5000 is recommended for WB. A concentration of 3 µL/reaction is recommended for IP. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
DCC-interacting protein 13-beta; Dip13-beta; Adapter protein containing PH domain; PTB domain and leucine zipper motif 2; APPL2; DIP13B;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum is known to recognise both mouse and human APPL2.
Storage:
Aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
Adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 2 (APPL2)
Rabbit anti-Adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1 (APPL1) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
APPL1 (adaptor protein containing PH domain, PTB domain and leucine zipper motif 1) mediates adiponectin signaling in various types of cells. APPL1 is also thought to have a role in insulin signaling.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
The C-terminus of Human APPL1 protein (amino acids: 455-709) conjugated to GST.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunoprecipitation (IP). A dilution of 1:1,000 is recommended for WB. A concentration of 3 µL/reaction is recommended for IP. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
DCC-interacting protein 13-alpha; Dip13-alpha; Adapter protein containing PH domain; PTB domain and leucine zipper motif 1; APPL1; APPL; DIP13A; KIAA1428;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum is known to recognise both mouse and human APPL1.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
Adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1 (APPL1)
Adiponectin Receptors 1 and 2 are membrane receptors for adiponectin, a hormone secreted by adipocytes which regulates energy homeostatis and insulin sensitivity.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. 15% glycerol
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
Human Adiponectin Receptor 2 protein (amino acids: 78-219) conjugated to GST.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting. A dilution of 1:2000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Progestin and adipoQ receptor family member II; ADIPOR2; PAQR2;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum is known to recognise both mouse and human Adiponectin Receptor 2.
Storage:
Aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Adiponectin Receptors 1 and 2 are membrane receptors for adiponectin, a hormone secreted by adipocytes which regulates energy homeostatis and insulin sensitivity.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. 15% glycerol
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
The intracellular portion of mouse Adiponectin Receptor 1 protein (amino acids: 4-142) conjugated to GST.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting. A dilution of 1:2000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Adipor1; AdipoR1; Progestin and adipoQ receptor family member I; ADIPOR1; PAQR1;TESBP1A; CGI-45;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum is known to recognise both mouse and human Adiponectin Receptor 1.
Storage:
Aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Myc Tag Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
The Myc tag contains the amino acids Glu-Gln-Lys-Leu-Ile-Ser-Glu-Glu-Asp-Leu (E-Q-K-L-I-S-E-E-D-L) corresponding to amino acids 410-419 of human Myc. This tag is widely used for monitoring expression of recombinant proteins in bacteria, insect and mammalian cells.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS, pH 7.4 with 0.05% sodium azide. For maximum recovery of product, centrifuge the original vial after thawing and prior to opening the cap.
Host Animal:
Rabbit
Species Reactivity:
Species Independent
Immunogen:
Myc epitope tag peptide
Applications:
ELISA,WB
Antibody Isotype:
IgG
Application Details:
ELISA and Western Blotting (WB). Suggested dilutions for ELISA at 1:1,000 and WB 1:500 - 1:1,000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Martel, D. et al. (2017) Characterisation of Casein Kinase 1.1 in Leishmania donovani Using the CRISPR Cas9 Toolkit. BioMed Res. Int. 2017 Article ID 4635605. Application: WB
Specificity:
This polyclonal anti-Myc-tag antibody detects overexpressed proteins containing the Myc epitope tag. The antibody recognizes the Myc-tag fused to either the amino- or carboxy- termini of targeted proteins in transfected or transformed cells.
Storage:
Maintain at -20°C prior to opening for up to 1 year. The product is also stable at 2-8°C undiluted for several weeks. After opening store at -20°C in undiluted aliquots for up to six months. For maximum recovery of product, centrifuge the original vial after thawing and prior to opening the cap. Avoid repeated freezing and thawing.
Rabbit anti-Maltose-Binding Protein Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Maltose binding protein (MBP) is encoded by the malE gene of E.coli. MBP is often used in protein expression studies because it creates a stable fusion product that does not appear to interfere with the bioactivity of the protein of interest. It also allows for its easy purification from bacterial extracts under mild conditions.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS, pH 7.4 with 0.05% sodium azide
Host Animal:
Rabbit
Species Reactivity:
Species Independent
Immunogen:
MBP epitope tag recombinant protein.
Applications:
ELISA,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and ELISA. Suggested starting dilutions for WB of 1:1,000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody recognizes the MBP epitope tag fused to the amino- or carboxy- termini of targeted proteins.
Storage:
Stable for 1 year at -20°C from the date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to opening the cap. Aliquot to avoid repeated freezing and thawing.
The 6X His tag is a short peptide sequence of 6 histidine residues. Epitopes such as the 6X His tag are often included with the target DNA at the time of cloning to produce fusion proteins containing the tag sequence. This allows anti-epitope tag antibodies such as this one to serve as a universal detection reagent for any recombinant protein containing this tag. Anti-epitope antibodies are a useful alternative to generating antibodies to identify a specific recombinant protein. The 6X His motif is often used as a tag on recombinant proteins to facilitate purification with immobilized metal-affinity chromatography.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS, pH 7.4 with 0.02% sodium azide.
Host Animal:
Rabbit
Species Reactivity:
Species Independent
Immunogen:
The antiserum was produced by immunizing rabbit with synthesized peptide containing 6 Histidine residues.
Applications:
ELISA,ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
ELISA, WB, IP, IF, IHC. Western Blotting at a suggested concentration of 1:500~1:1000. ELISA at a suggested concentration of 1: 2500. IP 5 µg/sample. IF 5 µg/mL. IHC 5 µg/mL. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
His-tagged fusion proteins
Storage:
Stable for 1 year at -20°C from the date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to opening the cap. Aliquot to avoid repeated freezing and thawing.
Rabbit anti-Influenza hemagglutin (HA) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
The Human influenza hemagglutin (HA) tag corresponds to a region (98-106 amino acids) from the HA molecule.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Host Animal:
Rabbit
Species Reactivity:
Species Independent
Immunogen:
The antiserum was produced by immunizing rabbit with synthesized peptide containing the influenza hemagglutinin epitope (YPYDVPDYA).
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting at a suggested dilution 1:500~1:1000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Antibody detects HA-tagged proteins (on amino- and carboxy termini) in transfected mammalian cells.
Storage:
Stable for 1 year at -20°C from the date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to opening the cap. Aliquot to avoid repeated freezing and thawing.
Purification:
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific peptide.
Rabbit anti-Contactin-6 Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
The neural adhesion molecule Contactin-6, also known as NB-3, is a contactin/F3 subgroup member of immunoglobulin superfamily. It is expressed exclusively in the nervous system and mainly upregulated at the early postnatal stage during mouse brain development. Employing Northern blot analysis Kamei et al found that amongst different regions of the adult human nervous system cerebellum expressed highest level of NB-3 mRNA. The expression of NB-3 in the cerebellum increases until adulthood. In contrast, the expression in the cerebrum declines to a low level after postnatal day 7. NB-3 like other neural recognition molecules plays a vitally important role in axonal guidance during development, plasticity, and maintenance of synaptic connections in the adult brain. Cui et al recently showed that NB-3 acts as a novel Notch ligand to participate in oligodendrocyte generation. Furthermore, NB-3 triggers nuclear translocation of the Notch intracellular domain and promotes oligodendrogliogenesis from progenitor cells and differentiation of oligodendrocyte precursor cells via Deltex1. In primary oligodendrocytes, NB-3 increases myelin-associated glycoprotein transcripts. Hence, the NB-3/Notch signaling pathway may be worthwhile a closer examination for its potential for the treatment of demyelinating diseases. Human NB-3 shares with rat NB-3 86% identity in nucleotide sequences and 90% identity in amino acid sequences. FUNCTION: Contactins mediate cell surface interactions during nervous system development. Participates in oligodendrocytes generation by acting as a ligand of NOTCH1. Its association with NOTCH1 promotes NOTCH1 activation through the released notch intracellular domain (NICD) and subsequent translocation to the nucleus. Involved in motor coordination. SUBCELLULAR LOCATION: Cell membrane; lipid-anchor; GPI-anchor. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Expressed in brain. In brain, it is preferentially expressed in the accessory olfactory bulb, layers II/III and V of the cerebral cortex, piriform cortex, anterior thalamic nuclei, locus coeruleus of the pons and mesencephalic trigeminal nucleus and in Purkinje cells of the cerebellum. DEVELOPMENTAL STAGE: Highly expressed after birth, reaching a maximum at the postnatal day 7, and declines thereafter in the cerebrum, whereas it increases in the cerebellum to adulthood.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Rat
Immunogen:
A synthetic peptide (KLHKMSSLSSVGVQILKPSTQF) as part of rat contactin-6 conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:1000 to 1: 5000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neural recognition molecule NB-3; mNB-3
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum stains beautifully the NB3 in DRG, where it nicely stains a subpopulation of neurons and in the trigeminal nerve root, where staining is restricted to the oligodendrocytes. Confirmed to react with rat Contactin-6
Storage:
After reconstitution keep aliquots at minus 20ºC for increased stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Destroys radicals which are normally produced within the cells and which are toxic to biological systems. CATALYTIC ACTIVITY: 2 superoxide + 2 H+ = O2 + H2O2. COFACTOR: Binds 1 copper ion per subunit. COFACTOR: Binds 1 zinc ion per subunit. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. DISEASE: Defects in SOD1 are the cause of familial amyotrophic lateral sclerosis (FALS); also called amyotrophic lateral sclerosis 1 (ALS1 or ALS). ALS is a degenerative disorder of motorneurons in the cortex, brainstem and spinal cord. ALS is characterized by muscular weakness and atrophy beginning in the hands and spreading to the forearms and legs. Muscle fasciculations are commonly visible. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. ALS is sometimes referred to as Lou Gehrig disease after the famous American baseball player who was diagnosed with the disorder. FALS, the familial form of ALS, accounts for about 10% of the cases and is transmitted in an autosomal dominant manner. The mean age at onset of FALS is 45 years. MISCELLANEOUS: Zinc binding promotes dimerization. SIMILARITY: Belongs to the Cu-Zn superoxide dismutase family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
A synthetic peptide (ASGEPVV LSGQIT) as part of mouse superoxide dismutase (SOD1) protein (aa: 24-36) conjugated to diphtheria toxoid
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:500 to 1:1000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Superoxide dismutase [Cu-Zn]; SOD1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Park KH et al. (2013) Postnatal muscle modification by myogenic factors modulates neuropathology and survival in an ALS mouse model. Nat Commun. 2013;4:2906.
Specificity:
Specificity was confirmed by western blot detecting mouse superoxide dismutase (SOD1). This antiserum is known to react with mouse and rat superoxide dismutase (SOD1) protein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Destroys radicals which are normally produced within the cells and which are toxic to biological systems. CATALYTIC ACTIVITY: 2 superoxide + 2 H+ = O2 + H2O2. COFACTOR: Binds 1 copper ion per subunit. COFACTOR: Binds 1 zinc ion per subunit. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. DISEASE: Defects in SOD1 are the cause of familial amyotrophic lateral sclerosis (FALS); also called amyotrophic lateral sclerosis 1 (ALS1 or ALS). ALS is a degenerative disorder of motorneurons in the cortex, brainstem and spinal cord. ALS is characterized by muscular weakness and atrophy beginning in the hands and spreading to the forearms and legs. Muscle fasciculations are commonly visible. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. ALS is sometimes referred to as Lou Gehrig disease after the famous American baseball player who was diagnosed with the disorder. FALS, the familial form of ALS, accounts for about 10% of the cases and is transmitted in an autosomal dominant manner. The mean age at onset of FALS is 45 years. MISCELLANEOUS: Zinc binding promotes dimerization. SIMILARITY: Belongs to the Cu-Zn superoxide dismutase family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (ESNGPVK VWGSIK) as part of human superoxide dismutase (SOD1) protein (aa: 24-36) conjugated to diphtheria toxoid
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:500 to 1:1000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Superoxide dismutase [Cu-Zn]; SOD1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity was confirmed by western blot detecting human superoxide dismutase (SOD1). This antiserum is known to react with human superoxide dismutase (SOD1).
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Noxa Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
The Bcl-2 family of proteins which regulate apoptosis share identical sequences called Bcl-2 Homology domains (BH1-4). The BH3 proteins, including BID, NOXA, PUMA, BIK, BIM and BAD are all pro-apoptotic and share sequence identity within the amphipathic alpha-helical BH3 region, which is essential for their apoptotic function. NOXA is highly expressed in adult T-cell leukemia cell line.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Mouse
Immunogen:
A synthetic peptide (CAQLRR IGDKVNLRQK) as part of mouse Noxa (aa: 75-90) conjugated to diphtheria toxoid
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:1000 to 1:2000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
PMAIP1; phorbol-12-myristate-13-acetate-induced protein 1; adult T cell leukemia-derived PMA-responsive; Immediate-early-response protein APR; PMA-induced protein 1; Pmaip1; Noxa
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Western blot analysis of cells infected with Noxa adenoviruses and BAF indicates a high level of specificity for this antiserum. This antiserum cross-reacts with mouse. Not yet tested in other species.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Noxa Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
The Bcl-2 family of proteins which regulate apoptosis share identical sequences called Bcl-2 Homology domains (BH1-4). The BH3 proteins, including BID, NOXA, PUMA, BIK, BIM and BAD are all pro-apoptotic and share sequence identity within the amphipathic alpha-helical BH3 region, which is essential for their apoptotic function. NOXA is highly expressed in adult T-cell leukemia cell line.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Mouse
Immunogen:
A synthetic peptide (MPGRKARRNA PVNPTR) as part of mouse Noxa (aa: 1-16) conjugated to diphtheria toxoid
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:1000 to 1:2000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
PMAIP1; phorbol-12-myristate-13-acetate-induced protein 1; adult T cell leukemia-derived PMA-responsive; Immediate-early-response protein APR; PMA-induced protein 1; Pmaip1; Noxa
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Western blot analysis of cells infected with Noxa adenoviruses and BAF indicates a high level of specificity for this antiserum. This antiserum cross-reacts with mouse. Not yet tested in other species.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Tyrosine Kinase Receptor B (TrkB) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
FUNCTION: Receptor for brain-derived neurotrophic factor (BDNF), neurotrophin-3 and neurotrophin-4/5 but not nerve growth factor (NGF). Involved in the development and/or maintenance of the nervous system. This is a tyrosine-protein kinase receptor. Known substrates for the TRK receptors are SHC1, PI-3 kinase, and PLC-gamma-1. CATALYTIC ACTIVITY: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. SUBUNIT: Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures (By similarity). Binds APS. Interacts with SQSTM1. SUBCELLULAR LOCATION: Membrane; single-pass type I membrane protein. ALTERNATIVE PRODUCTS: 3 named isoforms produced by alternative splicing. Additional isoforms seem to exist. TISSUE SPECIFICITY: The different forms are differentially expressed in various cell types. Isoform T2 is primarily expressed in neurons. PTM: Ligand-mediated auto-phosphorylation. SIMILARITY: Belongs to the Tyr protein kinase family. Insulin receptor subfamily. SIMILARITY: Contains 2 Ig-like C2-type (immunoglobulin-like) domains. SIMILARITY: Contains 2 LRR (leucine-rich) repeats. SIMILARITY: Contains 1 protein kinase domain.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (AFPRLEPNSIDPEN(C)) as part of rat TrkB protein (aa: 54-67) conjugated to KLH
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:1000 to 1:3000 is recommended for this application. For WB, a 1:500 to 1:1000 dilution is recommended. The sequence of the immunogen and the conjugate are identical to the one used by Yan et al (see the Refs) and the antiserum appears to have similar characteristics. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Warren PM et al. (2018) "Rapid and robust restoration of breathing long after spinal cord injury." Nat Commun. 2018 Nov. PMID: 30482901 9(1):4843. Application: IHC/IF. Species: Rat, spinal cord sections. Wang T et al. (2016) "Flux of signalling endosomes undergoing axonal retrograde transport is encoded by presynaptic activity and TrkB." Nat Commun. 2016 Sep. PMID: 27687129 30(7):12976. Application: IF & structured illumination microscopy (SIM). Species: Rat, Mouse; fixed 4% PFA with 4% sucrose Matusica D et al. (2016) Inhibition of motor neuron death in vitro and in vivo by a p75 neurotrophin receptor intracellular domain fragment. J Cell Sci. 2016 Feb 1;129(3):517-30. Application: WB. Brock JH et al. (2010) Local and remote growth factor effects after primate spinal cord injury. J Neurosci. 2010 Jul 21;30(29):9728-37. Gruber H. et al. (2008) Brain-derived neurotrophic factor and its receptor in the human and the sand rat intervertebral disc. Arthritis Res Ther. 2008; 10(4): R82.
Specificity:
Sequence was chosen to avoid cross reactivity with TrkA and TrkC. This antiserum recognises human, rat and mouse TrkB. Cross reactivity with other species has not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by g proteins which activate adenylyl cyclase. PTHR2 may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTHR2 presence in neurons indicates that it may function as a neurotransmitter receptor. SUBUNIT: Binds to TIPF39/TIP39. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein. TISSUE SPECIFICITY: Abundantly expressed in brain, arterial and cardiac endothelium. Found as well in sperm, in the head of the epididymis. Lower expression is found in vascular smooth muscle, exocrine pancreas, testis and placenta. SIMILARITY: Belongs to the G-protein coupled receptor 2 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Rat
Immunogen:
A synthetic peptide (RQIDSHVTLPGYVWSSSEQDC) of rat Parathyroid hormone receptor protein (aa: 481-501) conjugated to KLH has been used as the immunogen.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:500 to 1:1000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity has been shown by western blot. A band of 63 kDa corresponding to the theoretical molecular weight of Parathyroid hormone receptor is easily detectable by WB. Absorption of the antiserum with the immunising peptide abolished the binding of the antibody to the target hence detectability of the band. This antibody is known to react with rat Parathyroid hormone receptor.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Tyrosine Hydroxylase (TH) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Tyrosine hydroxylase (TH) is the rate-limiting enzyme in the synthesis of the catecholamines dopamine, epinephrine and norepinephrine. Therefore the regulation of the TH enzyme represents the central means for controlling the synthesis of these important catecholamines. FUNCTION: Plays an important role in the physiology of adrenergic neurons. CATALYTIC ACTIVITY: L-tyrosine + tetrahydrobiopterin + O2 = 3,4-dihydroxy-L-phenylalanine + 4a-hydroxytetrahydrobiopterin. COFACTOR: Fe(2+) ion. ENZYME REGULATION: Phosphorylation leads to an increase in the catalytic activity. PATHWAY: Catecholamine biosynthesis; first step. SUBUNIT: Homotetramer. PTM: In vitro, phosphorylation of Ser-19 increases the rate of Ser-40 phosphorylation, which results in enzyme opening and activation. SIMILARITY: Belongs to the biopterin-dependent aromatic amino acid hydroxylase family. The presence of different DNA sequences at the TH locus confers susceptibility to various disorders of the brain including manic-depression and schizophrenia. Parkinson's disease is also considered a TH deficiency as low dopamine levels are a consistent neurochemical abnormality.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Guinea Pig,Mouse,Rat
Immunogen:
A synthetic peptide (PRFIGRRQSLIEDARK) as part of human Tyrosine Hydroxylase (63-78) conjugated to KLH has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from TH protein in rat (31-47).
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
<b>Immunohistochemistry (IHC):</b> 1:2,000 to 1:5,000, dilutions of up to 1:100,000 have been reported. This is a superb antibody for detection of tyrosine hydroxylase (TH) containing neurons exhibiting an intense labelling with a negligible background. This antiserum has proven extremely useful for staining of catecholaminergic neurons. It stains nicely and intensely dendritic processes and fine nerve terminals. We recommend mouse or rat brain containing catecholaminergic neurons as a positive control for this antibody, for example brain stem or striatum. <br><b>Western blotting (WB)</b>: 1:100 to 1:500. Antibody has been tested on RIPA-extracted PC12 cell lysate and shown to be specific for TH (~60 kDa). Tissue homogenates show a higher level of non-specific binding and presence of uncharacterized bands. Affinity-purified anti-TH antibody (R-148-50) is recommended for tissue homogenates. <br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Pierre S.R., Lemmens M.A., Figueiredo-Pereira M.E. (2009) Subchronic infusion of the product of inflammation prostaglandin J2 models sporadic Parkinson's disease in mice J Neuroinflammation. Jul 25;6:18 Takeoka A. et al (2010) Noradrenergic innervation of the rat spinal cord caudal to a complete spinal cord transection: effects of olfactory ensheathing glia J Exp Neurol. 2010 Mar;222(1):59-69. Brown R.E. et al (2008) Characterization of GABAergic neurons in rapid-eye-movement sleep controlling regions of the brainstem reticular formation in GAD67-green fluorescent protein knock-in mice. Eur J Neurosci. 2008 Jan;27(2):352-63. Bisem NJ et al (2012) Mapping of FGF1 in the Medulla Oblongata of Macaca fascicularis. Acta Histochem Cytochem. 2012 Dec 26;45(6):325-34.
Specificity:
IHC on brain shows a pattern of staining specific for TH containing neurons. This antibody is known to react with rat, mouse and guinea pig. Cross reactivity with other species has not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Synphilin-1 (Sph1) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Synuclein alpha interacting protein (Synphilin-1) contains several protein-protein interaction domains and interacts with alpha synuclein in neurons. Mutations of SNCAIP have been linked to Parkinson disease. The amino acid sequence of synphilin-1 shares a high level of identity with its human counterpart, particularly in regions containing ankyrin-like motifs and the coiled-coil domain. Expression pattern of synphilin-1 in tissues is similar in both mouse and human. Synphilin-1 has an important role in the formation of aggregates and cytotoxicity in Parkinson disease and also Dorfin may be involved in the pathogenic process by ubiquitylation of synphilin-1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (CASKGKNKAA) as part of human synphilin-1a conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1: 1000 to 1:2000 is recommended for immunohistochemistry and 1:500-1:1000 for western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A high level of specificity has been shown for this antiserum by IHC on human brain. This antiserum is known to react with rat and human synphilin-1a.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Synphilin-1 (Sph1) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Synuclein alpha interacting protein (Synphilin-1) contains several protein-protein interaction domains and interacts with alpha synuclein in neurons. Mutations of SNCAIP have been linked to Parkinson disease. The amino acid sequence of synphilin-1 shares a high level of identity with its human counterpart, particularly in regions containing ankyrin-like motifs and the coiled-coil domain. Expression pattern of synphilin-1 in tissues is similar in both mouse and human. Synphilin-1 has an important role in the formation of aggregates and cytotoxicity in Parkinson disease and also Dorfin may be involved in the pathogenic process by ubiquitylation of synphilin-1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (SLELNGEKDKDKGRTLQRT) as part of human synphilin-1a conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1: 1000 to 1:2000 is recommended for this application. This antiserum will stain Lewy bodies in Dorsal raphe nucleus of Parkinson's diseased human brain. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A high level of specificity has been shown for this antiserum by IHC on human brain. This antiserum is known to react with rat and human synphilin-1a.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Ubiquitin-like protein which binds to a wide range of target proteins. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Involved in targeting RANGAP1 to the nuclear pore complex protein RANBP2. SUBUNIT: Covalently attached to a number of proteins such as PmL, RANGAP1, HIPK2, SP100, p53, p73alpha, MDM2, JUN and DNMT3B. Also interacts with HIF1A, HIPK2, HIPK3, CHD3, PIAS1, EXOSC9, TDG, RAD51 and RAD52. SUBCELLULAR LOCATION: Nucleus; nuclear membrane. Nucleus; nucleoplasm; nuclear speckle. Cytoplasm. SIMILARITY: Belongs to the ubiquitin family. SMT3 subfamily. SIMILARITY: Contains 1 ubiquitin-like domain.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (AKPSTEDLGDKKEGEY) as part of human SUMO-1 peptide (aa: 6-21) conjugated to diphtheria toxoid has been used as the immunogen. This antigen is homologous with SUMO-1 of rat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1:1000 to 1:2000 is recommended for immunohistochemistry and 1:2000 to 1:4000 for western blot. Cell lysate from Hela and NIH-3T3 cell lysates may be used as a positive control, and for IHC, lung carcinoma may be used. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Small ubiquitin-related modifier 1; Ubiquitin-like protein SMT3C; SMT3 homolog 3; Ubiquitin-homology domain protein PIC1; Ubiquitin-like protein UBL1; GAP-modifying protein 1; GMP1; Sentrin; SUMO1; SMT3C; SMT3H3; UBL1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum recognises human SUMO-1 and not ubiquitin. This antiserum is known to cross react with rat and human SUMO-1.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Parkinson disease protein 2 (Parkin) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. These substrates include SYT11, CCNE1, GPR37, STUB1, a 22 kDa O-linked glycosylated isoform of SNCAIP and SEPT5. May play a more general role in the ubiquitin proteasomal pathway by participating in the removal and/or detoxification of abnormally folded or damaged protein. Loss of this ubiquitin ligase activity appears to be the mechanism underlying pathogenesis of PARK2. May protect neurons against alpha synuclein toxicity, proteasomal dysfunction, GPR37 accumulation, and kainate-induced excitotoxicity. May play a role in controlling neurotransmitter trafficking at the presynaptic terminal and in calcium-dependent exocytosis. Regulates cyclin E during neuronal apoptosis. May represent a tumor suppressor gene. SUBCELLULAR LOCATION: Cytoplasm. Co-localizes with STY11 in neutrites. Co-localizes with SNCAIP in brainstem Lewy bodies. TISSUE SPECIFICITY: Highly expressed in the brain including the substantia nigra. Expressed in heart, testis and skeletal muscle. Expression is down-regulated or absent in tumor biopsies, and absent in the brain of PARK2 patients. Overexpression protects dopamine neurons from kainate-mediated apoptosis.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (NSLIKELHHFRILGEEQ) as part of human Parkin conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1:1000 is recommended for immunohistochemistry and 1:2000 for western blot. Nice staining is achieved in neuronal and cytoplasmic granules sections treated with citrate buffer for antigen retrieval. Few inclusions are stained but these were not positively identified as Lewy bodies. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Ubiquitin E3 ligase PRKN; Parkinson juvenile disease protein 2; Parkinson disease protein 2; PARK2; PRKN
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Song Y. J. C. et al (2009). Degeneration in different parkinsonian syndromes relates to astrocyte type and astrocyte protein expression. J. Neuropathol. Exp. Neurol. Oct 2009;68(10):1073-1083 Huang Y. et al (2008). LRRK2 and parkin immunoreactivity in multiple system atrophy inclusions. Acta Neuropathol. 2008 Dec;116(6):639-46.
Specificity:
This antiserum is known to be highly specific for Parkin shown by IHC and WB. This antibody is known to react with rat and human Parkin.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Parkinson disease protein 2 (Parkin) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, ELISA.
Background Info:
FUNCTION: Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. These substrates include SYT11, CCNE1, GPR37, STUB1, a 22 kDa O-linked glycosylated isoform of SNCAIP and SEPT5. May play a more general role in the ubiquitin proteasomal pathway by participating in the removal and/or detoxification of abnormally folded or damaged protein. Loss of this ubiquitin ligase activity appears to be the mechanism underlying pathogenesis of PARK2. May protect neurons against alpha synuclein toxicity, proteasomal dysfunction, GPR37 accumulation, and kainate-induced excitotoxicity. May play a role in controlling neurotransmitter trafficking at the presynaptic terminal and in calcium-dependent exocytosis. Regulates cyclin E during neuronal apoptosis. May represent a tumor suppressor gene. SUBCELLULAR LOCATION: Cytoplasm. Co-localizes with STY11 in neutrites. Co-localizes with SNCAIP in brainstem Lewy bodies. TISSUE SPECIFICITY: Highly expressed in the brain including the substantia nigra. Expressed in heart, testis and skeletal muscle. Expression is down-regulated or absent in tumor biopsies, and absent in the brain of PARK2 patients. Overexpression protects dopamine neurons from kainate-mediated apoptosis.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Guinea Pig,Human,Rat
Immunogen:
A synthetic peptide (RILGEEQYNRYQQYGAEEC) as part of human Parkin conjugated to diphtheria toxoid has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, immunoblot, 1-site ELISA. A dilution of 1:500 to 1:2000 is recommended for these applications. This antiserum stains trigeminal motor neurons in rat brain stem. A 50 kDa band was identified in rat brain extract using western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Ubiquitin E3 ligase PRKN; Parkinson juvenile disease protein 2; Parkinson disease protein 2; PARK2; PRKN
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Francelin C et al (2021) BACE1 Inhibition Increases Susceptibility to Oxidative Stress by Promoting Mitochondrial Damage. Antioxidants (Basel). 10(10):1539. E. Rubio de la Torre et al (2009) Combined kinase inhibition modulates parkin inactivation. Hum Mol Genet. 2009 Mar 1;18(5):809-23. D'Agata V. et al (2009) Parkin expression profile in dopamine d3 receptor knock-out mice brains. Neurochem Res. 2009 Feb;34(2):327-32. Tamo W. et al (2007) Parkin is expressed in vascular endothelial cells. Neurosci Lett. 2007 Jun 4;419(3):199-201. Trimmer P.A. et al (2004) Parkinson's disease transgenic mitochondrial cybrids generate Lewy inclusion bodies. J Neurochem. 2004 Feb;88(4):800-12. Denison S.R. et al (2004) Alterations in the common fragile site gene Parkin in ovarian and other cancers. Oncogene. 2003 Nov 13;22(51):8370-8. Pawlyk A.C. et al (2003) Novel monoclonal antibodies demonstrate biochemical variation of brain parkin with age. J Biol Chem. 2003 Nov 28;278(48):48120-8. Horowitz J.M. et al (2001) Spatial distribution, cellular integration and stage development of Parkin protein in Xenopus brain. Brain Res Dev Brain Res. 2001 Jan 31;126(1):31-41.
Specificity:
This antiserum is known to specifically recognise Parkin shown by IHC and WB. This antibody is known to react with Parkin of guinea pig and rat.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Autophagy-related protein 12 (ATG12) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Required for autophagy. SUBUNIT: Conjugated to ATG5. SUBCELLULAR LOCATION: Cytoplasm. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Ubiquitous. SIMILARITY: Belongs to the ATG12 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide corresponding to the N-terminal of human ATG12 protein has been used as the immunogen. No immunogenic carrier protein was conjugated to the immunogen. Instead, Adjukine B (see the Adjuvants in biosensis' product list) has been used to orchestrate/boost the immune response.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence, WB. A dilution of 1:200 to 1:1000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Autophagy-related protein 12; APG12-like; APG 12; ATG12; APG12; APG12L
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
IHC and WB confirmed the specificity for ATG12. Human, rat
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Autophagy protein 5 (ATG5) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Required for autophagy. Conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and autophagosome. The conjugate detaches from the membrane immediately before or after autophagosome formation is completed. FUNCTION: May play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity. SUBCELLULAR LOCATION: Cytoplasm. Colocalizes with nonmuscle actin. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Ubiquitous. The mRNA is present at similar levels in viable and apoptotic cells, whereas the protein is dramatically highly expressed in apoptotic cells. INDUCTION: By apoptotic stimuli. PTM: Conjugated to ATG12; which is essential for autophagy, but is not required for association with isolation membrane. SIMILARITY: Belongs to the ATG5 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide corresponding to the C-terminal of human ATG-5L. No immunogenic carrier protein was conjugated to the immunogen. Instead, Adjukine B has been used to orchestrate/boost the immune response.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence, WB. A dilution of 1:200 to 1:1000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Autophagy protein 5; APG5-like; APG 5; Apoptosis-specific protein; APG5; ATG5; APG5L; ASP
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
E.N. Wilson et al (2011) A Switch Between Cytoprotective and Cytotoxic Autophagy in the Radiosensitization of Breast Tumor Cells by Chloroquine and Vitamin D. Horm Cancer. 2011 Sep 2. Bristol ML et al (2012) Dual functions of autophagy in the response of breast tumor cells to radiation: cytoprotective autophagy with radiation alone and cytotoxic autophagy in radiosensitization by vitamin D 3. Autophagy. 2012 May 1;8(5):739-53. Guido C et al (2012) Metabolic reprogramming of cancer-associated fibroblasts by TGF-? drives tumor growth: connecting TGF-_ signaling with "Warburg-like" cancer metabolism and L-lactate production. Cell Cycle. 2012 Aug 15;11(16):3019-35.
Specificity:
IHC and WB confirmed the specificity for ATG5. Human, not yet tested in other species.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
DBH is an oxireductase belonging to the copper type II ascorbate-dependent monooxygenase family. DBH exists as a homotetramer composed of two non-covalently bound disulfide-linked dimers. It is present in the synaptic vesicles of postganglionic sympathetic neurons and converts dopamine to norepinephrine. It binds 2 copper ions and 1 PQQ per subunit . Depending on the presence of a signal peptide, DBH can exist in both soluble and membrane-bound forms.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Bovine,Guinea Pig,Human,Rat
Immunogen:
Native enzyme prepared from Bovine adrenal glands. Purity was greater than 95% by PAGE.
Applications:
IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC (frozen), Western Blot, radioimmunoassay and inhibition of enzymatic activity. Recommended to be used at a dilution of 1:500 to 1: 2000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Bowolaksono A. (2012) Molecular Regulation of Noradrenaline in Bovine Corpus Luteum. HAYATI Journal of Biosciences June 2012 Vol. 19 No. 2, p 81-87 Blanco-Centurion C. et al (2004) Effects of hypocretin2-saporin and antidopamine-beta-hydroxylase-saporin neurotoxic lesions of the dorsolateral pons on sleep and muscle tone. Eur J Neurosci. 2004 May;19(10):2741-52. Ohshita N. et al (2004) Characteristics of the trigeminal depressor response in cats. J Neurosci Res. 2004 Jun 15;76(6):891-901.
Specificity:
This antiserum has been extensively characterised in several laboratories. It reacts with a single band on western blot of bovine adrenal homogenates and stains only cells known to contain DBH, such as sympathetic neurons, adrenal medullary cells and central adrenergic neurons. Staining is abolished by preincubation with the enzyme. This antibody is known to react with bovine, human, guinea pig and rat DBH.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Rabbit anti-Myelin basic protein (MBP) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Myelin is a membrane characteristic of the nervous tissue and functions as an insulator to increase the velocity of the stimuli being transmitted between a nerve cell body and its target. Myelin isolated from human and bovine nervous tissue is composed of approximately 80% lipid and 20% protein, and 30% of the protein fraction constitutes myelin basic protein (MBP). MBP is an 'intrinsically unstructured' protein with a high proportion (approximately 75%) of random coil, but postulated to have core elements of beta-sheet and alpha-helix. MBP is a major protein in CNS myelin and is expressed specifically in the nervous system. A detailed immunochemical examination of monoclonal and polyclonal antibody responses to MBP and its peptides has revealed the existence of as many as 27 antigenic determinants, many of them conformational. Topological mapping of the potential antigenic determinants onto a model of MBP secondary structure places these determinants within 11 separate regions of the molecule, including those portions that have been found to be encephalitogenic. The message for myelin basic protein is selectively translocated to the ends of the cell processes. Immunization with myelin-associated antigens including MBP significantly promotes recovery after spinal cord contusion injury in the rat model. FUNCTION: Is, with PLP, the most abundant protein component of the myelin membrane in the CNS. Has a role in both the formation and stabilization of this compact multilayer arrangement of bilayers. Each splice variant and charge isomer may have a specialized function in the assembly of an optimized, biochemically functional myelin membrane (By similarity). SUBUNIT: Homodimer (By similarity). SUBCELLULAR LOCATION: Myelin membrane; peripheral membrane protein; cytoplasmic side. Cytoplasmic side of myelin. TISSUE SPECIFICITY: Found in both the central and the peripheral nervous system.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Guinea Pig,Human,Rat
Immunogen:
A synthetic peptide (YG SLPQKSQRSQ DENPVV, aa: 68-86) as part of guinea pig MBP protein conjugated to KLH
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:1000 to 1:4000 is recommended. Immunostaining for MBP of abnormal appearing oligodendrocytic process and cell bodies in demyelinating areas. This antibody recognises only areas of myelin degeneration when tested in injured spinal cord and lesioned sciatic nerves. It also stains discrete white matter in the brain of multiple system atrophy. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Myelin Basic Protein
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum recognizes MBP in demyelinated nerve tissues. Immunohistochemical analysis of lesioned rat spinal cord indictaes a high level of specificity for this antiserum. This antiserum reacts with human and rat MBP.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Contactin-6 Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
The neural adhesion molecule Contactin-6, also known as NB-3, is a contactin/F3 subgroup member of immunoglobulin superfamily. It is expressed exclusively in the nervous system and mainly upregulated at the early postnatal stage during mouse brain development. Employing Northern blot analysis Kamei et al found that amongst different regions of the adult human nervous system cerebellum expressed highest level of NB-3 mRNA. The expression of NB-3 in the cerebellum increases until adulthood. In contrast, the expression in the cerebrum declines to a low level after postnatal day 7. NB-3 like other neural recognition molecules plays a vitally important role in axonal guidance during development, plasticity, and maintenance of synaptic connections in the adult brain. Cui et al recently showed that NB-3 acts as a novel Notch ligand to participate in oligodendrocyte generation. Furthermore, NB-3 triggers nuclear translocation of the Notch intracellular domain and promotes oligodendrogliogenesis from progenitor cells and differentiation of oligodendrocyte precursor cells via Deltex1. In primary oligodendrocytes, NB-3 increases myelin-associated glycoprotein transcripts. Hence, the NB-3/Notch signaling pathway may be worthwhile a closer examination for its potential for the treatment of demyelinating diseases. Human NB-3 shares with rat NB-3 86% identity in nucleotide sequences and 90% identity in amino acid sequences. FUNCTION: Contactins mediate cell surface interactions during nervous system development. Participates in oligodendrocytes generation by acting as a ligand of NOTCH1. Its association with NOTCH1 promotes NOTCH1 activation through the released notch intracellular domain (NICD) and subsequent translocation to the nucleus. Involved in motor coordination. SUBCELLULAR LOCATION: Cell membrane; lipid-anchor; GPI-anchor. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Expressed in brain. In brain, it is preferentially expressed in the accessory olfactory bulb, layers II/III and V of the cerebral cortex, piriform cortex, anterior thalamic nuclei, locus coeruleus of the pons and mesencephalic trigeminal nucleus and in Purkinje cells of the cerebellum.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (GYPSPHYRWKQ) as part of mouse contactin-6 conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:1000 to 1: 4000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neural recognition molecule NB-3; mNB-3
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum stains beautifully the NB3 in DRG, where it nicely stains a subpopulation of neurons and in the trigeminal nerve root, where staining is restricted to the oligodendrocytes. Confirmed to react with rat Contactin-6 and expected to recognise human and mouse Contactin-6 as well.
Storage:
After reconstitution keep aliquots at -20°C for increased stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Rabbit anti-Nociceptin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, ELISA.
Background Info:
FUNCTION: Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Expressed predominantly in the spinal cord and brain, being more abundant in the hypothalamus and striatum. Also found in small amounts in ovary. PTM: Specific enzymatic cleavages at paired basic residues probably yield other active peptides besides nociceptin. PTM: The N-terminal domain contains 6 conserved cysteines thought to be involved in disulfide bonding and/or processing. SIMILARITY: Belongs to the opioid neuropeptide precursor family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Guinea Pig,Rat
Immunogen:
A synthetic peptide (C-TG ARKSARKLAN Q) as part of rat Nociceptin peptide (aa: 139-151) conjugated to diphtheria toxoid
Applications:
ELISA,IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC, 1-site ELISA. A dilution of 1: 1000 to 1: 3000 is recommended for both applications. This antibody may also be used for staining of nerve fibres in guinea pig myenteric plexus. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
There are no synonyms for this peptide; however the precursor protein contains: Neuropeptide 1; Nociceptin (Orphanin FQ; PPNOC; ORL1 receptor agonist); Neuropeptide 2
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity has been tested by the use of different peptides including enkephalin, dynorphin and endorphin for absorption in immunihistochemistry. This antibody is known to cross react with guinea pig and rat.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Orexin-A Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
FUNCTION: Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested. Orexin-A binds to both OX1R and OX2R with a high affinity, whereas orexin-B binds only to OX2R with a similar high affinity. SUBCELLULAR LOCATION: Endoplasmic reticulum; rough endoplasmic reticulum. Associated with perikaryal rough endoplasmic reticulum as well as cytoplasmic large granular vesicles at synapses. SIMILARITY: Belongs to the orexin family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Bovine,Rat
Immunogen:
A synthetic peptide (CRLYELLHGAGNHAAGILTL) as part of Bovine Orexin A (aa: 14-33) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. This is a superb antiserum for immunohistochemistry on Orexin A containing neurons exhibiting intense labelling of neurons with very low back ground. A dilution of 1:1000 to 1:2000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Orexin-A; Hypocretin-1; Hcrt1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Kruger J.L. et al (2010) Cellular location and major terminal networks of the orexinergic system in the brains of five microchiropteran species. J Chem Neuroanat. 2010 Nov;40(3):256-62. Gaykema R.P. et al (2009) Lipopolysaccharide challenge-induced suppression of Fos in hypothalamic orexin neurons: their potential role in sickness behavior. Brain Behav Immun. 2009 Oct;23(7):926-30. Lee H.S. et al (2005) Retrograde study of hypocretin-1 (orexin-A) projections to subdivisions of the dorsal raphe nucleus in the rat. Brain Res. 2005 Oct 12;1059(1):35-45. Yao S.T. et al (2005) Water deprivation increases the expression of neuronal nitric oxide synthase (nNOS) but not orexin-A in the lateral hypothalamic area of the rat. J Comp Neurol. 2005 Sep 19;490(2):180-93.
Specificity:
The specificity for this antiserum has been confirmed by immunohistochemistry on rat brain and the results reflect the current literature. This antibody is known to react with rat Orexin A.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Neurokinin-3 Receptor (NK-3R) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
FUNCTION: This is a receptor for the tachykinin neuropeptide neuromedin K (neurokinin B). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein. PTM: The anchoring of this receptor to the plasma membrane is probably mediated by the palmitoylation of a cysteine residue. MISCELLANEOUS: The rank order of affinity of this receptor to tachykinins is: neuromedin K > substance K > substance P. SIMILARITY: Belongs to the G-protein coupled receptor 1 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Rat
Immunogen:
A synthetic peptide (ASTTSSF ISSPYTSVDE YS) corresponding to the absolute C-terminal of rat NK-3 receptor protein (aa: 434-452) conjugated to KLH
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:500 to 1:2000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neuromedin K receptor; NKR; Neurokinin B receptor; NK-3 receptor; NK-3R; Tachykinin receptor 3; Tacr3; Tac3r
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity has been shown by western blot using rat brain homogenate. A band of 66 kDa, the theoretical MW of NK-3R, could be easily detected. This antiserum is know to cross react with rat NK-3 R.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Primate,Rat
Immunogen:
Recombinant human NT4
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA (1 site), Western Blot, ICC, inhibition of biological activity in vitro/in vivo. Recommended to be used at a concentration of 1-10 µg/mL for immunohistochemistry, ELISA, ICC and Western blot and inhibition of biological activity in vitro. Use neat for in vivo studies at 2-10 µg/mL (ED50). Note that the concentration of NT4 is generally low in most tissues nevertheless, neonatal testes of rat can be used as a good positive control. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Less than 1% cross-reactivity against NGF, recombinant human BDNF and 5% to NT3 has been shown by dot blot. Known to react with NT4 from rat and human, mouse and monkey.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Primate,Rat
Immunogen:
Recombinant human NT4
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA (1 site), Western Blot, inhibition of biological activity in vitro/in vivo. Recommended to be used at a dilution of 1:500 to 1:2000 for immunohistochemistry, ELISA and Western blot. 1:10 to 1:50 for inhibition of biological activity in vitro. Use neat for in vivo studies at 5-10 µL/g body weight. Note that the concentration of NT4 is generally low in most tissues nevertheless, neonatal testes of rat can be used as a good positive control. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Less than 1% cross-reactivity against NGF, recombinant human BDNF and 5% to NT3 has been shown by 1-site ELISA. Known to react with NT4 from rat and human, mouse and monkey.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
CNTF is a survival promoting factor for different types of neurons in vitro and in vivo. The essential structural features for the biological function of human CNTF were investigated by Thier, M. et al. They showed that deletion of 14 N-terminal and 18 C-terminal amino acids significantly increased bioactivity compared to wild-type CNTF. FUNCTION: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. TISSUE SPECIFICITY: Nervous system. PHARMACEUTICAL: CNTF is being tested under the name Axokine by Regeneron Pharmaceuticals for treatment of human motor neuron diseases, such as amyotrophic lateral sclerosis (ALS). As it induces substantial weight loss, preferentially of fat as opposed to lean body mass, it is being used for obesity treatment. SIMILARITY: Belongs to the CNTF family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human CNTF
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:500 to 1: 4000 is recommended for western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Ciliary neurotrophic factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody specifically detects CNTF shown by western blot. This antiserum to known to react with rat, mouse and human CNTF protein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Seems to promotes the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS with no preservatives.
Host Animal:
Rabbit
Species Reactivity:
Chicken,Human,Rat
Immunogen:
Recombinant human NT3
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% to mouse NGF, recombinant human BDNF and 5% to NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Seems to promotes the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Chicken,Human,Rat
Immunogen:
Recombinant human NT3
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A dilution of 1:500 to 1:1000 is recommended for IHC, ELISA and western blot. For inhibition of biological activity: 1:10-50 for in vitro, 2-10 µL/g body weight for in vivo. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% to mouse NGF, recombinant human BDNF and 5% to NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Seems to promote the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human (aa: 139-149), mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A dilution of 1:500 to 1:2000 is recommended for IHC, western blot. For inhibition of biological activity: 1:10-50 for in vitro, 5-10 µL/g body weight for in vivo. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Seems to promotes the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human (aa: 139-149), mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Feron F et al (2008) Neurotrophin expression in the adult olfactory epithelium. Brain Res. 1196:13-21 Application: IHC ; Species: Rat
Specificity:
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Purification:
Protein G purified IgG
Target:
Neurotrophin-3 (NT-3)
Uniprot Number:
P20783
Cookies:
X
We use cookies to help personalise and improve your web experience.
By using our website you consent to our use of cookies, some of which may have already been set on your device.
View our Cookie Policy to learn more.
