100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 2 mM Sodium Azide
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
25 mM Tris, 150 mM NaCl, 5 mM MgCl2, 0.12 mM ZnCl2, 2 mM Sodium Azide (pH7.4)
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Uroplakins (UPs) are a family of transmembrane proteins (UPs Ia, Ib, II and III) that are specific differentiation products of urothelial cells. Uroplakins are markers of terminally differentiated urothelium. Uroplakin II (UPII) is a newly described sensitive marker for urothelial carcinoma (UC). The expression profile of UPII in different types of UC and its utility in the diagnostic setting are needed.
Transcription factor E3 (TFE3) is a protein expressed in many cell types that are encoded by the TFE3 gene. This gene may be involved in chromosomal translocations that occur in some cancers.Xp11 translocation renal cell carcinomas (RCC) are a recently recognized subset of RCC, characterized by chromosome translocations involving the Xp11.2 break point and resulting in gene fusions involving the TFE3 transcription factor gene that maps to this locus.1 Alveolar soft part sarcoma (ASPS) is an uncommon soft tissue sarcoma of uncertain differentiation. The hallmark of ASPS is a chromosomal rearrangement at 17q25 and Xp11.2 engendering an ASPSCR1-TFE3 fusion gene responsible for an aberrant transcription factor presumably enabling pathogenesis.1-5
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
MRQ-37
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Argani P. Am J Clin Pathol. 2006; 126:332-4
References 2:
Argani P, et al. Am J SurgPathol. 2003; 27:750-61
References 3:
Argani P, et al. Clin Lab Med.2005; 25:363-78
References 4:
Lazar AJ, et al. Histopathol. 2009; 55:750-5
References 5:
Lin G, et al. Arch Pathol Lab Med. 2015; 139:106-21
T-cell leukemia/lymphoma protein 1A (TCL1) is a member of theTCL1 family and enhances the phosphorylation and activation ofAKT1, AKT2 and AKT3. TCL1promotes the nuclear translocation ofAKT1 and enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival. The expression of TCL1 is restricted to lymphoid cells. It is expressed early in lymphocyte differentiation. Strong expression ofTCL1 is found in a subset of mantle zone B lymphocytes and is expressed to a lesser extent by follicle center cells. In B cell neoplasia, TCL1 immunoreactivity is found in the majority of B cell lymphomas including lymphoblastic lymphoma, chronic lymphocytic leukemia, mantle cell lymphoma, follicular lymphoma, Burkitt lymphoma, diffuse large B-cell lymphoma (60%), and primary cutaneous B cell lymphoma (55%). The expression of theTCL1genecharacterizes low-grade B cell lymphomas.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EP105
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Laine J, et al. Mol Cell2000, 6:395-407
References 2:
Pekarsky Y, et al. Proc Natl Acad Sci U S A, 2000, 97:3028-3033
References 3:
Narducci MG, et al. Cancer Res, 2000, 60:2095-2100
T-bet, a T-box transcription factor, is expressed in CD4+ T-lymphocytes committed to T-helper (Th)1 Tcell development from naïve T-helper precursor cells (Thp) and redirects Th2 T-cells to Th1 development. Anti-T-bet is a marker of mature T-cells and is expressed at very low levels in Thp cells and is absent in precursor T-lymphoblastic leukemia/lymphoma cells. Scattered small lymphocytes in the interfollicular T-cell zone of reactive lymphoid tissue, including tonsil, lymph node, and spleen exhibited nuclear staining for anti-T-bet, with no anti-T-bet staining observed in germinal centers or mantle or marginal zones. T-bet is expressed in a significant subset of B-cell lymphoproliferative disorders, particularly at an early stage of B-cell development (precursor B-cell lymphoblastic leukemia/lymphoblastic lymphoma), and B-cell neoplasms derived from mature B-cells, including CLL/SLL, marginal zone lymphoma, and hairy cell leukemia.
Antibody Isotype:
IgG1
Monosan Range:
MONOSAN Ready To Use
Clone:
MRQ-46
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Szabo SJ, et al. Cell. 2000; 100:665-69
References 2:
Jöhrens K, et al. Am J Surg Pathol. 2007; 31:1181-5
References 3:
Atayar C, et al. Am J Pathol. 2005; 166:127-34
References 4:
Dorfman DM, et al. Am J Clin Pathol. 2004; 122:292-7
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
2-8 °C, DO NOT FREEZE
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 2 mM Sodium Azide
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
25 mM Tris, 150 mM NaCl, 5 mM MgCl2, 0.12 mM ZnCl2, 2 mM Sodium Azide (pH7.4)
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
The antibody reacts with neuroendocrine cells of human adrenal medulla, carotid body, skin, pituitary, thyroid, lung, pancreas, and gastrointestinal mucosa. This antibody identifies normal neuroendocrine cells and neuroendocrine neoplasms. Diffuse, finely granular, cytoplasmic staining is observed, which probably correlates with the distribution of the antigen within neurosecretory vesicles. The expression of synaptophysin is independent of the presence of NSE or other neuroendocrine markers. Antisynaptophysin is an independent, broad-range marker of neural and neuroendocrine differentiation.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
MRQ-40
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Wiedenmann, B, et al. Cell 1985;41:1017-1028
References 2:
Navone, F et al. J Cell Biol 1986;103:2511-2527
References 3:
Lyda MH et al. Hum Pathol. 2000 Aug;31(8):980-7
References 4:
Skacel M et al. Appl Immunohistochem Mol Morphol. 2000 Sep;8(3):302-9
STAT6, a member of the signal transducers and activators of transcription (STAT) family, has been found to form recurrent fusions with NAB2 on chromosome 12q13 in the majority of solitary fibrous tumors.1- 3 Inactivated STAT6 can be found in the form of a dimer located in the cytoplasm. STAT6 and NAB2 fusion enables cytosolic STAT6 to migrate to the nucleus and thus allowing for detection in immunohistochemical assays. NAB2-STAT6 fusion transcriptions have been reported in the majority of solitary fibrous tumors but not in meningiomas, hemangioblastomas, schwannomas, and hemangiomas. This makes STAT6 a useful marker in distinguishing solitary fibrous tumors from other morphologically similar tumors.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EP325
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Cheah AL, et al. Pathology. 2014; 46:389-95
References 2:
Schweizer L, et al. Acta Neuropathol. 2013; 125:651-58
References 3:
Koelsche C, et al. Histopathology. 2014; 65:613-22
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 2 mM Sodium Azide
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
25 mM Tris, 150 mM NaCl, 5 mM MgCl2, 0.12 mM ZnCl2, 2 mM Sodium Azide (pH7.4)
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Sry-related HMG-BOX gene 10, SOX-10, is a transcription factor involved in neural crest and peripheral nervous system development, and acts as a nucleocytoplasmic shuttle protein. SOX-10 is expressed in melanocytic lineages, and is a sensitive marker of melanoma for conventional, and desmoplastic subtypes. In normal tissues, SOX-10 is expressed in melanocytes, and myoepithelial cells.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EP268
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Rehberg S, et al. Mol Cell Biol. 2002; 22:5826-34
References 2:
Nonaka D, et al. Am J Surg Pathol.2008; 32:1291-8
References 3:
Nielsen TO, et al. Appl Immunohistochem Mol Morphol. 2012; 20:445-50
References 5:
Miettinen M, et al. Am J Surg Pathol. 2015; 39:826-35
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Sheep IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.25 M Sodium Chloride, pH 7.6
Reconstitution:
Rehydrate with 1.5 ml of deionized water and centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on Sheep IgG · light chains on all Sheep immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin Sheep serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on sheep IgG · light chains on all sheep immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin sheep serum proteins
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
S-100A and S-100B proteins are two members of the S-100 family of proteins. S-100A subtypes are composed of one alpha and one beta chain, whereas S-100B is composed of two beta chains. S-100 protein is reported to be expressed in neuroectodermal tissue, including nerves and melanocytes. Langerhans cells in skin are also reported to express S-100 protein. It is noteworthy that S-100 protein is highly soluble and may be eluted from frozen tissue during immunohistochemical procedures. Clone EP32 was raised against S-100 beta protein. Immunoreactivity was observed in neuroectodermal tissue e.g. melanocytes, nerve fibres, dendritic cells, adipocytes and a percentage of macrophages, lymphocytes and plasma cells.
Antibody Isotype:
IgG
Monosan Range:
MONXtra
Clone:
EP32
Concentration:
Greater than or equal to 30 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Chen H et al. American Journal of Cancer Research 2014;4(2):89-115
References 2:
Torlakovic EE et al.Applied Immunohistochemistry & Molecular Morphology. 2015; 23(1):1-18
Rabbit anti-rat IgG (H&L) is a secondary antibody conjugated to TRITC, which binds to rat IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase rat IgG (H&L). Tetramethylrhodamine-5-isothiocyanate (TRITC) has Amax = 550 nm; Emax = 570 nm
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. The shelf life is 1 year from date of receipt. Prepare working dilution prior to use and then discard.
The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on rat IgG, light chains on all rat immunoglobulins Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin rat serum proteins.
Rabbit anti-rat IgG (H&L) is a secondary antibody conjugated to HRP, which binds to rat IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase rat IgG (H&L).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 500-1 : 5 000 (IHC), 1 : 200-1 : 5000 (WB)
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml. Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.1 % (v/v) Kathon CG as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on rat IgG, light chains on all rat immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin rat serum proteins, human serum proteins.
Rabbit anti-rat IgG (H&L) is a secondary antibody conjugated to HRP, which binds to rat IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase rat IgG (H&L).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C.For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1.1 ml of sterile water add 1.1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Selected references:
Quian et al. (2015). Bone Marrow-Derived Mesenchymal Stem Cells Repair Necrotic Pancreatic Tissue and Promote Angiogenesis by Secreting Cellular Growth Factors Involved in the SDF-1α/CXCR4 Axis in Rats. Stem Cells International Volume 2015 (2015), Article ID 306836.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml. Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.1 % (v/v) Kathon CG as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on rat IgG, light chains on all rat immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin rat serum proteins.
Rabbit anti-rat IgG (H&L) is a secondary antibody conjugated to FITC, which binds to anti-rat IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase rat IgG (H&L). Fluorescein-5-isothiocyanate (FITC) has Amax = 494 nm; Emax = 518 nm
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. The shelf life is 1 year from date of receipt. Prepare working dilution prior to use and then discard.
The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Selected references:
Kolbert et al. (2018). Nitro-oxidative stress correlates with Se tolerance of Astragalus species. Plant Cell Physiol. 2018 May 25. doi: 10.1093/pcp/pcy099.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on rat IgG, light chains on all rat immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin rat serum proteins
Rabbit anti-Rat IgG (H&L) - DyLight 633 Conjugated is a secondary antibody conjugated to DyLight 633, which binds to rat IgG (H&L) in immunological assays. DyLight 633 has Amax = 638 nm, Emax = 658 nm. Antibodies are are affinity purified using solid phase rat IgG (H&L).DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.05 % (w/v) sodium azide is added as preservative.Based on immunoelectrophoresis, this antibody reacts with: (γ) chains on rat IgG light chains on all rat immunoglobulins.No reactivity is observed to:non-immunoglobulin rat serum proteins.
Rabbit anti-rat IgG (H&L) is a secondary antibody conjugated to biotin, which binds to rat IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase rat IgG (H&L).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. The shelf life is 1 year from date of receipt. Prepare working dilution prior to use and then discard.
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 2000-1 : 20 000 (WB) 1 : 500-1 : 5 000 (IHC)
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on rat IgG, light chains on all rat immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin rat serum proteins, human serum proteins
Rabbit anti-rat IgG (H&L) is a secondary antibody conjugated biotin, which binds to rat IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase rat IgG (H&L).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. The shelf life is 1 year from date of receipt. Prepare working dilution prior to use and then discard.
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 2000-1 : 20 000 (WB) 1 : 500-1 : 5 000 (IHC)
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on rat IgG, light chains on all rat immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin rat serum proteins.
Rabbit anti-rat IgG (H&L) is a secondary antibody conjugated to ALP, which binds to rat IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase rat IgG (H&L).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Non-diluted antibody is stable for 4 years at 2-8°C. For storage at -20 °C dilute antibody solution with an equal volume of glycerol to obtain final glycerol concentration of 50 % to prevent loss of enzymatic activity. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 500-1 : 2000 (IHC), 1 : 50 000-1 : 5 000 (WB)
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.50 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 30 mM triethanolamine, pH 7.2.5 mM magnesium chloride, 0.1 mM zinc chloride, 1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on rat IgG, light chains on all rat immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin rat serum proteins.
Rabbit anti-rat IgG (H&L) is a secondary antibody which binds to rat IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase rat IgG (H&L).
This antibody is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is > 4.5 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on rat IgG, light chains on all rat immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin rat serum proteins, human serum proteins
Rabbit anti-rat IgG (H&L) is a secondary antibody which binds to rat IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase rat IgG (H&L).
This antibody is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is > 4.5 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on rat IgG, light chains on all rat immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin rat serum proteins.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Rabbit anti Rat Collagen I antibody recognizes both native and heat denatured rat collagen type I. Collagen is located in the extracellular matrix of connective tissues. It is part of the interacting network of proteoglycans and proteins that provides a structural framework for both soft and calcified connective tissues. Type I collagen (~95 kDa) is found in bone, cornea, skin and tendon.Mutations in the encoding gene are associated with osteogenesis imperfecta (Sykes et al. 1990), Ehlers Danlos syndrome (Burrows et al. 1996), and idiopathic osteoporosis (Pernow et al. 2006). Storage: Prior to reconstitution store at +4oC.After reconstitution store at -20oC.Storage in frost-free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody.
Human prostein is a 553 aa protein identified by cDNA library substraction abd subsequent highthroughput microarray ascreening of prostate cancer. Prostein has multiple transmemberane domains. Prostein has been shown to be uniquely expressed in normal and cancerous prostatic tissues. By immunohistochemistry, prostein is expressed in the vast majority of normal and malignant prostatic tissues, regardless of grade and metastatic status. No protein expression is detected in normal and malignant tissue samples representing the great majority of essential tissues and tumors. Prostein is expressed in most of poorly differentiated prostatic carcinoma, including small cell prostate carcinoma. Prostein is more specific and sensitive for prostatic carcinomas than PSA and PSAP. Pretreatment: Heat induced epitope retrieval in 10 mM citrate buffer, pH6.0, for 20 minutes is required for IHC staining on formalin-fixed, paraffin embedded tissue sections. Note: Dilution of the antibody in 10% normal goat serum followed by a goat anti-rabbit secondary antibody-based detection is recommended. Control tissue Normal prostate or postate carcinoma. Staining cytoplasmic
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
ZR9
Concentration:
n/a
Format:
Concentrate
Storage buffer:
Tissue culture supernatant with 0.2% BSA and 15mM sodium azide
The progesterone receptor (PgR) is an estrogen regulated protein. It has been proposed that expression of PgR determination indicates a responsive estrogen receptor (ER) pathway, and therefore, may predict likely response to endocrine therapy in human breast cancer. A number of studies have shown that PgR determination provides supplementary information to ER, both in predicting response to endocrine therapy and estimating survival. PgR has proved superior to ER as a prognostic indicator in some studies. Pretreatment: Heat induced epitope retrieval in 10 mM citrate buffer, pH6.0 for 20 minutes is required for IHC staining on formalin-fixed, paraffin embedded tissue sections. Note: Dilution of the antibody in 10% normal goat serum followed by a goat anti-rabbit secondary antibody-based detection is recommended. Control tisse Breast, breast ducatl carcinoma. Staining Nuclear
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
ZR4
Concentration:
n/a
Format:
Concentrate
Storage buffer:
Tissue culture supernatant with 0.2% BSA and 15mM sodium azide
The antibody reacts with progesterone receptor forms alpha and beta. This antibody stains nuclei in breast, ovarian and endometrial epithelia, as well as myometrial nuclei. Since the early 1990s the immunohistochemical (IHC) assay determination of progesterone receptor status has replaced the dextran-coated charcoal method as a prognostic indicator in breast carcinoma. IHC has shown to be superior in prognostic significance when using any one of several available methods of quantitation using this technique.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
Y85
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Dabbs D. Diagnostic Immunohistochemistry, 2nd edition. p 728-32
References 2:
Dunnwald LK, et al. Breast Cancer Res. 2007;9(1):R6
References 3:
Leong A S-Y, et al. Manual of diagnostic immunohistochemistry, 2nd edition. p 375-76
Prior to reconstitution store at +4oC.After reconstitution store at -20oC.Storage in frost-free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody. Rabbit anti Porcine collagen I/III antibody reacts with native and heat denatured porcine collagen type 1 and 3.Less than 0.5% reactivity is observed with porcine albumin and immunoglobulins.
The accumulation of p53 protein in response to genotoxic stress in vitro is well established and appears to induce growth arrest and apoptosis by the transcriptional regulation of other genes and possibly by other direct mechanisms.
Monosan Range:
MONXtra
Concentration:
n/a
Storage buffer:
PBS with 1% BSA and sodium azide
Storage:
2-8°C
References 1:
Botchkarev VA et al. American Journal of Pathology. 158 (6): 19131919 (2001)
References 2:
Midgley CA et al. Journal of Cell Science. 108: 18431848 (1995
Alpha-Methylacyl-CoA Racemase (also known as AMACR or P504s) is an essential enzyme in the ?oxidation of branched-chain fatty acids. AMACR over-expression has been demonstrated in several cancers including colorectal, prostate, ovarian, breast, bladder, lung, and renal cell carcinomas, lymphoma, and melanoma. Staining with the antibody to this enzyme has been useful in identifying prostate carcinoma and prostatic intraepithelial neoplasia, as well as atypical adenomatous hyperplasia in formalin-fixed paraffinized tissue in morphologically difficult cases.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
13H4
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Browne TJ et al. Hum Pathol. 2004 Dec;35(12):1462-8
References 2:
Wu CL et al. Hum Pathol. 2004 Aug;35(8):1008-13
References 3:
Evans AJ. J Clin Pthol. 2003 Dec;56(12):892-7
References 4:
Beach R, Gown AM, et al. Am J Surg Pathol. 2002 Dec;26(12):1588-96
References 5:
Jiang Z, Wu CL, et al. Am J Surg Pathol. 2002 Sep;26(9):1169-74
p40 is a relatively unknown antibody that recognizes ?Np63-a p63 isoform suggested to be highly specific for squamous/basal cells. In a recent study, p40 is equivalent to p63 in sensitivity for squamous cell carcinoma, but it is markedly superior to p63 in specificity1, which eliminates a potential pitfall of misinterpreting a p63-positive adenocarcinoma or unsuspected lymphoma as squamous cell carcinoma. These findings strongly support the routine use of p40 in place of p63 for the diagnosis of pulmonary squamous cell carcinoma. Postive control Prostate
p40 is a relatively unknown antibody that recognizes ?Np63-a p63 isoform suggested to be highly specific for squamous/basal cells. In a recent study, p40 is equivalent to p63 in sensitivity for squamous cell carcinoma, but it is markedly superior to p63 in specificity1, which eliminates a potential pitfall of misinterpreting a p63-positive adenocarcinoma or unsuspected lymphoma as squamous cell carcinoma. These findings strongly support the routine use of p40 in place of p63 for the diagnosis of pulmonary squamous cell carcinoma. Postive control Prostate
p40 is a relatively unknown antibody that recognizes ?Np63-a p63 isoform suggested to be highly specific for squamous/basal cells. In a recent study, p40 is equivalent to p63 in sensitivity for squamous cell carcinoma, but it is markedly superior to p63 in specificity1, which eliminates a potential pitfall of misinterpreting a p63-positive adenocarcinoma or unsuspected lymphoma as squamous cell carcinoma. These findings strongly support the routine use of p40 in place of p63 for the diagnosis of pulmonary squamous cell carcinoma. Postive control Prostate
p63 consists of two major isoforms -TAp63 and ?Np63. These isoforms differ in the structure of the N-terminal domains. The TAp63 isoform (identified by anti-p63 antibody) contains a transactivation- competent TAdomain with homology to p53, which regulates the expression of the growth -inhibitor y genes. In contrast, ?Np63 isoform (identified by anti-p40 antibody) contains an alternative transcriptionally- inactive ?N domain, which antagonizes the activity of TAp63 and p53. The p40 (clone ZR8) recognizes exclusively ?Np63 but not TAp63. p40 is a squamous cell carcinoma specific antibody. It reacts with the vast majority of cases of squamous cell carcinomas of various origins, but not with adenocarcinomas. It is particularly useful in differentiating lung squamous cell carcinoma from lung adenocarcinoma. p40 antibody can also be used as an alternative basal cell/myoepithelial cell marker, which has similar sensitivity and specificity as that of p63 antibody. Therefore, p40 antibody may also be used as an alternative immunohistochemical marker for determining prostate adenocarcinoma vs. benign prostate glands and for determining breast intraductal carcinoma v s. invasive breast ductal carcinoma. Pretreatment: Heat induced epitope retrieval in 10 mM citrate buffer, pH6.0, or in 50 mM Tris buffer pH9.5, for 20 minutes is required for IHC staining on formalin-fixed, paraffin embedded tissue sections. Note: Dilution of the antibody in 10% normal goat serum followed by a goat anti-rabbit secondary antibody-based detection is recommended. Control tissue Lung squamous cell carcinoma. Staning nuclear
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
ZR8
Concentration:
n/a
Format:
Purified
Storage buffer:
Purified antibody in 0.2% BSA and 15mM sodium azide.
Anti-myeloperoxidase detects granulocytes and monocytes in blood and precursors of granulocytes in the bone marrow. This antibody can detect myeloid cell populations of the bone marrow as well as in other sites.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
SP72
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Pinkus GS, et al. Mod Pathol. 1991; 4:733-41
References 2:
Chang CC, et al. Am J Clin Pathol. 2000; 114:807-11
References 3:
Kaleem Z, et al. Am J Clin Pathol. 2001; 115:876-84
References 4:
Audouin J, et al. Int J Surg Pathol. 2003; 11:271-82
The antibody abels a 50kDa, multiple myeloma oncogen-1 (MUM1) protein. MUM1 is encoded by the MUM1/IRF-4 gene, which is mapped to 6q23-25 and identified as a myeloma-associated oncogene. It is a member of the interferon regulatory factor family of transcription factors and plays an important role in the regulation of gene expression in response to signaling by interferon and other cytokines. MUM1 positive cells express the protein in the nucleus in a diffuse and microgranular pattern. However, some positivity is also observed in the cytoplasm of MUM1-expressing cells. In normal/reactive lymphoid tissues, such as lymph node, this antibody stains plasma cells, some B-cells in the light zone of terminal centers, and a subset of T-cells (T-cells in germinal centers and interfollicular areas). Anti-MUM1 antibody can stain other B-cell lymphomas such as lymphoplasmacytic lymphoma, chronic lymphocytic leukemia, follicular lymphoma, marginal zone lymphoma, lymphoblastic lymphoma /leukemia, primary effusion lymphoma, DLBCL, Burkitt-like lymphoma, and classical Hodgkin lymphoma.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
MRQ-43
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Grossman A, et al. Genomics. 1996; 37:229-33
References 2:
Neresh KN. Haematologica. 2007; 92:267-8
References 3:
Van Imhoff GW, et al. J Clin Oncol. 2006; 24:4135-42
References 4:
Gualco G, et al. Appl Immunohistochem Mol Morphol. 2010; 18:301-10
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store at 2-8°C for use within 1-3 weeks or -20°C for long term storage, avoid repeat freeze thaws.
Specificity:
Mouse IL6
Cross Reactivity:
Not Tested Against Other Species
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Rabbit anti-mouse IgG (H&L), Rhodamine (TRITC - tetramethylrhodamine-5-isothiocyanate) conjugated, is a secondary antibody which binds to all mouse IgGs in immunological assays. TRITC has Amax = 550 nm, Emax = 570 nm. Antibody is adsorbed against human serum and affinity purified using solid phase mouse IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. Shelf life of this product is one year from date of receipt.
The optimal working dilution should be determined by the investigator, (ICC), immunohistochemistry ( IHC) (Flow cyt)
Purity:
Immunogen affinity purified IgG.
Special application note:
This antibody reacts with the heavy chains on mouse IgG and with the light chains on all mouse immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin mouse serum proteins, or human serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1% (w/v) BSA, protease/IgG free and 0.05 % (w/v) sodium azide as preservative.
Rabbit anti-mouse IgG (H&L) is a secondary antibody conjugated to Rhodamine (TRITC-rhodamine - Tetramethylrhodamine-5-isothiocyanate) which is reacting with mouse IgG (H&L) in immunological assays. TRITC has Amax = 550 nm, Emax = 570 nm. Antibodies are affinity purified using solid phase mouse IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
The optimal working dilution should be determined by the investigator, (ICC), immunohistochemistry ( IHC) (Flow cyt)
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
This antibody reacts with the heavy chains on mouse IgG and with the light chains on all mouse immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin mouse serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1% (w/v) BSA, protease/IgG free and 0.05 % (w/v) sodium azide as preservative.
Rabbit anti-mouse IgG is a secondary antibody conjugated to HRP (horse radish peroxidase) which binds to all mouse immunoglobulins in immunological assays.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store lyophilized material at 2-8°C. For storage at -20 °C after reconstitution dilute antibody solution with an equal volume of glycerol to obtain final glycerol concentration of 50 % to prevent loss of enzymatic activity. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
Host Animal:
Rabbit
Species Reactivity:
Mouse IgG heavy and light chains (H&L)
Expected Species:
Mouse IgG Heavy and Light chains (H&L)
Immunogen:
Purified Mouse IgG, whole molecule
Applications:
ELISA (ELISA) , Immunohistochemistry (IHC), Western blot (WB)
No confirmed exceptions from predicted reactivity are currently known
Special application note:
HRP-conjugate is supplied in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free0.1 % (v/v) of Kathon CG is used as preservative.
Rabbit anti-mouse IgG (H&L),HRP conjugated, is a secondary atnibody which binds to mouse IgGs in immunological assays. Antibodies are adsorbed against human serum and affinity purified using solid phase mouse IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
This antibody reacts with the heavy chains on mouse IgG and with the light chains on all mouse immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin mouse serum proteins, or human serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 10 % (w/v) BSA, Protease/IgG free and 0.1 % (v/v) Kathon CG is used as preservative. Use of sodium azide will inhibit enzymatic activity of horseradish peroxidase.
Rabbit anti-mouse IgG is a secondary antibody conjugated to HRP (horse radish peroxidase) which binds to all mouse immunoglobulins in immunological assays.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
Host Animal:
Rabbit
Species Reactivity:
Mouse IgG heavy and light chains (H&L)
Expected Species:
Mouse IgG Heavy and Light chains (H&L)
Immunogen:
Purified Mouse IgG, whole molecule
Applications:
ELISA (ELISA) , Immunohistochemistry (IHC), Western blot (WB)
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Vitale et al. (2021) Light Spectral Composition Influences Structural and Eco-Physiological Traits of Solanum lycopersicum L. cv. 'Microtom' in Response to High-LET Ionizing Radiation. Plants (Basel). 2021 Aug 23;10(8):1752. doi: 10.3390/plants10081752. PMID: 34451797; PMCID: PMC8399554.Bui et al. (2020). Differential submergence tolerance between juvenile and adult Arabidopsis plants involves the ANAC017 transcription factor. doi.org/10.1101/2020.02.12.945923 BioRxiv.Koch et al. (2019). Heat stress directly impairs gut integrity and recruits distinct immune cell populations into the bovine intestine. Proc Natl Acad Sci U S A. 2019 May 21;116(21):10333-10338. doi: 10.1073/pnas.1820130116.
Special application note:
Concentration: 1.0 mg/ml (E 1% at 280 nm = 13.0)HRP-conjugate is supplied in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free0.1 % (v/v) of Kathon CG is used as preservative.
Rabbit anti-mouse IgG (H&L), FITC (fluorescein-5-isothiocyanate) conjugated, is a secondary antibody which binds to mouse IgGs in immunological assays. FITC has Amax = 494 nm, Emax = 518 nm. Fluor to protein ratio is 3-7 moles FITC per mole antibody. Antibodies are adsorbed against human serum and affinity purified using solid phase mouse IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. Shelf life of this product is one year from date of receipt.
This antibody reacts with the heavy chains on mouse IgG and with the light chains on all mouse immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin mouse serum proteins, or human serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1% (w/v) BSA, protease/IgG free and 0.05 % (w/v) sodium azide as preservative.
Rabbit anti-mouse IgG (H&L), FITC (fluorescein-5-isothiocyanate) conjugated is a secondary antibody which binds to mouse IgGs in immunological assays. FITC has Amax = 494 nm, Emax = 518 nm. Fluor to protein ratio is 3-7 moles FITC per mole antibody. Antibodies are affinity purified using solid phase mouse IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. Shelf life of this product is one year from date of receipt.
This antibody reacts with the heavy chains on mouse IgG and with the light chains on all mouse immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin mouse serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1% (w/v) BSA, protease/IgG free and 0.05 % (w/v) sodium azide as preservative.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified Whole Molecule Mouse IgG
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Rabbit anti-mouse IgG (H&L) - DyLight 650 Conjugated is a secondary antibody conjugated to DyLight 650, which binds to mouse IgG (H&L) in immunological assays.DyLight 650 has Amax = 652 nm, Emax = 672 nm. Antibodies are purified using solid phase Mouse IgGDyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.05 % (w/v) sodium azide is added as preservative.Based on immunoelectrophoresis, this antibody reacts with: heavy (γ) chains on mouse IgG light chains on all mouse immunoglobulinsNo reactivity is observed to: non-immunoglobulin mouse serum proteins
Rabbit anti-mouse IgG (H&L) - DyLight 550 Conjugate, min. cross-reactivity to human serum is a secondary antibody conjugated to DyLight 550, which binds to all mouse IgG (H&L) in immunological assays. DyLight 550 has Amax = 562 nm, Emax = 576 nm. Antibodies are are affinity purified using solid phase mouse IgG (H&L).DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
Based on immunoelectrophoresis, this antibody reacts with: heavy (γ) chains on mouse IgG light chains on all mouse immunoglobulins.No reactivity is observed to: non-immunoglobulin mouse serum proteins human serum proteins.
Application Details:
1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0,15 M Sodium Chloride, pH 7,2, 1 % (w/v) BSA, Protease/IgG free, 0,05 % (w/v) sodium azide is added as preservative
Rabbit anti-mouse IgG (H&L), DyLight 488 Conjugated is a secondary antibody conjugated to DyLight 488, which binds to Mouse IgG (H&L) in immunological assays.DyLight 488 has Amax = 493 nm, Emax = 518 nm. Antibodies are purified using solid phase Mouse IgG (H&L)DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.05 % (w/v) sodium azide is added as preservative.Based on immunoelectrophoresis, this antibody reacts with: heavy (γ) chains on mouse IgG, light chains on all mouse immunoglobulinsNo reactivity is observed to: non-immunoglobulin mouse serum proteins
Rabbit anti-mouse IgG (H&L), biotin conjugated, is a secondary antibody which binds to mouse IgGs in immunological assays. Antibodies are adsorbed against human serum. Antibodies are affinity purified using solid phase mouse IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. Shelf life of this product is one year from date of receipt.
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified IgG.
Special application note:
This antibody reacts with the heavy chains on mouse IgG and with the light chains on all mouse immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin mouse serum proteins, or human serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free and 0.05 % (w/v) sodium azide as preservative.
Rabbit anti-mouse IgG (H&L), ALP (alkaline phosphatase) conjugated, is a secondary antibody which binds to mouse IgGs in immunological assays. Antibodies are adsorbed against human serum and affinity purified using solid phase mouse IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Non-diluted antibody is stable for 4 years at 2-8°C. For storage at -20 °C dilute antibody solution with an equal volume of glycerol to obtain final glycerol concentration of 50 % to prevent loss of enzymatic activity. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
This antibody reacts with the heavy chains on mouse IgG and with the light chains on all mouse immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin mouse or human serum proteins based on immunoelectrophoresis.Antibody is supplied in 30 mM triethanolamine, pH 7.2, 5 mM magnesium chloride, 0.1 mM zinc chloride, 1 % (w/v) BSA, Protease/IgG free , 0.05 % (w/v) sodium azide as preservative.
Rabbit anti-mouse IgG (H&L) is a secondary antibody conjugated to ALP (Alkaline phosphatase) which binds to all mouse immunoglobulins in immunological assays.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid, clear, colorless.
Storage Temp:
Non-diluted antibody is stable for 4 years at 2-8°C. For storage at -20 °C dilute antibody solution with an equal volume of glycerol to obtain final glycerol concentration of 50 % to prevent loss of enzymatic activity. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
Host Animal:
Rabbit
Species Reactivity:
Mouse IgG heavy and light chains (H&L)
Immunogen:
Purified Mouse IgG, whole molecule,
Applications:
ELISA (ELISA), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western blot (WB)
Based on IEP, this antibody binds to: heavy chains on mouse IgGlight chains on all mouse immunoglobulinsNo reactivity is observed to non-immunoglobulin mouse serum proteins based in immunoelectrophoresis.
No confirmed exceptions from predicted reactivity are currently known
Special application note:
ALP conjugate is supplied in 30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free. 0.05 % (w/v) of sodium azide is added as preservative.Concentration: 1.50 mg/ml (E 1% at 280 nm = 13.0)
Rabbit anti-mouse IgG (H&L), affinity purified, is a secondary antibody which binds to mouse IgGs in immunological assays. Antibodies are adsorbed against human serum and affinity purified using solid phase mouse IgG.
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified IgG.
Special application note:
This antibody reacts with the heavy chains on mouse IgG and with the light chains on all mouse immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin mouse serum proteins, or human serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7, 0.05 % (w/v) sodium azide as preservative.
Antibody reacts with the heavy chains on mouse IgG and with the light chains on all mouse immunoglobulins based on immunoelectrophoresis.No reactivity is observed to non-immunoglobulin mouse serum proteins based on immunoelectrophoresis.
Application Details:
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Antibody is supplied in 10 mM Sodium Phosphate, 0,15 M Sodium Chloride, pH 7,2, 0,05 % (w/v) of Sodium azide as preservative
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Mammaglobin is breast-associated glycoprotein distantly related to secretoglobin family that includes human uteroglobin and lipophilin. Anti-mammaglobin labels cytoplasm of normal breast epithelial cells as well as primary and metastatic breast carcinomas. Absence of mammaglobin expression is typically seen in prostate, kidney, colon, rectum, small intestine, stomach, pancreas, lung and thyroid tissue.2,5 Mammaglobin may be used as part of an immunohistochemical panel for determination of metastatic breast carcinoma and tumor of unknown primary origin.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
31A5
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Fleming TP et al. Ann NY Acad Sci 2000;923:78-89
References 2:
Bhargava R, et al. Am J Clin Pathol. 2007; 127:103-13
References 3:
Wang Z, et al. Int J Clin Exp Pathol. 2009; 2:384-9
References 4:
Han JH, et al. Arch Pathol Lab Med. 2003; 127:1330-4
Rabbit anti-llama IgG (H&L) is a secondary antibody conjugated to HRP, which binds to llama IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase llama IgG (H&L).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C.For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1.1 ml of sterile water add 1.1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
Host Animal:
Rabbit
Immunogen:
Purified llama IgG (H&L) AAQ19986
Applications:
ELISA (ELISA), Immunohistochemistry (IHC), Western Blot (WB)
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Concentration: 1.0 mg/ml (E 1% at 280 nm = 13.0)Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml. Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.1 % (v/v) Kathon CG as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on llama IgG, light chains on all llama immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin llama serum proteins.This antibody will react with VHH of llama IgG's.
Rabbit anti-llama IgG (H&L) is a secondary antibody conjugated to FITC, which binds to llama IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase llama IgG (H&L). Fluorescein-5-isothiocyanate (FITC) has Amax = 494 nm; Emax = 518 nm
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. The shelf life is 1 year from date of receipt. Prepare working dilution prior to use and then discard.
The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on llama IgG, light chains on all llama immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin llama serum proteins.This antibody will react with VHH of llama IgG's.
Rabbit anti-llama IgG (H&L) , DyLight 594 Conjugate is a secondary antibody conjugated to DyLight 594, which binds to all llama IgG (H&L) in immunological assays. DyLight 550 has Amax = 593 nm, Emax = 618 nm. Antibodies are are affinity purified using solid phase llama IgG.DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
Based on immunoelectrophoresis, this antibody reacts with: heavy (γ) chains on llama IgG light chains on all llama immunoglobulins.This antibody will react with VHH of llama IgG's.No reactivity is observed to: non-immunoglobulin llama serum proteins.
Application Details:
1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0,15 M Sodium Chloride, pH 7,2, 1 % (w/v) BSA, Protease/IgG free, 0,05 % (w/v) sodium azide is added as preservative
Rabbit anti-llama IgG (H&L) - DyLight 550 Conjugate is a secondary antibody conjugated to DyLight 550, which binds to all llama IgG in immunological assays. DyLight 550 has Amax = 562 nm, Emax = 576 nm. Antibodies are are affinity purified using solid phase llama IgG (H&L).DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
Based on immunoelectrophoresis, this antibody reacts with: heavy (γ) chains on llama IgG light chains on all llama immunoglobulins.This antibody will react with VHH of llama IgG's.No reactivity is observed to: non-immunoglobulin llama serum proteins.
Application Details:
1 : 20-1 : 2000 for most applications (ELISA, Flow cytometry, Immunofluorescence, Immunolocalization)
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0,15 M Sodium Chloride, pH 7,2, 1 % (w/v) BSA, Protease/IgG free, 0,05 % (w/v) sodium azide is added as preservative
Rabbit anti-llama IgG (H&L), DyLight 488 Conjugated is a secondary antibody conjugated to DyLight 488, which binds to llama IgG (H&L) in immunological assays.DyLight 488 has Amax = 493 nm, Emax = 518 nm. Antibodies are purified using solid phase Llama IgG (H&L)DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Concentration: 1.0 mg/ml (E 1% at 280 nm = 13.0)Conjugate is present in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.05 % (w/v) sodium azide is added as preservative.Based on immunoelectrophoresis, this antibody reacts with: heavy (γ) chains on llama IgG, light chains on all llama immunoglobulinsThis antibody will react with VHH of llama IgG's.No reactivity is observed to: non-immunoglobulin llama serum proteins
Rabbit anti-llama IgG (H&L), DyLight 350 Conjugated is a secondary antibody conjugated to DyLight 350, which binds to llama IgG (H&L) in immunological assays.DyLight 350 has Amax = 353 nm, Emax = 432 nm. Antibodies are purified using solid phase Llama IgG (H&L)DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.05 % (w/v) sodium azide is added as preservative.Based on immunoelectrophoresis, this antibody reacts with: heavy (γ) chains on llama IgG, light chains on all llama immunoglobulinsThis antibody will react with VHH of llama IgG's.No reactivity is observed to: non-immunoglobulin llama serum proteins
Rabbit anti-llama IgG (H&L) is a secondary antibody conjugated to biotin, which binds to llama IgG in immunological assays. Antibody is affinity purified using solid phase llama IgG (H&L).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. The shelf life is 1 year from date of receipt. Prepare working dilution prior to use and then discard.
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 2000-1 : 20 000 (WB) 1 : 500-1 : 5 000 (IHC)
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on llama IgG, light chains on all llama immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin llama serum proteins.This antibody will react with VHH of llama IgG's.
Rabbit anti-llama IgG (H&L) is a secondary antibody conjugated to ALP, which binds to in immunological assays. Antibody is affinity purified using solid phase llama IgG (H&L).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Non-diluted antibody is stable for 4 years at 2-8°C. For storage at -20 °C dilute antibody solution with an equal volume of glycerol to obtain final glycerol concentration of 50 % to prevent loss of enzymatic activity. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 500-1 : 2000 (IHC), 1 : 50 000-1 : 5 000 (WB)
Purity:
Immunogen affinity purified rabbit IgG.
Selected references:
Alharbi et al. (2019). Humoral Immunogenicity and Efficacy of a Single Dose of ChAdOx1 MERS Vaccine Candidate in Dromedary Camels. Sci Rep. 2019 Nov 8;9(1):16292. doi: 10.1038/s41598-019-52730-4.Aharbi et al. (2019). Humoral Immunogenicity and Efficacy of a Single Dose of ChAdOx1 MERS Vaccine Candidate in Dromedary Camels. Sci Rep. 2019 Nov 8;9(1):16292. doi: 10.1038/s41598-019-52730-4.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.50 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 30 mM triethanolamine, pH 7.2.5 mM magnesium chloride, 0.1 mM zinc chloride, 1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on llama IgG, light chains on all llama immunoglobulins. Based on immunoelectrophoresis no reactivity is observed to: non-immunoglobulin llama serum proteins.This antibody will react with VHH of llama IgG's.
Rabbit anti-llama IgG (H&L) is a secondary antibody which binds to llama IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase llama IgG (H&L).
This antibody is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is > 4.5 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on llama IgG, light chains on all llama immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin llama serum proteins.This antibody will react with VHH of llama IgG's.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Llama IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
AAQ19986
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
AAQ19986
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
AAQ19986
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
AAQ19986
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Llama IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Cadherin-16, coded by the CDH16 gene at 16q22.1, belongs to the cadherin superfamily which is composed of calcium-dependent, membrane-associated glycoproteins with a role in cell-adhesion. CDH16 is involved in embryonal development and cell growth. CDH16 supports the formation of tubuli during renal development and remains expressed in distal tubuli of adult kidneys. CDH16 has therefore also been termed kidney specific cadherin (ksp-cadherin) but the protein is also relevant for the development of follicular thyroid cells and thyroid follicular polarity. CDH16 immunostaining is predominantly seen in the kidney, thyroid and the epididymis. In the kidney, CDH16 immunostaining is stronger in distal tubuli and collecting ducts than in proximal tubuli. The staining pattern is membranous (predominantly basolateral) and also cytoplasmic. In the thyroid, a strong membranous CDH16 staining occurs in follicle cells. In the epididymis, a predominantly membranous but also cytoplasmic staining is preferably seen in epithelial cells of the cauda while staining is absent or markedly weaker in the caput. Among cancers, a positive CDH16 immunostaining is most commonly seen in kidney cancer. CDH16 expression also occurs in cancers of the thyroid, uterine cervix, endometrium and the ovary.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human Visfatin
Cross Reactivity:
Not
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
T-bet, a T-box transcription factor, is expressed in CD4+ T-lymphocytes committed to T-helper (Th)1 Tcell development from naïve T-helper precursor cells (Thp) and redirects Th2 T-cells to Th1 development. Anti-T-bet is a marker of mature T-cells and is expressed at very low levels in Thp cells and is absent in precursor T-lymphoblastic leukemia/lymphoma cells. Scattered small lymphocytes in the interfollicular T-cell zone of reactive lymphoid tissue, including tonsil, lymph node, and spleen exhibited nuclear staining for anti-T-bet, with no anti-T-bet staining observed in germinal centers or mantle or marginal zones. T-bet is expressed in a significant subset of B-cell lymphoproliferative disorders, particularly at an early stage of B-cell development (precursor B-cell lymphoblastic leukemia/lymphoblastic lymphoma), and B-cell neoplasms derived from mature B-cells, including CLL/SLL, marginal zone lymphoma, and hairy cell leukemia.
Antibody Isotype:
IgG1
Monosan Range:
MONOSAN
Clone:
MRQ-46
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Szabo SJ, et al. Cell. 2000; 100:665-69
References 2:
Jöhrens K, et al. Am J Surg Pathol. 2007; 31:1181-5
References 3:
Atayar C, et al. Am J Pathol. 2005; 166:127-34
References 4:
Dorfman DM, et al. Am J Clin Pathol. 2004; 122:292-7
The antibody reacts with neuroendocrine cells of human adrenal medulla, carotid body, skin, pituitary, thyroid, lung, pancreas, and gastrointestinal mucosa. This antibody identifies normal neuroendocrine cells and neuroendocrine neoplasms. Diffuse, finely granular, cytoplasmic staining is observed, which probably correlates with the distribution of the antigen within neurosecretory vesicles. The expression of synaptophysin is independent of the presence of NSE or other neuroendocrine markers. Antisynaptophysin is an independent, broad-range marker of neural and neuroendocrine differentiation.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
MRQ-40
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Wiedenmann, B, et al. Cell 1985;41:1017-1028
References 2:
Navone, F et al. J Cell Biol 1986;103:2511-2527
References 3:
Lyda MH et al. Hum Pathol. 2000 Aug;31(8):980-7
References 4:
Skacel M et al. Appl Immunohistochem Mol Morphol. 2000 Sep;8(3):302-9
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 0.11 ml of deionized water and let stand 30 minutes at room temperature to dissolve. Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Specificity:
Human Resistin
Cross Reactivity:
Not Tested Against Other Species
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
PU.1 is a transcription factor that has been shown to be important for normal B-cell development. PU.1 belongs to the ETS family of transcription factors. It is expressed in the myeloid lineage and in immature as well as mature B-lymphocytes, with the exception of plasma cells. PU.1 is essential during early B-cell differentiation. The absence of PU.1 results in total block of B-cell development at the prepro stage. Very little is known about PU.1 function in later stages of B-cell development. PU.1 does not seem to play a role in the end-stage of B-cell development and is not expressed in plasma cells. PU.1 exerts an important role in the regulation of the expression of crucial B-cell proteins, such as immunoglobulin (Ig) genes, and CD20 and its putative binding sites were also identified in the promoters of CD79, CD10, and CD22. PU.1 binds to the 3 enhancer region of both the Ig kappa and lambda light chain genes and it also regulates the immunoglobulin heavy chain genes through the intron enhancer region.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EPR3158Y
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
PU.1 is a transcription factor that has been shown to be important for normal B-cell development. PU.1 belongs to the ETS family of transcription factors. It is expressed in the myeloid lineage and in immature as well as mature B-lymphocytes, with the exception of plasma cells. PU.1 is essential during early B-cell differentiation. The absence of PU.1 results in total block of B-cell development at the prepro stage. Very little is known about PU.1 function in later stages of B-cell development. PU.1 does not seem to play a role in the end-stage of B-cell development and is not expressed in plasma cells. PU.1 exerts an important role in the regulation of the expression of crucial B-cell proteins, such as immunoglobulin (Ig) genes, and CD20 and its putative binding sites were also identified in the promoters of CD79, CD10, and CD22. PU.1 binds to the 3 enhancer region of both the Ig kappa and lambda light chain genes and it also regulates the immunoglobulin heavy chain genes through the intron enhancer region.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
EPR3158Y
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
The antibody reacts with progesterone receptor forms alpha and beta. This antibody stains nuclei in breast, ovarian and endometrial epithelia, as well as myometrial nuclei. Since the early 1990s the immunohistochemical (IHC) assay determination of progesterone receptor status has replaced the dextran-coated charcoal method as a prognostic indicator in breast carcinoma. IHC has shown to be superior in prognostic significance when using any one of several available methods of quantitation using this technique.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
Y85
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Dabbs D. Diagnostic Immunohistochemistry, 2nd edition. p 728-32
References 2:
Dunnwald LK, et al. Breast Cancer Res. 2007;9(1):R6
References 3:
Leong A S-Y, et al. Manual of diagnostic immunohistochemistry, 2nd edition. p 375-76
Alpha-Methylacyl-CoA Racemase (also known as AMACR or P504s) is an essential enzyme in the ?oxidation of branched-chain fatty acids. AMACR over-expression has been demonstrated in several cancers including colorectal, prostate, ovarian, breast, bladder, lung, and renal cell carcinomas, lymphoma, and melanoma. Staining with the antibody to this enzyme has been useful in identifying prostate carcinoma and prostatic intraepithelial neoplasia, as well as atypical adenomatous hyperplasia in formalin-fixed paraffinized tissue in morphologically difficult cases.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
13H4
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Browne TJ et al. Hum Pathol. 2004 Dec;35(12):1462-8
References 2:
Wu CL et al. Hum Pathol. 2004 Aug;35(8):1008-13
References 3:
Evans AJ. J Clin Pthol. 2003 Dec;56(12):892-7
References 4:
Beach R, Gown AM, et al. Am J Surg Pathol. 2002 Dec;26(12):1588-96
References 5:
Jiang Z, Wu CL, et al. Am J Surg Pathol. 2002 Sep;26(9):1169-74
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human Omentin
Cross Reactivity:
Not Tested Against Other Species
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
NKX3.1 is a prostate specific androgen-regulated homeobox gene located on chromosome 8p. It is difficult to distinguish between high grade prostate adenocarcinoma and high grade infiltrating urothelial carcinoma using hematoxylin and eosin stained specimens. Current prostate adenocarcinoma markers such as prostate specific antigen (PSA) and prostate specific acid phosphatase (PSAP) are very useful in determining prostate origin of prostate cancer in other sites, but have lower sensitivity when identifying poorly differentiated compared to well differentiated cases. NKX3.1 is a sensitive and specific tissue marker of prostate adenocarcinoma and can be used to help distinguish it from urothelial carcinomas. Currently, thrombomodulin and uroplakin are used to identify tumors of urothelial origin; however, their sensitivities are suboptimal.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EP356
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Gurel B, et al. Am J Surg Pathol. 2010; 34:1097-105
References 2:
Chuang AY, et al. Am J Surg Pathol. 2007; 31:1246-55
The antibody abels a 50kDa, multiple myeloma oncogen-1 (MUM1) protein. MUM1 is encoded by the MUM1/IRF-4 gene, which is mapped to 6q23-25 and identified as a myeloma-associated oncogene. It is a member of the interferon regulatory factor family of transcription factors and plays an important role in the regulation of gene expression in response to signaling by interferon and other cytokines. MUM1 positive cells express the protein in the nucleus in a diffuse and microgranular pattern. However, some positivity is also observed in the cytoplasm of MUM1-expressing cells. In normal/reactive lymphoid tissues, such as lymph node, this antibody stains plasma cells, some B-cells in the light zone of terminal centers, and a subset of T-cells (T-cells in germinal centers and interfollicular areas). Anti-MUM1 antibody can stain other B-cell lymphomas such as lymphoplasmacytic lymphoma, chronic lymphocytic leukemia, follicular lymphoma, marginal zone lymphoma, lymphoblastic lymphoma /leukemia, primary effusion lymphoma, DLBCL, Burkitt-like lymphoma, and classical Hodgkin lymphoma.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
MRQ-43
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Grossman A, et al. Genomics. 1996; 37:229-33
References 2:
Neresh KN. Haematologica. 2007; 92:267-8
References 3:
Van Imhoff GW, et al. J Clin Oncol. 2006; 24:4135-42
References 4:
Gualco G, et al. Appl Immunohistochem Mol Morphol. 2010; 18:301-10
Mammaglobin is breast-associated glycoprotein distantly related to secretoglobin family that includes human uteroglobin and lipophilin. Anti-mammaglobin labels cytoplasm of normal breast epithelial cells as well as primary and metastatic breast carcinomas. Absence of mammaglobin expression is typically seen in prostate, kidney, colon, rectum, small intestine, stomach, pancreas, lung and thyroid tissue.2,5 Mammaglobin may be used as part of an immunohistochemical panel for determination of metastatic breast carcinoma and tumor of unknown primary origin.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
31A5
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Fleming TP et al. Ann NY Acad Sci 2000;923:78-89
References 2:
Bhargava R, et al. Am J Clin Pathol. 2007; 127:103-13
References 3:
Wang Z, et al. Int J Clin Exp Pathol. 2009; 2:384-9
References 4:
Han JH, et al. Arch Pathol Lab Med. 2003; 127:1330-4
10 mM Sodium Phosphate, 0.15 M Na/K Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store at 2-8°C for use within 1-3 weeks or -20°C for long term storage, avoid repeat freeze thaws.
Specificity:
Human IL6
Cross Reactivity:
Not Tested Against Other Species
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Rabbit anti-human IgM ( chain)is a secondary antibody conjugated to TRITC, which binds to human IgM in immunological assays. Antibody is affinity purified using solid phase human IgG (H&L). Tetramethylrhodamine-5-isothiocyanate (TRITC) has Amax = 550 nm; Emax = 570 nm.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. The shelf life is 1 year from date of receipt. Prepare working dilution prior to use and then discard.
The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on human IgM. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin human serum proteins light chains on all human immunoglobulins.
Rabbit anti-human IgM ( chain) is a secondary antibody conjugated to HRP, which binds to human IgM (heavy chain) in immunological assays. Antibody is affinity purified using solid phase human IgG (H&L).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator,
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml. Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.1 % (v/v) Kathon CG as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy ( ) chains on human IgM Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin human serum proteins, light chains on all human immunoglobulins
Rabbit anti-human IgM ( chain) is a secondary antibody conjugated to FITC, which binds to human IgM in immunological assays. Antibody is affinity purified using solid phase human IgG (H&L). Fluorescein-5-isothiocyanate (FITC) has Amax = 494 nm; Emax = 518 nm.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. The shelf life is 1 year from date of receipt. Prepare working dilution prior to use and then discard.
The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy (m) chains on human IgM. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin human serum proteins, light chains on all human immunoglobulins
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Storage:
2-8 °C
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water,Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Antibody purity is > 90 % based on SDS-PAGE. Small amounts of intact IgG may be present.Affinity purified using solid phase Human IgM. F(ab)’2 fragment was prepared by pepsin digestion.Antibody is supplied in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2.Based on IEP, this antibody reacts with: • heavy ( ) chains on Human IgM.Based on IEP, no reactivity is observed to: • light chains on all Human immunoglobulins • non-immunoglobulin Human serum proteins • Mouse IgG or serum proteins.
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on human IgM Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin human serum proteins light chains on all human immunoglobulins
Application Details:
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 2000-1 : 20 000 (WB) 1 : 500 - 1 : 5 000 (IHC)
Rabbit anti-human IgM ( chain) is a secondary antibody which binds to human IgM (m chain) in immunological assays. Antibody is affinity purified using solid phase human IgG (H&L).
This antibody is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is > 4.5 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on human IgM Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin human serum proteins light chains on all human immunoglobulins
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgM (µ chain)
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (µ) chains on human IgM
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins · light chains on all human immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgM (µ chain)
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (µ) chains on human IgM
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins · light chains on all human immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgM (µ chain)
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (µ) chains on human IgM
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins · light chains on all human immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgM (µ chain)
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (µ) chains on human IgM
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins · light chains on all human immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Storage:
2-8 °C
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (µ) chains on human IgM
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins · light chains on all human immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Antibody purity is > 95 % based on SDS-PAGE.Affinity purified using solid phase Human IgM.Antibody is supplied in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2. 0.05 % (w/v) Sodium Azide is added as a preservative.Based on IEP, this antibody reacts with: heavy (γ) chains on Human IgM .Based on IEP, no reactivity is observed to: light chains on all Human immunoglobulins, non-immunoglobulin Human serum proteins, Mouse IgG or serum proteins.
Rabbit anti-human IgG (H&L) is a secondary antibody conjugated to TRITC, which binds to human IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase human IgG (H&L). Tetramethylrhodamine-5-isothiocyanate (TRITC) has Amax = 550 nm; Emax = 570 nm.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. The shelf life is 1 year from date of receipt. Prepare working dilution prior to use and then discard.
The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on human IgG, light chains on all human immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin human serum proteins
Rabbit anti-human IgG (H&L) is a secondary antibody conjugated to HRP, which binds to human IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase human IgG (H&L).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator,
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml. Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.1 % (v/v) Kathon CG as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on human IgG, light chains on all human immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin human serum proteins.
Rabbit anti-human IgG (H&L) is a secondary antibody conjugated to FITC, which binds to human IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase human IgG (H&L). Fluorescein-5-isothiocyanate (FITC) has Amax = 494 nm; Emax = 518 nm
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. The shelf life is 1 year from date of receipt. Prepare working dilution prior to use and then discard.
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on human IgG, light chains on all human immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin human serum proteins.
Rabbit anti-human IgG (H&L), DyLight 800 Conjugated is a secondary antibody conjugated to DyLight 800, which binds to human IgG (H&L) in immunological assays.DyLight 800 has Amax = 777 nm, Emax = 794 nm. Antibodies are purified using solid phase Human IgG (H&L)DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.05 % (w/v) sodium azide is added as preservative.Based on immunoelectrophoresis, this antibody reacts with: heavy (γ) chains on human IgG, light chains on all human immunoglobulinsNo reactivity is observed to: non-immunoglobulin human serum proteins
Rabbit anti-human IgG (H&L) , DyLight 594 Conjugate is a secondary antibody conjugated to DyLight 594, which binds to all human IgG in immunological assays. DyLight 550 has Amax = 593 nm, Emax = 618 nm. Antibodies are are affinity purified using solid phase human IgG.DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
Based on immunoelectrophoresis, this antibody reacts with: heavy (γ) chains on human IgG light chains on all human immunoglobulins.No reactivity is observed to: non-immunoglobulin human serum proteins.
Application Details:
1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0,15 M Sodium Chloride, pH 7,2, 1 % (w/v) BSA, Protease/IgG free, 0,05 % (w/v) sodium azide is added as preservative
Rabbit anti-human IgG (H&L) is a secondary antibody conjugated to biotin, which binds to human IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase human IgG (H&L).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. The shelf life is 1 year from date of receipt. Prepare working dilution prior to use and then discard.
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 2000-1 : 20 000 (WB) 1 : 500-1 : 5 000 (IHC)
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on human IgG, light chains on all human immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin human serum proteins
Rabbit anti-human IgG (H&L) is a secondary antibody conjugated to ALP, which binds to human IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase human IgG (H&L).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Non-diluted antibody is stable for 4 years at 2-8°C. For storage at -20 °C dilute antibody solution with an equal volume of glycerol to obtain final glycerol concentration of 50 % to prevent loss of enzymatic activity. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 500-1 : 2000 (IHC), 1 : 50 000-1 : 5 000 (WB)
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.50 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 30 mM triethanolamine, pH 7.2.5 mM magnesium chloride, 0.1 mM zinc chloride, 1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on human IgG, light chains on all human immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin human serum proteins
Rabbit anti-human IgG (H&L) is a secondary antibody which binds to human IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase human IgG (H&L).
This antibody is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is > 4.5 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on human IgG, light chains on all human immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin human serum proteins.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified human IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
CAA10835
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified human IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
CAA10835
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: ¢heavy (γ) chains on human IgG ¢light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: ¢non-immunoglobulin human serum proteins ¢Mouse IgG and serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Hemoglobin alpha chain belongs to the globin family and is involved in oxygen transport from the lung to the various peripheral tissues. Hemoglobin A is comprised of two alpha chains and two beta chains. Immunohistochemical localization of hemoglobin is excellent as an erythroid marker for the detection of immature, dysplastic, and megaloblastic erythroid cells in myeloproliferative disorders, such as erythroleukemia. In contrast, myeloid cells, lymphoid cells, plasma cells, histiocytes, and megakaryocytes do not stain with anti-hemoglobin A.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EPR3608
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
OMalley DP, et al. Mod Pathol. 2005; 18:1550-61
References 2:
Cherie H Dunphy, et al. Appl Immun Mol Morphol, 2005; 15(2):154-159
Hemoglobin alpha chain belongs to the globin family and is involved in oxygen transport from the lung to the various peripheral tissues. Hemoglobin A is comprised of two alpha chains and two beta chains. Immunohistochemical localization of hemoglobin is excellent as an erythroid marker for the detection of immature, dysplastic, and megaloblastic erythroid cells in myeloproliferative disorders, such as erythroleukemia. In contrast, myeloid cells, lymphoid cells, plasma cells, histiocytes, and megakaryocytes do not stain with anti-hemoglobin A.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
EPR3608
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
OMalley DP, et al. Mod Pathol. 2005; 18:1550-61
References 2:
Cherie H Dunphy, et al. Appl Immun Mol Morphol, 2005; 15(2):154-159
The antibody detects astrocytes, Schwann cells, satellite cells, enteric glial cells, and some groups of ependymal cells. This marker is mainly used to distinguish neoplasms of astrocytic origin from other neoplasms in the central nervous system.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EP672Y
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Jessen, KR, et al. J Neurosci 1983;3:2206-2218
References 2:
Regner A et al. J Neurotrauma. 2001 Aug;18(8):783-92
References 3:
Nagashima G et al. Clin Neurol Neurosurg. 2002 May;104(2):125-31
References 4:
Choi, BH, et al. Science 1984;223:407-409
References 5:
Viale, G, et al. Virchows Arch A Pathol Anat 1991;418:339-348
GCDFP-15 is a glycoprotein localized in the apocrine metaplastic epithelium lining breast cysts and in apocrine glands in the axilla, vulva, eyelid, ear canal, and in salivary glands. GCDFP-15 positivity is seen in breast carcinomas. On the other hand, colorectal carcinomas, lung carcinoma, mesotheliomas rarely stain with this antibody. Because of its specificity for breast carcinoma, this antibody is often helpful in distinguishing metastasis of unknown primary.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EP1582Y
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Mazoujian G, et al. Am J Pathol. 1983; 110:105-12
References 2:
Liegl B, et al. Histopathology. 2007; 50:439-47
References 3:
Bhargava R, et al. Am J Clin Pathol. 2007; 127:103-13
References 4:
Tornos C, et al. Am J Surg Pathol. 2005; 29:1482-9
References 5:
Takeda Y, et al. Arch Pathol Lab Med. 2008; 132:239-43
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human gACRP-30
Cross Reactivity:
Not Tested Against Other Species
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Factor XIIIa has been identified in platelets, megakaryocytes, and fibroblast-like mesenchymal or histiocytic cells in the placenta, uterus, and prostate, monocytes and macrophages and dermal dendritic cells. Anti- Factor XIIIa has been found to be useful in differentiating between dermatofibroma (almost all cases +), dermatofibrosarcoma protuberans (-/+) and desmoplastic malignant melanoma. Anti-factor XIIIa positivity is also seen in capillary hemagioblastoma, hemangioendothelioma, hemangiopericytoma, xanthogranuloma, xanthoma, hepatocellular carcinoma, glomus tumor, and meningioma.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EP3372
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Nemes Z, Hum Pathol 1992 Jul; 23(7):805-10
References 2:
Horenstein MG et al. Am J Surg Pathol. 2000 Jul;24(7):996-1003
References 3:
Kraus MD et al. Am J Dermatopathol. 2001 Apr;23(2):104-11
References 4:
Abenoza P, et al. Am J Dermatopathol. 1993; 15:429-34
References 5:
Anstey A, Cerio R, et al.: Am J Dermatopathol 1994 Feb: 16(1):14-22
E-cadherin is an adhesion protein that is expressed in cells of epithelial lineage. Anti-E-cadherin stains positively in glandular epithelium as well as adenocarcinomas of the lung, gastrointestinal tract and ovary. Another application involves the differentiation of ductal (which is membrane staining) vs. lobular cancer of the breast (which is cytoplasmic staining). It has also been shown to be positive in some thyroid carcinomas. A combination of E-cadherin and p120 catenin helps distinguish ductal carcinoma of the breast from lobular carcinoma.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EP700Y
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Han AC, et al. Hum Pathol. 1997; 28:641-5
References 2:
Simsir A, et al. Diagn Cytopathol. 1999; 20:125-30
References 3:
Abutaily AS, et al. J Clin Pathol. 2002; 55:662-8
References 4:
Acs G, et al. Am J Clin Pathol. 2001; 115:85-98
References 5:
Dabbs DJ, et al. Am J Surg Pathol. 2007; 31:427-37
Cytokeratin 5 is an intermediate filament protein of 58 kD molecular weight within the cytokeratin family. It is a type II (basic) cytokeratin. Antibodies to this protein identify basal cells of squamous and glandular epithelia, myoepithelia, and mesothelium. Anti-cytokeratin 5 has been reported useful in the differential diagnosis of metastatic carcinoma in the pleura versus epithelioid mesothelioma. Epithelioid mesotheliomas are strongly positive in almost all cases, but a minority of pulmonary adenocarcinomas will show focal immunoreactivity. Almost all squamous cell carcinomas, half of transitional carcinomas, and many undifferentiated large cell carcinomas immunostain with anti-CK 5. Anti-CK 5, along with antip63, affords a high sensitivity and specificity for squamous differentiation. Myoepithelial cells of the breast, glandular epithelia, and basal cells of the prostate are labeled with anti-CK. This antibody, along with anti-CK 14, has found application in identifying basal-like breast carcinoma.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EP1601Y
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Ordonez NG. Human Pathology. 2007; 38:116
References 2:
Kargi A, et al. Appl Immunohistochem Mol Morphol.; 15:415420 (2007)
Cyclins are proteins that govern transitions through distinct phases of the cell cycle by regulating the activity of the cyclin-dependent kinases. Cyclin D1, one of the key cell cycle regulators, is a putative proto-oncogene found in a wide variety of human neoplasms. This antibody is useful for distinguishing mantle cell lymphomas (cyclin D1 positive).
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
SP4
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Aagaard, L, et al. International J of Cancer 1995;61(1):115-120
References 2:
Bartkova, J, et al. Cancer Research 1995;55:949-956
References 3:
Bartkova, J, et al. Oncogene 199510(4):775-778
References 4:
Bartkova, J, et al. J of Pathology 1994;172(3):237-245
References 5:
Lukas, J, et al. Molecular and Cellular Biology 1995;15(5):2600-2611
Rabbit anti Human collagen I/II/III/IV/V antibodyrecognizes multiple collagen types and exhibits the following reactivities in ELISA with both native and denaturated human collagen types:. I & III100%IV & V90%II 80%Human fibronectin, albumin and immunoglobulins all <0.5% Storage: This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
The claudins are a family of over twenty proteins which are components of tight junction. Tight junctions are specialized regions of cell to cell contact; made up of network of strands to act as a molecular gasket for preventing the leakage of ions, water etc. between cells. They are abundant in luminal epithelial sheets where they maintain epithelial cell polarity. The claudins constitute a variable component, with specific claudins being associated with specific tissues. The immunoreactivity for anti-claudin 1 is membranous and is found in nearly all carcinomas. The staining is much stronger in the carcinoma cells than in normal tissues. Anti-claudin 1 in a panel of immunostains with EMA (positive), S-100 (negative), and GLUT1 can be utilized as a robust marker in diagnosis of perineurioma and neurofibroma. Recently studies showed anti-claudin seems to be a specific marker for meningiomas. Therefore, anti-claudin with anti-EMA, anti-S-100 protein, anti-CD34, and anti-glial fibrillary acidic protein may be helpful in the diagnosis of meningiomas from histologic mimics
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Folpe AL, et al. Am J Surg Pathol. 2002; 26:1620-6
CDX-2 is a caudal-related homeobox transcription factor whose expression in the adult is normally present in the gastrointestinal (GI) epithelium. It is implicated in the development and maintenance of the intestinal mucosa. This protein is expressed immunohistochemically in the nuclei of normal GI epithelium. CDX-2 protein expression has been seen in GI carcinomas. Anti-CDX-2 has been useful to establish GI origin of metastatic adenocarcinomas and carcinoids and is especially useful to distinguish metastatic colorectal adenocarcinoma from lung adenocarcinoma. However, mucinous carcinomas of the ovary also stain positively with this antibody, which limits the usefulness of this marker in the distinction of metastatic colorectal adenocarcinoma versus mucinous carcinoma of the ovary.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EPR2764Y
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Mazziotta RM, et al. Appl Immunohistochem Mol Morphol. 2005; 13:55-60
References 2:
Erickson LA, et al. Endocr Pathol. 2004; 15:247-52
References 3:
Saqi A, et al. Am J Clin Pathol. 2005; 123:394-404
References 4:
Saad RS, et al. Am J Clin Pathol. 2004; 122:421-7
References 5:
Kaimaktchiev V, et al. Mod Pathol. 2004; 17:1392-9
CD99, as detected with a variety of antibodies, is expressed by virtually almost all Ewings sarcoma and primitive peripheral neuroectodermal tumors (ES/PNET) and demonstrates strong and diffuse membranous staining. Other tumors that may show CD99 expression include neuroendocrine carcinomas, mesenchymal chondrosarcomas, solitary fibrous tumors, synovial sarcomas, vascular tumors, small round blue cell tumors, lymphoblastic lymphoma, acute myeloid leukemia, and myeloid sarcoma.5 However, strong and diffuse membranous reactivity for CD99 favors ES/PNET over the other diagnostic considerations. The other CD99+ tumors usually show cytoplasmic and more heterogeneous staining. Therefore, when making a final diagnostic interpretation, CD99 must be considered in a panel with other antibodies.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EPR3097Y
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Rettig WJ, et al. Lab Invest. 1992; 66:133
References 2:
Fellinger EJ, et al. Amer J Surg Pathol. 1992; 16:746
References 3:
Ambros IM, et al. Cancer. 1991; 139:317
References 4:
Khoury JD. Adv Anat Pathol. 2005; 12:212-20
References 5:
Dabbs DJ. Theranostic and Genomic Applications. 2014; 126
Anti-CD5 is a pan T-cell marker that also reacts with a range of neoplastic B-cells. CD5 expression is useful in distinguishing mature T-cell neoplasms and differentiating among mature small lymphoid cell malignancies. Anti-CD5 does not react with granulocytes or monocytes.
Antibody Isotype:
IgG1
Monosan Range:
MONOSAN
Clone:
SP19
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Jones NH, et al., Nature 1986;323: 346-349
References 2:
Tan SH et al. Br J Dermatol. 2003 Sep;149(3): 542-53
References 3:
Chang CC et al. Mod Pathol. 2002 Oct;15(10): 1051-7
References 4:
Hatano B et al. Pathol Int. 2002 May-Jun;52(5-6): 400-5
References 5:
West RB et al. Am J Clin Pathol. 2002 Apr;117(4): 636-43
CD56, also known as neural cell adhesion molecule (NCAM), is a calcium-independent homophilic binding protein that belongs to a group of cell adhesion molecules including cadherins, selectins, and integrins. CD56 is involved in cellcell adhesion of neural cells during embryogenesis and is expressed on most neuroectodermally derived tissues.1-3 In normal tissue, anti-CD56 labels neurons, glia, schwann cells, NK (natural killer) cells, and a subset of T-cells.3 CD56 expression can be seen in most NK cell neoplasms, certain subtypes of T-cell lymphoma and in some plasma cell neoplasms.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
MRQ-42
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Langdon, SP et al. Cancer Research 1988; 48(21):6161-6165
References 2:
Kaufmann, O et al. Hum Pathol. 1997 Dec; 28(12): 1373-8
References 3:
Tao, J et al. Am J Surg Pathol. 2002 Jan; 26(1):111-8
References 4:
Ely, SA et al. Am J Pathol. 2002 Apr; 160(4): 1293-9
References 5:
Sumi, M et al. Leuk Lymphoma. 2003 Jan; 44(1): 201-4
CD3s immunohistochemical detection locates the cytoplasmic component of CD3 protein. Anti-CD3 is considered to be a pan-T-cell marker and reacts with an antigen present at the surface and in the cytoplasm of T lymphocytes. Anti-CD3 is widely used for the identification of immature and mature T-cell malignancies.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
MRQ-39
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Beverley PC, et al. Eur J Immunol.; 11:329-34 (1981)
References 2:
Hedvat CV, et al. Hum Pathol.; 33:968-74 (2002)
References 3:
Karube K, et al. Am J Surg Pathol.; 27:1366-74 (2003)
References 4:
Dogan A, et al. Am J Surg Pathol.; 27:903-11 (2003)
CD21 (also known as complement receptor 2 (CR2), C3d receptor, or EBV receptor) is a 140 kDa membrane protein on B-lymphocytes to which the Epstein-Barr virus (EBV) binds during infection of these cells. The antigen is absent on T-lymphocytes, monocytes, and granulocytes. MON 3028 is useful in the identification of follicular dendritic cell matrix found in normal lymph node and tonsillar tissue. This antibody also labels follicular dendritic cell sarcomas. Anti-CD21 is valuable in differentiating follicular lymphoma with marginal zone differentiation from marginal zone lymphoma with follicular involvement. It also plays a role in distinguishing among nodular lymphocyte predominant Hodgkin lymphoma, lymphocyte-rich classic Hodgkin lymphoma, and T-cell/histiocyte-rich B-cell lymphoma in combination with other B-cell and T-cell markers. Anti-CD21 is also useful in identifying abnormal follicular dendritic cell pattern in angioimmunoblastic T-cell lymphoma and follicular T-cell lymphoma.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EP3093
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Dillon KM et al. J Clin Pathol. 2002 Oct;55(10):791-4
CD1a is a non-polymorphic, major histocompatibility complex, class I-related cell surface glycoprotein (45 to 55 kDa) and is expressed in association with ?-microglobulin. In normal tissues, anti-CD1a reacts with cortical thymocytes, Langerhans cells, interdigitating cells, and rare antigen-presenting cells of the lymph node. CD1a positivity has also been seen in Langerhans cell histiocytosis (histiocytosis X), and a subset of pre-T lymphoblastic lymphoma/leukemia (cortical T LBL/L).
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EP3622
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Krenacs L, et al. J Pathol. 1993; 171:99-104
References 2:
Angel CE, et al. Blood. 2009; 113:1257-67
References 3:
Emile JF, et al. Am J Surg Pathol. 1995; 19:636-41
References 4:
Stefano, AP et al. Br J Haematol. 1999; 105:394-401
CD117, c-kit is a tyrosine kinase receptor found on interstitial cells of Cajal, germ cells, bone marrow stem cells, melanocytes, breast epithelium and mast cells. This receptor is found on a wide variety of tumor cells (follicular and papillary carcinoma of thyroid, adenocarcinomas from endometrium, lung, ovary, pancreas, breast; malignant melanoma, endodermal sinus tumor, and small cell carcinoma) but has been particularly useful in differentiating gastrointestinal stromal tumors from Kaposis sarcoma, and tumors of smooth muscle origin.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
YR145
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Sircar K, et al. AM J Surg Pathol 23(4):377-389,1999
References 2:
Miettinen M et al. Am J Surg Pathol 24(2):211-222, 2000
References 3:
Miettinen M. et al. Am J Surg Pathol 23(9): 1109-1118
Calponin is a 34 kD polypeptide that interacts with actin, tropomyosin, and calmodulin. It is involved in smooth muscle contraction mechanism and is restricted exclusively to smooth muscle tissue. Anticalponin has been found to be useful in staining myoepithelium and is, therefore, useful for differentiating benign sclerosing adenosis of the breast from infiltrating ductal carcinoma. Calponin positivity has also been noted in malignant myoepithelioma and pleomorphic adenoma3 of salivary gland origin, as well as angiomatoid malignant fibrous histiocytoma.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EP798Y
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Wang NP, et al. Appl Immunohistochem. 1997; 5:141-151
References 2:
Nagao T, et al. Cancer. 1998; 83:1292-9
References 3:
Savara AT, et al. Mod Pathol. 1997; 10:1093-1100
References 4:
Fanburg-Smith JC, et al. Hum Pathol. 1999; 30:1336-43
References 5:
Hornick JL, et al. Am J Surg Pathol. 2003; 27: 1183-96
Anti-caldesmon is a regulatory protein found in smooth muscle and other tissues which interacts with actin, myosin, tropomyosin, and calmodulin. Anti-caldesmon antibody labels smooth muscle and tumors of smooth muscle, myofibroblastic, and myoepithelial differentiation. Anti-caldesmon has also been used to differentiate epithelioid mesothelioma from serous papillary carcinoma of the ovary.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
E-89
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Miettinen M, et al. Arch Pathol Lab Med. 2006; 130:1466-78
References 2:
Watanabe K, et al. Hum Pathol. 1999; 30:392-6
References 3:
McCluggage WC. Adv Anat Pathol. 2004; 11:162-71
References 4:
Comin CE, et al. Am J Surg Pathol. 2006; 30:463-9
References 5:
Comin CE, et al. Am J Surg Pathol. 2007; 31:1139-48
Complement component C3 plays a central role in the activation of complement system. Its activation is required for both classical and alternative complement activation pathways. C3d deposition in the renal transplant PTCs (peritubular capillaries) is indicative of AR (acute rejection) with subsequent high probability of graft loss. Anti-C3d, combined with anti-C4d, can be utilized as a tool for diagnosis of AR and warrant prompt and aggressive anti-rejection treatment. In another study, Pfaltz et al. have shown that anti-C3d labeled the epidermal basement membrane in 97% (31/32) cases of bullous pemphigoid (BP), with none of the normal controls demonstrating such findings. In the same study 27% (3/11) cases of pemphigus vulgaris (PV) demonstrated intercellular C3d deposition. Therefore, C3d immunohistochemistry is a helpful adjunct in the diagnosis of BP (and perhaps PV), especially in the cases in which only formalin-fixed, paraffin embedded tissue is available for analysis.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Bickerstaff A, et al. Am J Pathol. 2008; 173:347-57
References 2:
Kuypers DR, et al. Transplantation. 2003; 76:102-8
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
R-Phycoerythrin (R-PE)
Form:
Lyophilized
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
1mg/ml
Conjugate:
DyLight® 650 (Ex = 652 nm; Em = 672 nm)
Form:
Liquid
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 2 mM Sodium Azide
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
DyLight® 550
Form:
Liquid
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
1mg/ml
Conjugate:
DyLight® 488 (Ex = 493 nm; Em = 518 nm)
Form:
Liquid
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Rabbit anti-hamster IgG (H&L), TRITC (tetramethylrhodamine-5-isothiocyanate) conjugated is a secondary antibody which binds to hamster IgG in immunological assays. TRITC has Amax = 550 nm, Emax = 570 nm. Fluor/protein ratio is 1-2 moles TRITC per mole antibody. Antibodies are affinity purified on solid phase hamster IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. Shelf life of this product is one year from date of receipt.
The optimal working dilution should be determined by the investigator,
Purity:
Immunogen affinity purified IgG.
Special application note:
This antibody reacts with the heavy chains on hamsterIgG and with the light chains on all hamsterimmunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin hamster serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1% (w/v) BSA, protease/IgG free and 0.05 % (w/v) sodium azide as preservative.
The optimal working dilution should be determined by end user
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Antibody purity is > 95% based on SDS-PAGE.Affinity purified using solid phase Hamster IgG .Antibody is supplied in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2. 0.05% (w/v) Sodium Azide is added as a preservative.Based on IEP, this antibody reacts with: • heavy (γ) chains on hamster IgG • light chains on all hamster immunoglobulins .Based on IEP, no reactivity is observed to: • non-immunoglobulin hamster serum immunoglobulins • human serum proteins .
For reconstitution add 1,1 ml of sterile water,Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Antibody purity is > 95% based on SDS-PAGE.Affinity purified using solid phase Hamster IgG .Antibody is supplied in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.1% (v/v) Kathon CG is added as a preservative.Based on IEP, this antibody reacts with: • heavy (γ) chains on hamster IgG • light chains on all hamster immunoglobulins .Based on IEP, no reactivity is observed to: • non-immunoglobulin hamster serum immunoglobulins • human serum proteins .
Rabbit anti-hamster IgG (H&L) is a secondary antibody conjugated to HRP, which binds tohamster IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase hamster IgG (H&L).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator,
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml. Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.1 % (v/v) Kathon CG as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on hamster IgG, light chains on all hamster immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin hamster serum proteins
Antibody purity is > 95% based on SDS-PAGE.Affinity purified using solid phase Hamster IgG .Antibody is supplied in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.05% (w/v) Sodium Azide is added as a preservative.Based on IEP, this antibody reacts with: • heavy (γ) chains on hamster IgG • light chains on all hamster immunoglobulins .Based on IEP, no reactivity is observed to: • non-immunoglobulin hamster serum immunoglobulins .
Rabbit anti-hamster IgG (H&L) - DyLight 633 Conjugated is a secondary antibody conjugated to DyLight 633, which binds to hamster IgG (H&L) in immunological assays. DyLight 633 has Amax = 638 nm, Emax = 658 nm. Antibodies are are affinity purified using solid phase hamster IgG.DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
Based on immunoelectrophoresis, this antibody reacts with: (γ) chains on hamster IgG light chains on all hamster immunoglobulins.No reactivity is observed to:non-immunoglobulin hamster serum proteins.
Application Details:
1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0,15 M Sodium Chloride, pH 7,2, 1 % (w/v) BSA, Protease/IgG free, 0,05 % (w/v) sodium azide is added as preservative
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
This antibody reacts with the heavy chains on hamsterIgG and with the light chains on all hamster immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin hamster serum proteins based on immunoelectrophoresis. Minimum cross-reactivity is observed to human serum based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free and 0.1 % (v/v) Kathon CG is used as preservative. Use of sodium azide will inhibit enzymatic activity of horseradish peroxidase.
Rabbit anti-hamster IgG (H&L) is a secondary antibody conjugated to ALP, which binds to hamster IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase hamster IgG (H&L).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Non-diluted antibody is stable for 4 years at 2-8°C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard. Shelf life is 1 year from date of receipt. Prepare working dilution prior to use and then discard.
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator,
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.50 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 30 mM triethanolamine, pH 7.2.5 mM magnesium chloride, 0.1 mM zinc chloride, 1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on hamster IgG, light chains on allhamster immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin hamster serum proteins.
Rabbit anti-hamster IgG (H&L) is a secondary antibody which binds to hamster IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase hamster IgG (H&L).
This antibody is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is > 4.5 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on hamster, IgG light chains on all hamster immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin hamster serum proteins
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Rabbit anti-guinea pig IgG (H&L) is a secondary antibody conjugated to TRITC, which binds to guinea pig IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase guinea pig IgG (H&L). Tetramethylrhodamine-5-isothiocyanate (TRITC) has Amax = 550 nm; Emax = 570 nm.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. The shelf life is 1 year from date of receipt. Prepare working dilution prior to use and then discard.
The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on guinea pig IgG, light chains on all guinea pig immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin guinea pig serum proteins
Rabbit anti-guinea pig IgG (H&L) is a secondary antibody conjugated to HRP, which binds to guinea pig IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase guinea pig IgG (H&L).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator,
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml. Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.1 % (v/v) Kathon CG as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on guinea pig IgG, light chains on all guinea pig immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin guinea pig serum proteins
Rabbit anti-guinea pig IgG (H&L) is a secondary antibody conjugated to FITC, which binds to guinea pig IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase guinea pig IgG (H&L). Fluorescein-5-isothiocyanate (FITC) has Amax = 494 nm; Emax = 518 nm.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. The shelf life is 1 year from date of receipt. Prepare working dilution prior to use and then discard.
The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Selected references:
Sergey Mursalimov et al. (2022) Cytomixis in wheat male meiosis: influence analysis of the substitution of chromosome 1A, 2D, 5A, or 5D, Botany Letters, DOI: 10.1080/23818107.2022.2074889
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on guinea pig IgG, light chains on all guinea pig immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin guinea pig serum proteins.
Rabbit anti-guinea pig IgG (H&L) is a secondary antibody which binds to guinea pig IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase guinea pig IgG (H&L).
This antibody is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is > 4.5 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on guinea pig, IgG light chains on all guinea pig immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin guinea pig serum proteins
Affinity purified using solid phase Guinea Pig IgG
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Guinea Pig IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on guinea pig IgG · light chains on all guinea pig immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin guinea pig serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Guinea Pig IgG
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Guinea Pig IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on guinea pig IgG · light chains on all guinea pig immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin guinea pig serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Guinea Pig IgG
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Guinea Pig IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on guinea pig IgG · light chains on all guinea pig immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin guinea pig serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Guinea Pig IgG
Purity:
> 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Guinea Pig IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on guinea pig IgG · light chains on all guinea pig immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin guinea pig serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Rabbit anti-goat IgG (H&L), Rhodamine (TRITC- tetramethylrhodamine-5-isothiocyanate) conjugated, is a secondary antibody which binds to goat IgGs in immunological assays. TRITC has Amax = 550 nm Emax = 570 nm. Antibodies are adsorbed against human,mouse,rat IgG and affinity purified using solid phase goat IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store at 2-8°C. Shelf life of this product is one year from date of receipt.
The optimal working dilution should be determined by the investigator,
Purity:
Immunogen affinity purified IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
This antibody reacts with the heavy chains on goat IgG and with the light chains on all goat immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin goat serum proteins or IgG from human, mouse or rat based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free and 0.1 % (v/v) Kathon CG is used as preservative.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG (H&L), is a Rhodamine (TRITC) conjugated secondary antibody which binds to goat IgG (H&L) in immunological assays. Rhodamine - Tetramethylrhodamine-5-isothiocyanate (TRITC) has Amax = 550 nm, Emax = 570 nm. Antibodies are affinity purified using solid phase goat IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
The optimal working dilution should be determined by the investigator, (ICC), immunohistochemistry ( IHC) (Flow cyt)
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
This antibody reacts with the heavy chains on goat IgG and with the light chains on all goat immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin goat serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1% (w/v) BSA, protease/IgG free and 0.05 % (w/v) sodium azide as preservative.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG is a secondary antibody conjugated to HRP (horse radish peroxidase) which binds to all goat immunoglobulins in immunological assays.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store lyophilized material at 2-8°C. For storage at -20 °C after reconstitution dilute antibody solution with an equal volume of glycerol to obtain final glycerol concentration of 50 % to prevent loss of enzymatic activity. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
Host Animal:
Rabbit
Species Reactivity:
Goat IgG heavy and light chains (H&L)
Expected Species:
Goat IgG Heavy and Light chains (H&L)
Immunogen:
purified goat IgG, whole molecule
Applications:
ELISA (ELISA), Immunohistochemistry (IHC), Western blot (WB)
No reactivity is observed to non-immunoglobulin goat serum proteins based in immunoelectrophoresis.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
No confirmed exceptions from predicted reactivity are currently known
Special application note:
HRP-conjugate is supplied in 10 mM Sodium Phosphate, 0,15 M Sodium Chloride, pH 7,2, 10 % (w/v) BSA, Protease/IgG free0,1 % (v/v) of Kathon CG is used as preservative
Rabbit anti-goat IgG is a secondary antibody conjugated to HRP which binds to goat IgGs in immunological assays.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
Host Animal:
Rabbit
Species Reactivity:
Goat IgG heavy chains and light chains on all Goat immunoglobulins
Expected Species:
Goat IgG Heavy chains and Light chains on all Goat immunoglobulins
Immunogen:
Purified Goat IgG, whole molecule
Applications:
ELISA (ELISA) , Immunohistochemistry (IHC), Western blot (WB)
No reactivity is observed to non-immunoglobulin goat serum proteins. No reactivity is observed to serum from human, mouse and rat based on immunoelecrophoresis.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
HRP-conjugate is supplied in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 10 % (w/v) BSA, Protease/IgG free0.1 % (v/v) of Kathon CG is used as preservative.
Rabbit anti-goat IgG is a secondary antibody conjugated to HRP (horse radish peroxidase) which binds to all goat immunoglobulins in immunological assays.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
Host Animal:
Rabbit
Species Reactivity:
Goat IgG heavy and light chains on all goat immunoglobulins
Immunogen:
Purified goat IgG, whole molecule
Applications:
ELISA (ELISA), Immunohistochemistry (IHC), Western blot (WB)
For blocking BSA and non-fat milk is recommended to be replaced by other blocking reagents, like donkey serum or commercial formulations which are free from bovine IgG.
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Centrifuge to remove any particulates, Prepare fresh working dilutions daily
Not reactive in:
Non-immunoglobulin goat serum proteins based in immunoelectrophoresis
Selected references:
Sinclair et al. (2017) Etiolated Seedling Development Requires Repression of Photomorphogenesis by a Small Cell-Wall-Derived Dark Signal. Curr Biol. 2017 Nov 20;27(22):3403-3418.e7. doi: 10.1016/j.cub.2017.09.063.
Special application note:
Concentration: 1.0 mg/mlHRP-conjugate is supplied in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 10 % (w/v) BSA, Protease/IgG free with 0.1 % (v/v) of ProClin 150 as preservative.
Rabbit anti-goat IgG (H&L), FITC (fluorescein-5-isothiocyanate) conjugated, is a secondary antibody which binds to goat IgGs in immunological assays. Amax = 494 nm, Emax = 518 nm.Fluor to protein ratio is 3-7 moles FITC per mole antibody. Antibodies are adsorbed against human,mouse,rat IgG and affinity purified using solid phase goat IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. Shelf life of this product is one year from date of receipt.
This antibody reacts with the heavy chains on goat IgG and with the light chains on all goat immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin goat serum proteins or IgG from human, mouse or rat based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free and 0.1 % (v/v) Kathon CG is used as preservative.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG (H&L), FITC (fluorescein-5-isothiocyanate) conjugated is a secondary antibody which binds to goat IgGs in immunological assays. FITC has Amax = 494 nm, Emax = 518 nm.Fluor to protein ratio is 3-7 moles FITC per mole antibody. Antibodies are affinity purified using solid phase goat IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. Shelf life of this product is one year from date of receipt.
This antibody reacts with the heavy chains on goat IgG and with the light chains on all goat immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin goat serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1% (w/v) BSA, protease/IgG free and 0.05 % (w/v) sodium azide as preservative.BSA and milk have to be replaced by other blocking reagents, like donkey serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG (H&L) is a HRP conjugated F(ab)'2 fragment of a secondary antibody which reactis with all goat IgGs in immunological assays. Antibody is adsorbed against human,mouse and rat IgG. Its purity is > 90% based on SDS-PAGE. Antibody solution may contain small amounts of intact IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
For reconstitution add 0,55 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
This antibody reacts with the heavy chains on goat IgG and with the light chains on all goat immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin goat serum proteins or IgG from human, mouse or rat based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 10 % (w/v) BSA, Protease/IgG free and 0.1 % (v/v) Kathon CG is used as preservative. Use of sodium azide will inhibit enzymatic activity of horseradish peroxidase.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG (H&L),HRP conjugated is a F(ab)'2 fragment of a secondary antibody which binds to all goat IgGs in immunological assays. Antibody purity is > 90% based on SDS-PAGE. Antibody solution may contain small amounts of intact IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 0.5 mg of antibody in 0.55 ml of sterile water add 0.55 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
Host Animal:
Rabbit
Applications:
ELISA (ELISA) , Immunohistochemistry (IHC), Western blot (WB)
For reconstitution add 0,55 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
This antibody reacts with the heavy chains on goat IgG and with the light chains on all goat immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin goat serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free and 0.1 % (v/v) Kathon CG is used as preservative.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG (H&L) is a secondary antibody F(ab)'2 fragment, which binds to all goat IgGs in immunological assays and is FITC (fluorescein-5-isothiocyanate) conjugated. Antibody is also specially adsorbed against human,mouse and rat IgG. FITC Amax = 494 nm, Emax = 518 nm.Fluor to protein ratio is 3-7 moles FITC per mole antibody. Antibody purity is > 90% based on SDS-PAGE, may contain small amounts of intact IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. Shelf life of this product is one year from date of receipt.
This antibody reacts with the heavy chains on goat IgG and with the light chains on all goat immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin goat serum proteins or IgG from human, mouse or rat based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7, 1% (w/v) BSA, Protease/IgG free , 0.05 % (w/v) sodium azide as preservative. BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG (H&L), F(ab)'2 fragment, DyLight 800 Conjugated is a secondary antibody conjugated to DyLight 800, which binds to Goat IgG (H&L), F(ab)'2 fragment in immunological assays.DyLight 800 has Amax = 777 nm, Emax = 794 nm. Antibodies are purified using solid phase Goat IgG (H&L)DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 0,5 mg of antibody in 0,55 ml of sterile water add 0,55 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
For reconstitution add 0,55 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.05 % (w/v) sodium azide is added as preservative.Based on immunoelectrophoresis, this antibody reacts with: heavy (γ) chains on goat IgG, light chains on all goat immunoglobulinsNo reactivity is observed to: non-immunoglobulin goat serum proteins.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG (H&L), F(ab)'2 fragment is a biotinylated secondary antibody which binds to goat IgG (H&L), F(ab)'2 fragment Antibody purity is > 90% based on SDS-PAGE. Antibody solution may contain small amounts of intact IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. Shelf life of this product is one year from date of receipt.
This antibody reacts with the heavy chains on goat IgG and with the light chains on all goat immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin goat serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free and 0.1 % (v/v) Kathon CG is used as preservative. Use of sodium azide will inhibit enzymatic activity of horseradish peroxidase.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG (H&L) is a F(ab)'2 fragment, of unconjugated, affinity purified secondary antibody which binds all goat IgGs in immunological assays. Antibody is adsorbed against human,mouse,rat IgG and its purity is > 90% based on SDS-PAGE. Antibody solution may contain small amounts of intact IgG.
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified IgG.
Special application note:
This antibody reacts with the heavy chains on goat IgG and with the light chains on all goat immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin goat serum proteins or IgG from human, mouse or rat based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7, 0.05 % (w/v) sodium azide as preservative. BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG (H&L) F(ab)'2 fragment is an unconjugated secondary antibody which is reacting with goat IgG (H&L) F(ab)'2 in immunological assays and is affinity purified. Antibody purity is > 90% based on SDS-PAGE. Antibody solution may contain small amounts of intact IgG.
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
This antibody reacts with the heavy chains on goat IgG and with the light chains on all goat immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin goat serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7, 0.05 % (w/v) sodium azide as preservative. BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 0.55 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 0.55 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Rabbit anti-goat IgG (H&L), DyLight 800 Conjugated, min. cross-reactivity to human, mouse, rat lgG is a secondary antibody conjugated to DyLight 800, which binds to Goat IgG (H&L) in immunological assays.DyLight 800 has Amax = 777 nm, Emax = 794 nm. Antibodies are purified using solid phase Goat IgG (H&L)DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.05 % (w/v) sodium azide is added as preservative.Based on immunoelectrophoresis, this antibody reacts with: heavy (γ) chains on goat IgG, light chains on all goat immunoglobulinsNo reactivity is observed to: non-immunoglobulin goat serum proteins, IgG from human, mouse, or rat
Rabbit anti-goat IgG (H&L), DyLight 800 Conjugated is a secondary antibody conjugated to DyLight 800, which binds to Goat IgG (H&L) in immunological assays.DyLight 800 has Amax = 777 nm, Emax = 794 nm. Antibodies are purified using solid phase Goat IgG (H&L)DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.05 % (w/v) sodium azide is added as preservative.Based on immunoelectrophoresis, this antibody reacts with: heavy (��) chains on goat IgG, light chains on all goat immunoglobulinsNo reactivity is observed to: non-immunoglobulin goat serum proteins.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG (H&L) - DyLight 650 Conjugated is a secondary antibody conjugated to DyLight 650, which binds to Goat IgG (H&L) in immunological assays.DyLight 650 has Amax = 652 nm, Emax = 672 nm. Antibodies are are affinity purified using solid phase goat IgG (H&L).DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.05 % (w/v) sodium azide is added as preservative.Based on immunoelectrophoresis, this antibody reacts with: heavy (γ) chains on goat IgG light chains on all goat immunoglobulinsNo reactivity is observed to: non-immunoglobulin goat serum proteins.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG (H&L) , DyLight 594 Conjugate is a secondary antibody conjugated to DyLight 594, which binds to all goat IgGs in immunological assays. DyLight 550 has Amax = 593 nm, Emax = 618 nm. Antibodies are are affinity purified using solid phase goat IgG.DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
Based on immunoelectrophoresis, this antibody reacts with: heavy (γ) chains on goat IgG light chains on all goat immunoglobulins.No reactivity is observed to: non-immunoglobulin goat serum proteins.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Application Details:
1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0,15 M Sodium Chloride, pH 7,2, 1 % (w/v) BSA, Protease/IgG free, 0,05 % (w/v) sodium azide is added as preservative
Rabbit anti-goat IgG (H&L) - DyLight 550 Conjugated, min cross reactivity to human, mouse, rat lgG is a secondary antibody conjugated to DyLight 550, which binds to all goat IgGs in immunological assays. DyLight 550 has Amax = 562 nm, Emax = 576 nm. Antibodies are are affinity purified using solid phase goat IgG.DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
Based on immunoelectrophoresis, this antibody reacts with: heavy (γ) chains on goat IgG light chains on all goat immunoglobulin.No reactivity is observed to: non-immunoglobulin goat serum proteins IgG from human, mouse, or rat.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Application Details:
1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0,15 M Sodium Chloride, pH 7,2, 1 % (w/v) BSA, Protease/IgG free, 0,05 % (w/v) sodium azide is added as preservative
Rabbit anti-Goat IgG (H&L), DyLight 550 conjugated is a secondary antibody conjugated to DyLight 550, which binds to Goat IgG (H&L) in immunological assays.DyLight 550 has Amax = 562 nm, Emax = 576 nm. Antibodies are purified using solid phase Goat IgG (H&L)DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
For reconstitution add 1,1 ml of sterile water,Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Antibody purity is > 95% based on SDS-PAGE.Affinity purified using solid phase Goat IgG .Antibody is supplied in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.05% (w/v) Sodium Azide is added as a preservative.Based on IEP, this antibody reacts with: • heavy (γ) chains on goat IgG • light chains on all goat immunoglobulins .Based on IEP, no reactivity is observed to: • non-immunoglobulin goat serum immunoglobulins .
Rabbit anti-Goat IgG (H&L), DyLight 488 conjugated, min. cross-reactivity to human, mouse, rat lgG is a secondary antibody conjugated to DyLight 488, which binds to Goat IgG (H&L) in immunological assays.DyLight 488 has Amax = 493 nm, Emax = 518 nm. Antibodies are purified using solid phase Goat IgG (H&L)DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries
For reconstitution add 1,1 ml of sterile water,Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Antibody purity is > 95% based on SDS-PAGE.Affinity purified using solid phase Goat IgG .Antibody is supplied in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.05% (w/v) Sodium Azide is added as a preservative.Based on IEP, this antibody reacts with: • heavy (γ) chains on goat IgG • light chains on all goat immunoglobulins .Based on IEP, no reactivity is observed to: • non-immunoglobulin goat serum immunoglobulins • IgG from human, mouse or rat .
Rabbit anti-goat IgG (H&L), DyLight 488 Conjugated is a secondary antibody conjugated to DyLight 488, which binds to Goat IgG (H&L) in immunological assays.DyLight 488 has Amax = 493 nm, Emax = 518 nm. Antibodies are purified using solid phase Goat IgG (H&L)DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. Product is stable for 4 weeks at 2-8°Cafter rehydration. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C, If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Application Details:
1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Conjugate is present in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.05 % (w/v) sodium azide is added as preservative.Based on immunoelectrophoresis, this antibody reacts with:, heavy (γ) chains on goat IgG, light chains on all goat immunoglobulinsNo reactivity is observed to: non-immunoglobulin goat serum proteins, IgG from human, mouse, or rat
Rabbit anti-goat IgG (H&L), DyLight 350 Conjugated is a secondary antibody conjugated to DyLight 350, which binds to Goat IgG (H&L) in immunological assays.DyLight 350 has Amax = 353 nm, Emax = 432 nm. Antibodies are purified using solid phase Goat IgG (H&L)DyLight is a registered trade mark of Thermofisher Inc., and its subsidaries.
For reconstitution add 1,1 ml of sterile water,Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Antibody purity is > 95% based on SDS-PAGE.Affinity purified using solid phase Goat IgG .Antibody is supplied in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.05% (w/v) Sodium Azide is added as a preservative.Based on IEP, this antibody reacts with: • heavy (γ) chains on goat IgG • light chains on all goat immunoglobulins .Based on IEP, no reactivity is observed to: • non-immunoglobulin goat serum immunoglobulins .
No reactivity is observed to non-immunoglobulin goat serum proteins based in immunoelectrophoresis.No reactivity is observed to human, mouse and rat IgG based on immunoelectrophoresis.
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Biotin conjugate is supplied in 10 mM Sodium Phosphate, 0,15 M Sodium Chloride, pH 7,2, 1 % (w/v) BSA, Protease/IgG free, Contains 0,05 % (w/v) sodium azide as preservativeAntibody binds to heavy chains of goat IgG and light chains of all goat immunoglobulins based on immunoelectrophoresis,?BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG
Rabbit anti-goat IgG is a secondary antibody conjugated to ALP (Alkaline phosphatase) which binds to all donkey immunoglobulins in immunological assays.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Non-diluted antibody is stable for 4 years at 2-8°C. For storage at -20 °C dilute antibody solution with an equal volume of glycerol to obtain final glycerol concentration of 50 % to prevent loss of enzymatic activity. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
Host Animal:
Rabbit
Species Reactivity:
Goat IgG heavy and light chains (H&L)
Expected Species:
Goat IgG Heavy and Light chains (H&L)
Immunogen:
Purified Goat IgG, whole molecule
Applications:
ELISA (ELISA) , Immunocytochemistry (ICC), Immunohistochemistry (IHC), Western blot (WB)
No reactivity is observed to non-immunoglobulin goat serum proteins based or IgG from human, mouse or rat based on immunoelectrophoresis.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
No confirmed exceptions from predicted reactivity are currently known
Special application note:
APL conjugate is supplied in 30 mM Triethanolamine, pH 7,2, 5 mM Magnesium Chloride, 0,1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free, 0,05 % (w/v) of sodium azide is added as preservative
Rabbit anti-goat IgG is a secondary antibody conjugated to ALP (Alkaline phosphatase) which binds to all goat immunoglobulins in immunological assays.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Non-diluted antibody is stable for 4 years at 2-8°C. For storage at -20 °C dilute antibody solution with an equal volume of glycerol to obtain final glycerol concentration of 50 % to prevent loss of enzymatic activity. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
Host Animal:
Rabbit
Species Reactivity:
Goat IgG heavy and light chains (H&L)
Expected Species:
Goat IgG Heavy and Light chains (H&L)
Immunogen:
Purified Goat IgG, whole molecule
Applications:
ELISA (ELISA) , Immunocytochemistry (ICC), Immunohistochemistry (IHC), Western blot (WB)
No reactivity is observed to non-immunoglobulin goat serum proteins based in immunoelectrophoresis. BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
No confirmed exceptions from predicted reactivity are currently known
Special application note:
ALP conjugate is supplied in 30 mM Triethanolamine, pH 7,2, 5 mM Magnesium Chloride, 0,1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free, 0,05 % (w/v) of sodium azide is added as preservative
Rabbit anti-goat IgG (H&L), affinity purified, is an unconjugated secondary antibody which binds to all goat IgGs in immunological assays. Antibody is adsorbed against human,mouse,rat IgG and affinity purified using solid phase goat IgG.
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified IgG.
Special application note:
This antibody reacts with the heavy chains on goat IgG and with the light chains on all goat immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin goat serum proteins or IgG from human, mouse or rat based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 0.05 % (w/v) sodium azide as preservative. BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.Expiration date: November 6, 2017
Rabbit anti-goat IgG (H&L), affinity purified is a secondary antibody which binds to goat IgGs in immunological assays. Antibodies are affinity purified using solid phase goat IgG.
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified IgG.
Special application note:
This antibody reacts with the heavy chains on goat IgG and with the light chains on all goat immunoglobulins based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin goat serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7, 0.05 % (w/v) sodium azide as preservative. BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 0.55 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to:<br>ââ¬Ã¢ non-immunoglobulin goat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Rabbit anti-goat IgG Fc, Rhodamine (TRITC-tetramethylrhodamine-5-isothiocyanate) conjugated, is a secondary antibody which binds to goat IgG Fc constant part in immunological assays. TRITC has Amax = 550 nm, Emax = 570 nm. Antibodies are affinity purified on solid phase goat IgG Fc.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. Shelf life of this product is one year from date of receipt.
The optimal working dilution should be determined by the investigator,
Purity:
Immunogen affinity purified IgG.
Special application note:
This antibody reacts with the heavy chains on goat IgG based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin goat serum proteins or immunoglobulin light chains based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1% (w/v) BSA, protease/IgG free and 0.05 % (w/v) sodium azide as preservative.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG Fc,HRP conjugated, is a secondary antibody which binds to goat IgG Fc constant part in immunological assays. Antibodies are adsorbed against human serum and affinity purified using solid phase goat IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
This antibody reacts with the heavy chains on goat IgG based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin goat serum proteins or immunoglobulin light chains based on immunoelectrophoresis.Minimum cross-reactivity is observed with human serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free and 0.1 % (v/v) Kathon CG is used as preservative.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG Fc is a secondary antibody to goat Fc part conjugated to HRP. Antibodies are affinity purified using solid phase goat IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
This antibody reacts with the heavy chains on goat IgG based on immunoelectrophoresis.Minimum cross-reactivity is observed to the light chains or to non-immunoglobulin goat serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free and 0.1 % (v/v) Kathon CG is used as preservative. Use of sodium azide will inhibit enzymatic activity of horseradish peroxidase.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG Fc, biotin conjugated, is a secondary antibody which binds to goat IgG Fc part in immunological assays. Antibody is adsorbed against human serum and affinity purified using solid phase goat IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. Shelf life of this product is one year from date of receipt.
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified IgG.
Special application note:
This antibody reacts with the heavy chains on goat IgG based on immunoelectrophoresis.Minimum cross-reactivity is observed with the light chains on goat immunoglobulins or to non-immunoglobulin goat serum proteins based on immunoelectrophoresis. Minimum cross-reactivity is observed with human serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free and 0.1 % (v/v) Kathon CG is used as preservative.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG Fc, biotin conjugated is a secondary antibody which binds to goat IgG Fc constant part in immunological assays. Antibodies are affinity purified using solid phase goat IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. Shelf life of this product is one year from date of receipt.
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified IgG.
Special application note:
This antibody reacts with the heavy chains on goat IgG based on immunoelectrophoresis.Minimum cross-reactivity is observed with the light chains on goat immunoglobulins or to non-immunoglobulin goat serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free and and 0.05 % (w/v) sodium azide as preservative.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG Fc, alkaline phosphatase (ALP) conjugated is a secondary antibody which binds to goat IgG Fc part in immunological assays. Antibodies are adsorbed against human serum and affinity purified using solid phase goat IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Non-diluted antibody is stable for 4 years at 2-8°C. For storage at -20 °C dilute antibody solution with an equal volume of glycerol to obtain final glycerol concentration of 50 % to prevent loss of enzymatic activity. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
This antibody reacts with the heavy chains on goat IgG based on immunoelectrophoresis.Minimum cross-reactivity is observed to the light chains or to non-immunoglobulin goat serum proteins based on immunoelectrophoresis. Minimum cross-reactivity is observed to human serum proteins based on immunoelectrophoresis.Antibody is supplied in 30 mM triethanolamine, pH 7.2, 5 mM magnesium chloride, 0.1 mM zinc chloride, 1 % (w/v) BSA, Protease/IgG free , 0.05 % (w/v) sodium azide as preservative.BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Rabbit anti-goat IgG Fc, affinity purified, is a secondary antibody which binds to goat IgG Fc constant part in immunological assays. Antibodies are adsorbed against human serum and are affinity purified using solid phase goat IgG.
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified IgG.
Special application note:
This antibody reacts with the heavy chains on goat IgG based on immunoelectrophoresis.Minimum cross-reactivity is observed to non-immunoglobulin goat serum proteins or immunoglobulin light chains based on immunoelectrophoresis. Minimum cross-reactivity is observed with human serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7, 0.05 % (w/v) sodium azide as preservative. BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
This antibody reacts with the heavy chains on goat IgG based on immunoelectrophoresis.Minimum cross-reactivity is observed to the light chains or to non- immunoglobulin goat serum proteins based on immunoelectrophoresis.Antibody is supplied in 10 mM sodium phosphate, 150 mM sodium chloride, pH 7, 0.05 % (w/v) sodium azide as preservative. BSA and milk have to be replaced by other blocking reagents, like doneky serum or commercial formulations which are free from bovine IgG.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · Goat IgG F(ab)'2 fragment
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · goat IgG, F(ab)2 fragment · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · goat IgG, F(ab)2 fragment · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · Goat IgG F(ab)'2 fragment
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · goat IgG, F(ab)2 fragment · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · Goat IgG F(ab)'2 fragment
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · goat IgG, F(ab)2 fragment · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · Goat IgG F(ab)'2 fragment
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Glucose transporter 1 (or GLUT1), also known as solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1) protein is coded by the SLC2A1 gene on chromosome 1p34.2. GLUT1 facilitates the transport of glucose across the plasma membranes of cells. Glut1 is also a receptor for vitamin C uptake and the human T-cell leukemia virus (HTLV) I and II. GLUT1 expression occurs in almost all tissues. The level of GLUT1 expression parallels the rate of cellular glucose metabolism. It is particularly high in erythrocytes and in endothelial cells of the bloodbrain barrier. GLUT1 is often overexpressed in cancer because many tumors exert a metabolic switch from oxidative phosphorylation to glycolysis which requires an elevated uptake of glucose. In cancer GLUT1 represents a potential therapeutic target for GLUT1 inhibitors such as Bay-876. In normal tissues, the strongest GLUT1 immunostaining is seen in amnion, chorion, and trophoblast cells of the placenta. GLUT1 staining is also strong in all erythrocytes and their precursor cells. GLUT1 staining of endothelial cells is depending on the location and tissue type. It is strongest in the brain. An at least weak to moderate staining is seen in squamous epithelium and urothelium as well as in dendritic cells of germinal centres. Among tumors, a positive GLUT1 immunostaining is preferentially seen in squamous cell carcinomas irrespective of their origin but at least a small fraction of GLUT1 positive cases also occurs in a broad range of other tumor entities.
The antibody detects astrocytes, Schwann cells, satellite cells, enteric glial cells, and some groups of ependymal cells. This marker is mainly used to distinguish neoplasms of astrocytic origin from other neoplasms in the central nervous system.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
EP672Y
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Jessen, KR, et al. J Neurosci 1983;3:2206-2218
References 2:
Regner A et al. J Neurotrauma. 2001 Aug;18(8):783-92
References 3:
Nagashima G et al. Clin Neurol Neurosurg. 2002 May;104(2):125-31
References 4:
Choi, BH, et al. Science 1984;223:407-409
References 5:
Viale, G, et al. Virchows Arch A Pathol Anat 1991;418:339-348
GCDFP-15 is a glycoprotein localized in the apocrine metaplastic epithelium lining breast cysts and in apocrine glands in the axilla, vulva, eyelid, ear canal, and in salivary glands. GCDFP-15 positivity is seen in breast carcinomas. On the other hand, colorectal carcinomas, lung carcinoma, mesotheliomas rarely stain with this antibody. Because of its specificity for breast carcinoma, this antibody is often helpful in distinguishing metastasis of unknown primary.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
EP1582Y
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Mazoujian G, et al. Am J Pathol. 1983; 110:105-12
References 2:
Liegl B, et al. Histopathology. 2007; 50:439-47
References 3:
Bhargava R, et al. Am J Clin Pathol. 2007; 127:103-13
References 4:
Tornos C, et al. Am J Surg Pathol. 2005; 29:1482-9
References 5:
Takeda Y, et al. Arch Pathol Lab Med. 2008; 132:239-43
Factor XIIIa has been identified in platelets, megakaryocytes, and fibroblast-like mesenchymal or histiocytic cells in the placenta, uterus, and prostate, monocytes and macrophages and dermal dendritic cells. Anti- Factor XIIIa has been found to be useful in differentiating between dermatofibroma (almost all cases +), dermatofibrosarcoma protuberans (-/+) and desmoplastic malignant melanoma. Anti-factor XIIIa positivity is also seen in capillary hemagioblastoma, hemangioendothelioma, hemangiopericytoma, xanthogranuloma, xanthoma, hepatocellular carcinoma, glomus tumor, and meningioma.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
EP3372
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Nemes Z, Hum Pathol 1992 Jul; 23(7):805-10
References 2:
Horenstein MG et al. Am J Surg Pathol. 2000 Jul;24(7):996-1003
References 3:
Kraus MD et al. Am J Dermatopathol. 2001 Apr;23(2):104-11
References 4:
Abenoza P, et al. Am J Dermatopathol. 1993; 15:429-34
References 5:
Anstey A, Cerio R, et al.: Am J Dermatopathol 1994 Feb: 16(1):14-22
Anti-Factor VIII-Related Antigen antibody reacts with endothelial cells and neoplastic blood cells. This antibody has helped to establish the endothelial nature of some lesions of disputed histogenesis, e.g. Kaposis sarcoma and cardiac myxoma. Not all endothelial cells synthesize (or store) this molecule; therefore, it should not be surprising that not all tumors of endothelial differentiation (benign or malignant) react with this antigen.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Nichols GE, et al. Am J Clin Pathol. 1992; 97:770-5
References 2:
Falk S, et al. Am J Surg Pathol. 1993; 17:959-70
References 3:
Meis-Kindblom JM, et al. Am J Surg Pathol. 1998; 22:683-97
References 4:
Allison KH, et al. Am J Surg Pathol. 2004; 28:298-307
References 5:
Peyvandi F, et al. Blood Transfus. 2011; 9 Suppl 2:s3-8
Recognizes a protein of 67kDa, which is identified as estrogen receptor (ER) alpha. The ER gene consists of more than 140kb of genomic DNA divided into 8 exons, being translated into a protein with six functionally discrete domains, labeled A through F. This antibody strongly stains the nucleus of epithelial cells in breast carcinomas. The ER is an important regulator of growth and differentiation in the mammary gland. Presence of ER in breast tumors indicates an increased likelihood of response to antiestrogen (e.g. tamoxifen) therapy. Pretreatment: Heat induced epitope retrieval in 10 mM citrate buffer, pH6.0, or in 50 mM Tris buffer pH9.5, for 20 minutes is required for IHC staining on formalin-fixed, paraffin embedded tissue sections. Note: Dilution of the antibody in 10% normal goat serum followed by a goat anti-rabbit secondary antibody-based detection is recommended. Control tissue Breast carcinoma. Staining nuclear.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
ZR2
Concentration:
n/a
Format:
Concentrate
Storage buffer:
Tissue culture supernatant with 0.2% BSA and 15mM sodium azide
E-cadherin is an adhesion protein that is expressed in cells of epithelial lineage. Anti-E-cadherin stains positively in glandular epithelium as well as adenocarcinomas of the lung, gastrointestinal tract and ovary. Another application involves the differentiation of ductal (which is membrane staining) vs. lobular cancer of the breast (which is cytoplasmic staining). It has also been shown to be positive in some thyroid carcinomas. A combination of E-cadherin and p120 catenin helps distinguish ductal carcinoma of the breast from lobular carcinoma.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
EP700Y
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Han AC, et al. Hum Pathol. 1997; 28:641-5
References 2:
Simsir A, et al. Diagn Cytopathol. 1999; 20:125-30
References 3:
Abutaily AS, et al. J Clin Pathol. 2002; 55:662-8
References 4:
Acs G, et al. Am J Clin Pathol. 2001; 115:85-98
References 5:
Dabbs DJ, et al. Am J Surg Pathol. 2007; 31:427-37
DOG1 is a calcium-dependent chloride channel protein that is encoded by a gene called TMEM16A (TMEM16 FLJ10261, ANO1, ORAOV2, and AOS2) located on chromosome 11q13. DOG1 has many significant functions such as regulation of the cholinergic activity of gastrointestinal smooth muscle 2 and regulation of both the survival and proliferation of cells. Anti-DOG1 antibody has been shown to be useful in the identification of gastrointestinal stromal tumors (GIST).
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
SP31
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Kang HG, et al. Mod Pathol. 2011; 24:866-77
References 2:
Rizzo FM, et al. BMC Cancer. 2016; 16:87
References 3:
Katoh M, et al.Int J Oncol. 2003; 22:1375-81
References 4:
Stanich JE, et al. Am J Physiol Gastrointest Liver Physiol. 2011; 1044-51
Cytokeratin 5 is an intermediate filament protein of 58 kD amongst the cytokeratin family. It is a type II (basic) cytokeratin. Antibodies to this protein identify basal cells of squamous and glandular epithelia, myoepithelia, and mesothelium.1 Cytokeratin 14 is a 50 kD polypeptide found in basal cells of squamous epithelia, some glandular epithelia, myoepithelium, and mesothelial cells.1 Anti-cytokeratin 5 has been useful in the differential diagnosis of metastatic carcinoma in the pleura versus epithelial mesothelioma.2 Anti-cytokeratin 14 has been demonstrated to be useful in differentiating squamous cell carcinomas from other epithelial tumors.3,4 Anti-Cytokeratin 5, along with anti-cytokeratin 14, has been found to have an application in identifying the basal-like phenotype of breast carcinoma.5
Antibody Isotype:
IgG /IgG3
Monosan Range:
MONOSAN Ready To Use
Clone:
EP1601Y & LL002
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Dabbs DJ. Elsevier Saunders, 2014. Print. P. 212
References 2:
Comin CE, et al. Am J Surg Pathol. 2007; 31:1139-48
References 3:
Reis-Filho JS, et al. Appl Immunohistochem Mol Morphol. 2003; 11:1-8
Cytokeratin 5 is an intermediate filament protein of 58 kD molecular weight within the cytokeratin family. It is a type II (basic) cytokeratin. Antibodies to this protein identify basal cells of squamous and glandular epithelia, myoepithelia, and mesothelium. Anti-cytokeratin 5 has been reported useful in the differential diagnosis of metastatic carcinoma in the pleura versus epithelioid mesothelioma. Epithelioid mesotheliomas are strongly positive in almost all cases, but a minority of pulmonary adenocarcinomas will show focal immunoreactivity. Almost all squamous cell carcinomas, half of transitional carcinomas, and many undifferentiated large cell carcinomas immunostain with anti-CK 5. Anti-CK 5, along with antip63, affords a high sensitivity and specificity for squamous differentiation. Myoepithelial cells of the breast, glandular epithelia, and basal cells of the prostate are labeled with anti-CK. This antibody, along with anti-CK 14, has found application in identifying basal-like breast carcinoma.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
EP1601Y
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Ordonez NG. Human Pathology. 2007; 38:116
References 2:
Kargi A, et al. Appl Immunohistochem Mol Morphol.; 15:415420 (2007)
Cyclooxygenase 2 (COX-2) is an essential enzyme involved not only in the mediation of inflammation but also carcinogenesis. Increased expression of COX-2 has been shown in carcinomas of many organ systems including stomach, colorectum, breast and lung.
Antibody Isotype:
IgG-1
Monosan Range:
MONOSAN Ready To Use
Clone:
SP21
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
The oncogenic transcription factor, c-MYC, has a crucial role in growth control, differentiation, cellular metabolism and apoptosis and is associated with variety of tumors. MON 3393 stains this protein in tissues from colorectal adenocarcinoma, breast invasive ductal carcinoma, prostate adenocarcinoma, Burkitt lymphoma, and diffused large B-cell lymphoma.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EP121
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Rabbit anti-chicken IgG/Y (H&L) is a secondary antibody conjugated to TRITC , which binds to chicken IgG/Y (H&L) in immunological assays. Antibody is affinity purified using solid phase chicken IgG/Y. Tetramethylrhodamine-5-isothiocyanate (TRITC) has Amax = 550 nm; Emax = 570 nm.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1,1 ml of sterile water add 1,1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Prepare fresh working dilutions daily
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on chicken IgG (IgY), light chains on all chicken immunoglobulins Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin chicken serum proteins
Rabbit anti-chicken IgG/Y (H&L) is a secondary antibody conjugated to HRP, which binds to in immunological assays. Antibody is affinity purified using solid phase chicken IgG/Y.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store lyophilized material at 2-8°C. For storage at -20 °C after reconstitution dilute antibody solution with an equal volume of glycerol to obtain final glycerol concentration of 50 % to prevent loss of enzymatic activity. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard, Be sure to mix well but without foaming.
This conjugate is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 500-1 : 5 000 (IHC), 1 : 200-1 : 5000 (WB)
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml. Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.1 % (v/v) Kathon CG as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on chicken IgG (IgY), light chains on all chicken immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin chicken serum proteins
Rabbit anti-chicken IgY (H&L) is a secondary antibody conjugated to HRP, which binds to in immunological assays. Antibody is affinity purified using solid phase chicken IgY.Chicken egg yolk immunoglobulin (IgY) has been also called chicken IgG.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C.For long time storage after reconstitution, dilute the antibody solution with glycerol to a final concentration of 50% glycerol and store as liquid at -20 °C, to prevent loss of enzymatic activity. For example, if you have reconstituted 1 mg of antibody in 1.1 ml of sterile water add 1.1 ml of glycerol. Such solution will not freeze in -20 °C. If you are using a 1:5000 dilution prior to diluting with glycerol, then you would need to use a 1:2500 dilution after adding glycerol. Prepare working dilution prior to use and then discard. Be sure to mix well but without foaming.
Host Animal:
Rabbit
Species Reactivity:
Heavy chains on chicken IgY and light chains on all chicken immunoglobulins,
Immunogen:
Purified Chicken IgY (H&L), whole molecule
Applications:
ELISA (ELISA), Immunohistochemistry (IHC), Western blot (WB)
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Reconstitution:
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Centrifuge to remove any particulates, Prepare fresh working dilutions daily
Not reactive in:
Non-immunoglobulin chicken serum proteins
Selected references:
Li et al. (2022), The effects of Ni availability on H2 production and N2 fixation in a model unicellular diazotroph: The expression of hydrogenase and nitrogenase. Limnol Oceanogr, 67: 1566-1576. https://doi.org/10.1002/lno.12151Panayiotou et al. (2018). Viperin restricts Zika virus and tick-borne encephalitis virus replication by targeting NS3 for proteasomal degradation.J Virol. 2018 Jan 10. pii: JVI.02054-17. doi: 10.1128/JVI.02054-17.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml. Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.1 % (v/v) Kathon CG as preservative of bacterial growth.
Rabbit anti-chicken IgG/Y (H&L) is a secondary antibody conjugated to FITC, which binds to chicken IgG/Y (H&L) in immunological assays. Antibody is affinity purified using solid phase chicken IgG/Y. Fluorescein-5-isothiocyanate (FITC) has Amax = 494 nm; Emax = 518 nm.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. The shelf life is 1 year from date of receipt. Prepare working dilution prior to use and then discard.
The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on chicken IgG (IgY), light chains on all chicken immunoglobulins Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin chicken serum proteins
Rabbit anti-chicken IgG/Y (H&L) is a secondary antibody which binds to chicken IgG/Y (H&L) in immunological assays. Antibody is affinity purified using solid phase chicken IgG/Y.
This antibody is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is > 4.5 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on chicken IgG (IgY), light chains on all chicken immunoglobulins Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin chicken serum proteins
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Chicken IgG/Y, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on chicken IgG/Y · light chains on all chicken immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin chicken serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Chicken IgG/Y, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on chicken IgG/Y · light chains on all chicken immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin chicken serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Chicken IgG/Y, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on chicken IgG/Y · light chains on all chicken immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin chicken serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on chicken IgG/Y · light chains on all chicken immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin chicken serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Anti-CEA specifies a group of proteins in the Carcinoembryonic Antigen (CEA) family of proteins which are present in the epithelia of various types and tumors (both benign and malignant) derived from such epithelia. Such tissues are represented by the epithelia of colon, bronchus, alveoli, breast, pancreas, biliary tract, superficial layer and parietal layers of the stomach. Predominately biliary canaliculi are labelled in the liver and this factor is useful in the diagnosis of hepatocelluar carcinoma. Anti-CEA has been quite useful in differentiating adenocarcinoma of the lung vs. mesothelioma. Associated products: CK 5/6, Calretinin, WT-1, E-Cadherin, TTF-1, TAG-72, EMA, CK 20
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Shield PW, et al. Am J Clin Pathol. 1996; 105:157-62
References 2:
Sheahan K, et al. Am J Clin Pathol. 1990; 94:157-64
CDX-2 is a caudal-related homeobox transcription factor whose expression in the adult is normally present in the gastrointestinal (GI) epithelium. It is implicated in the development and maintenance of the intestinal mucosa. This protein is expressed immunohistochemically in the nuclei of normal GI epithelium. CDX-2 protein expression has been seen in GI carcinomas. Anti-CDX-2 has been useful to establish GI origin of metastatic adenocarcinomas and carcinoids and is especially useful to distinguish metastatic colorectal adenocarcinoma from lung adenocarcinoma. However, mucinous carcinomas of the ovary also stain positively with this antibody, which limits the usefulness of this marker in the distinction of metastatic colorectal adenocarcinoma versus mucinous carcinoma of the ovary.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
EPR2764Y
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Mazziotta RM, et al. Appl Immunohistochem Mol Morphol. 2005; 13:55-60
References 2:
Erickson LA, et al. Endocr Pathol. 2004; 15:247-52
References 3:
Saqi A, et al. Am J Clin Pathol. 2005; 123:394-404
References 4:
Saad RS, et al. Am J Clin Pathol. 2004; 122:421-7
References 5:
Kaimaktchiev V, et al. Mod Pathol. 2004; 17:1392-9
Cyclin-dependent kinase 4 (CDK4) is a member of the Ser/Thrprotein kinase family. It is a catalytic subunit of the protein kinasecomplex that is important for cellcycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D- type cyclins and CDK inhibitor p16 (INK4a). Overexpression of CDK4 has been observed in many tumor types, including oral squamous cell carcinoma and cancers of the pancreatic (endocrine tumors), lung, breast and colon. The expression of CDK4 is associated with tumor progression.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EP180
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Harbour JW, et al.: Cell 1999, 98:859-869
References 2:
Wikman H, et al.: Genes Chromosomes Cancer 2005, 42:193-199
References 3:
Poomsawat S, et al.: J Oral Pathol Med 2010, 39:793-799
References 4:
Lindberg D, et al.: Neuroendocrinology 2007, 86:112-118
CD99, as detected with a variety of antibodies, is expressed by virtually almost all Ewings sarcoma and primitive peripheral neuroectodermal tumors (ES/PNET) and demonstrates strong and diffuse membranous staining. Other tumors that may show CD99 expression include neuroendocrine carcinomas, mesenchymal chondrosarcomas, solitary fibrous tumors, synovial sarcomas, vascular tumors, small round blue cell tumors, lymphoblastic lymphoma, acute myeloid leukemia, and myeloid sarcoma.5 However, strong and diffuse membranous reactivity for CD99 favors ES/PNET over the other diagnostic considerations. The other CD99+ tumors usually show cytoplasmic and more heterogeneous staining. Therefore, when making a final diagnostic interpretation, CD99 must be considered in a panel with other antibodies.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
EPR3097Y
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Rettig WJ, et al. Lab Invest. 1992; 66:133
References 2:
Fellinger EJ, et al. Amer J Surg Pathol. 1992; 16:746
References 3:
Ambros IM, et al. Cancer. 1991; 139:317
References 4:
Khoury JD. Adv Anat Pathol. 2005; 12:212-20
References 5:
Dabbs DJ. Theranostic and Genomic Applications. 2014; 126
CD56, also known as neural cell adhesion molecule (NCAM), is a calcium-independent homophilic binding protein that belongs to a group of cell adhesion molecules including cadherins, selectins, and integrins. CD56 is involved in cellcell adhesion of neural cells during embryogenesis and is expressed on most neuroectodermally derived tissues.1-3 In normal tissue, anti-CD56 labels neurons, glia, schwann cells, NK (natural killer) cells, and a subset of T-cells.3 CD56 expression can be seen in most NK cell neoplasms, certain subtypes of T-cell lymphoma and in some plasma cell neoplasms.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
MRQ-42
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Langdon, SP et al. Cancer Research 1988; 48(21):6161-6165
References 2:
Kaufmann, O et al. Hum Pathol. 1997 Dec; 28(12): 1373-8
References 3:
Tao, J et al. Am J Surg Pathol. 2002 Jan; 26(1):111-8
References 4:
Ely, SA et al. Am J Pathol. 2002 Apr; 160(4): 1293-9
References 5:
Sumi, M et al. Leuk Lymphoma. 2003 Jan; 44(1): 201-4
CD4 is a 55 kD glycoprotein expressed on the surface of T-helper/regulatory T-cells, monocytes, macrophages, and dendritic cells. Anti-CD4 is used in the immunophenotyping of lymphoproliferative disorders.1 The majority of peripheral T-cell lymphomas are derived from the T-helper/regulatory cell subset so that most mature T-cell neoplasms are CD4+ CD8-.2 As with other T-cell antigens, CD4 may be aberrantly expressed in neoplastic T-cells so that the evaluation of such tumors requires the application of a panel of markers in order to identify tumors with CD4 aberrant expression.1-3
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
EP204
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Leong AS-Y, et al. Greenwich Medical Media Ltd. 2003
References 2:
Akiyama T, et al. Pathol Int. 2008; 58:626-34
References 3:
Garcia-Herrera A, et al. J Clin Oncol. 2008; 26:3364-71
CD4 is a 55 kD glycoprotein expressed on the surface of T-helper/regulatory T-cells, monocytes, macrophages, and dendritic cells. Anti-CD4 is used in the immune phenotyping of lymphoproliferative disorders. The majority of peripheral T-cell lymphomas are derived from the T-helper/regulatory cell subset so that most mature T-cell neoplasms are CD4+ CD8-. As with other T-cell antigens, CD4 may be aberrantly expressed in neoplastic T-cells so that the evaluation of such tumors requires the application of a panel of markers in order to identify tumors with CD4 aberrant expression.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
1F6
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Leong AS-Y, et al. Greenwich Medical Media Ltd. 2003
References 2:
Akiyama T, et al. Pathol Int. 2008; 58:626-34
References 3:
Garcia-Herrera A, et al. J Clin Oncol. 2008; 26:3364-71
CD3s immunohistochemical detection locates the cytoplasmic component of CD3 protein. Anti-CD3 is considered to be a pan-T-cell marker and reacts with an antigen present at the surface and in the cytoplasm of T lymphocytes. Anti-CD3 is widely used for the identification of immature and mature T-cell malignancies.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
MRQ-39
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Beverley PC, et al. Eur J Immunol.; 11:329-34 (1981)
References 2:
Hedvat CV, et al. Hum Pathol.; 33:968-74 (2002)
References 3:
Karube K, et al. Am J Surg Pathol.; 27:1366-74 (2003)
References 4:
Dogan A, et al. Am J Surg Pathol.; 27:903-11 (2003)
Anti-CD3 antibody has been considered the best all around T-cell marker. This antibody reacts with an antigen present in early thymocytes. The positive staining of this marker may represent a sign of early commitment to the T-cell lineage.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Beverley PC, et al. Eur J Immunol. 1981; 11:329-34
References 2:
Clevers H, et al. Eur J Immunol. 1988; 18:705-10
References 3:
Hedvat CV, et al. Hum Pathol. 2002; 33:968-74
References 4:
Karube K, et al. Am J Surg Pathol. 2003; 27:1366-74
CD21 (also known as complement receptor 2 (CR2), C3d receptor, or EBV receptor) is a 140 kDa membrane protein on B-lymphocytes to which the Epstein-Barr virus (EBV) binds during infection of these cells. The antigen is absent on T-lymphocytes, monocytes, and granulocytes. MON 3028 is useful in the identification of follicular dendritic cell matrix found in normal lymph node and tonsillar tissue. This antibody also labels follicular dendritic cell sarcomas. Anti-CD21 is valuable in differentiating follicular lymphoma with marginal zone differentiation from marginal zone lymphoma with follicular involvement. It also plays a role in distinguishing among nodular lymphocyte predominant Hodgkin lymphoma, lymphocyte-rich classic Hodgkin lymphoma, and T-cell/histiocyte-rich B-cell lymphoma in combination with other B-cell and T-cell markers. Anti-CD21 is also useful in identifying abnormal follicular dendritic cell pattern in angioimmunoblastic T-cell lymphoma and follicular T-cell lymphoma.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
EP3093
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Dillon KM et al. J Clin Pathol. 2002 Oct;55(10):791-4
CD1a is a non-polymorphic, major histocompatibility complex, class I-related cell surface glycoprotein (45 to 55 kDa) and is expressed in association with ?-microglobulin. In normal tissues, anti-CD1a reacts with cortical thymocytes, Langerhans cells, interdigitating cells, and rare antigen-presenting cells of the lymph node. CD1a positivity has also been seen in Langerhans cell histiocytosis (histiocytosis X), and a subset of pre-T lymphoblastic lymphoma/leukemia (cortical T LBL/L).
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
EP3622
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Krenacs L, et al. J Pathol. 1993; 171:99-104
References 2:
Angel CE, et al. Blood. 2009; 113:1257-67
References 3:
Emile JF, et al. Am J Surg Pathol. 1995; 19:636-41
References 4:
Stefano, AP et al. Br J Haematol. 1999; 105:394-401
CD14 is a 55kDa glycosyl-phosphatidylinositol-linked membrane protein, involved in endotoxin binding and recognition of apoptotic cells. CD14 is expressed on monocytes, macrophages, follicular dendritic cells, and granulocytes. Anti-CD14 can detect these cells, including monocyte-derived cells which are frequently increased in diffuse large B-cell lymphoma (DLBCL), as well as in neoplastic cells in acute myeloid leukemia with monocytic differentiation and chronic myelomonocytic leukemia.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EPR3653
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Gregory CD, et al. Apoptosis. 1999; 4:11-20
References 2:
Wright SD, et al. Science. 1990; 249: 1431-33
References 3:
Marmey B, et al. Hum Pathol. 2006; 37:68-77
References 4:
Smeltzer JP, et al. Clin Cancer Res. 2014; 20:2862-72
References 5:
Rollins-Raval MA, et al. Histopathology. 2012; 60: 933-42
CD14 is a 55kDa glycosyl-phosphatidylinositol-linked membrane protein, involved in endotoxin binding and recognition of apoptotic cells. CD14 is expressed on monocytes, macrophages, follicular dendritic cells, and granulocytes. Anti-CD14 can detect these cells, including monocyte-derived cells which are frequently increased in diffuse large B-cell lymphoma (DLBCL), as well as in neoplastic cells in acute myeloid leukemia with monocytic differentiation and chronic myelomonocytic leukemia.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
EPR3653
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Gregory CD, et al. Apoptosis. 1999; 4:11-20
References 2:
Wright SD, et al. Science. 1990; 249: 1431-33
References 3:
Marmey B, et al. Hum Pathol. 2006; 37:68-77
References 4:
Smeltzer JP, et al. Clin Cancer Res. 2014; 20:2862-72
References 5:
Rollins-Raval MA, et al. Histopathology. 2012; 60: 933-42
CD117, c-kit is a tyrosine kinase receptor found on interstitial cells of Cajal, germ cells, bone marrow stem cells, melanocytes, breast epithelium and mast cells. This receptor is found on a wide variety of tumor cells (follicular and papillary carcinoma of thyroid, adenocarcinomas from endometrium, lung, ovary, pancreas, breast; malignant melanoma, endodermal sinus tumor, and small cell carcinoma) but has been particularly useful in differentiating gastrointestinal stromal tumors from Kaposis sarcoma, and tumors of smooth muscle origin.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
YR145
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Sircar K, et al. AM J Surg Pathol 23(4):377-389,1999
References 2:
Miettinen M et al. Am J Surg Pathol 24(2):211-222, 2000
References 3:
Miettinen M. et al. Am J Surg Pathol 23(9): 1109-1118
The c-kit proto-oncogene encodes a transmembrane receptor with tyrosine kinase activity, c-kit (CD117), which is closely-related to the platelet-derived growth factor receptor family. c-kit plays a role during hematopoiesis, gametogenesis and melanogenesis. The expression of CD117 antigen is of particular interest in the study of gastrointestinal stromal tumors (GIST), small lung cell carcinomas and in melanomas.
Antibody Isotype:
IgG
Monosan Range:
MONXtra
Clone:
EP10
Concentration:
Greater than or equal to 13 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Sawyer EJ et al. Journal of Pathology 2003, 200, 59-64
Rabbit anti-cat IgG (H&L) is a secondary antibody which binds to cat IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase cat IgG (H&L).
This antibody is suitable for all immunoassay applications, The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is > 4.5 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on cat IgG light chains on all cat immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin cat serum proteins
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on cat IgG · light chains on all cat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin cat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Carbonic Anhydrase (CA IX) is part of a family of zinc containing metalloproteins that catalyze the reversible hydration of CO2.1 Among these, CA IX is anchored to the cell membrane and is expressed in the human gastrointestinal tract, chiefly in the stomach.1 Data suggest consistent immunoreactivity for anti-CA IX in clear cell renal cell carcinoma (RCC) making it a useful marker for this type of tumor.2
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
EP161
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Leppilampi M, et al. World J Gastroenterol. 2003; 9:1398-1403
Calponin is a 34 kD polypeptide that interacts with actin, tropomyosin, and calmodulin. It is involved in smooth muscle contraction mechanism and is restricted exclusively to smooth muscle tissue. Anticalponin has been found to be useful in staining myoepithelium and is, therefore, useful for differentiating benign sclerosing adenosis of the breast from infiltrating ductal carcinoma. Calponin positivity has also been noted in malignant myoepithelioma and pleomorphic adenoma3 of salivary gland origin, as well as angiomatoid malignant fibrous histiocytoma.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
EP798Y
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Wang NP, et al. Appl Immunohistochem. 1997; 5:141-151
References 2:
Nagao T, et al. Cancer. 1998; 83:1292-9
References 3:
Savara AT, et al. Mod Pathol. 1997; 10:1093-1100
References 4:
Fanburg-Smith JC, et al. Hum Pathol. 1999; 30:1336-43
References 5:
Hornick JL, et al. Am J Surg Pathol. 2003; 27: 1183-96
Anti-caldesmon is a regulatory protein found in smooth muscle and other tissues which interacts with actin, myosin, tropomyosin, and calmodulin. Anti-caldesmon antibody labels smooth muscle and tumors of smooth muscle, myofibroblastic, and myoepithelial differentiation. Anti-caldesmon has also been used to differentiate epithelioid mesothelioma from serous papillary carcinoma of the ovary.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
E89
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Miettinen M, et al. Arch Pathol Lab Med. 2006; 130:1466-78
References 2:
Watanabe K, et al. Hum Pathol. 1999; 30:392-6
References 3:
McCluggage WC. Adv Anat Pathol. 2004; 11:162-71
References 4:
Comin CE, et al. Am J Surg Pathol. 2006; 30:463-9
References 5:
Comin CE, et al. Am J Surg Pathol. 2007; 31:1139-48
Immunohistochemical staining with anti-calcitonin antibody has proven to be an effective way of demonstrating calcitonin-producing cells in the thyroid. C-cell hyperplasia and medullary thyroid carcinomas stain positive for calcitonin. Studies of calcitonin have resulted in the identification of a wide spectrum of C-cell proliferative abnormalities.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Matias-Guiu X, et al. Endocr Pathol. 2014; 25:21-9
References 2:
Fisher S, et al. Arch Pathol Lab Med. 2008;132:359-72
Acute humoral rejection is mediated by antibodies to the donor endothelium that activate the classical complement pathway. This leads to a number of split products of complement proteins. C4d is a fragment of C 4 complement released during activation of the classic complement pathway by the antigen antibody complex. C4d deposits in peritubular capillaries and is regarded as an indirect sign of an antibody response. C4d can be a useful tool for indicating acute renal allograft rejection
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
SP91
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Jianghua C, et al. Clin Transplant. 2005; 19:785-91
References 2:
Kayler LK, et al. Transplantation. 2008; 85:813-20
References 3:
Ranjan P, et al. Nephrol Dial Transplant .2008; 23:1735-41
References 4:
Seemayer CA, et al. Nephrol Dial Transplant. 2007; 22:568-76
References 5:
Bouron-Dal Soglio D, et al. Hum Pathol. 2008; 39:1103-10
The optimal working dilution should be determined by the investigator
Purity:
Immunogen affinity purified in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2 with 0.05% (w/v) sodium azide.
Special application note:
Antibody purity is > 95% based on SDS-PAGE.Affinity purified using solid phase Bovine IgG (H&L).Antibodi is supplied in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2.0.05% (w/v) Sodium Azide is added as preservative.Based on IEP, this antibody reacts with: heavy (γ) chains on bovine IgG light chains on all bovine immunoglobulins. Based on IEP, no reactivity is observed to: non-immunoglobulin bovine serum immunoglobulins.
For reconstitution add 1,1 ml of sterile water, Let it stand 30 minutes at room temperature to dissolve, Centrifuge to remove any particulates, Prepare fresh working dilutions daily
Not reactive in:
Non-immunoglobulin bovine serum proteins
Special application note:
Antibody purity is > 95% based on SDS-PAGE.Antibody is supplied in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free. 0.1% (v/v) ProClin 150 is added as a preservative.
Rabbit anti-bovine IgG (H&L) is a secondary antibody conjugated to FITC, which binds to bovine IgG (H&L) in immunological assays. Antibody is affinity purified using solid phase bovine IgG (H&L). Fluorescein-5-isothiocyanate (FITC) has Amax = 494 nm; Emax = 518 nm
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 2-8°C. The shelf life is 1 year from date of receipt. Prepare working dilution prior to use and then discard.
The optimal working dilution should be determined by the investigator, Suggested starting dilution(s): 1 : 20-1 : 2000 for most applications
Purity:
Immunogen affinity purified rabbit IgG.
Special application note:
Purity of this preparation is > 95% based on SDS-PAGE. Antibody concentration is 1.0 mg/ml (E 1% at 280 nm = 13.0). Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2.1 % (w/v) B, Protease/IgG free. Contains 0.05% (w/v) sodium azide as preservative of bacterial growth.Based on immunoelectrophoresis, this antibody reacts with: heavy chains on bovine IgG light chains on all bovine immunoglobulins. Based on immunoelectrophoresis, no reactivity is observed to: non-immunoglobulin bovine serum proteins
Affinity purified antibody is > 95% based on SDS-PAGE.Affinity purified using solid phase Bovine IgG (H&L).Antibody is supplied in 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free.0.05% (w/v) Sodium Azide is added as preservative.Based on IEP, this antibody reacts with: heavy (γ) chains on bovine IgG light chains on all bovine immunoglobulins. Based on IEP, no reactivity is observed to: non-immunoglobulin bovine serum immunoglobulins.
Affinity purified using solid phase Bovine IgG (H&L)
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Bovine IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on bovine IgG · light chains on all bovine immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin bovine serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Bovine IgG (H&L)
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Bovine IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on bovine IgG · light chains on all bovine immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin bovine serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Bovine IgG (H&L)
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Bovine IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on bovine IgG · light chains on all bovine immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin bovine serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Bovine IgG (H&L)
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Bovine IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on bovine IgG · light chains on all bovine immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin bovine serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Bovine IgG (H&L)
Purity:
> 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Bovine IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on bovine IgG · light chains on all bovine immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin bovine serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Prior to reconstitution store at +4oC.After reconstitution store at -20oC.Storage in frost-free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody. Rabbit anti Bovine collagen I/III antibody reacts with both Collagen I and III. Less than 0.5% reactivity was observed with bovine albumin and immunoglobulins.Collagen is located in the extracellular matrix of connective tissues. It is part of the interacting network of proteoglycans and proteins that provides a structural framework for both soft and calcified connective tissues.
Oct-binding factor-1 (OBF1), also known as BOB.1, is a B-cell-specific coactivator which has been mapped to chromosome 11q23. Expression of BOB.1/OBF.1 is restricted largely to mature B-cells, with germinal center B-cells normally staining for BOB.1.2,3 Analyses of BOB.1/OBF.1 expression in a variety of established B-cell lines representing different stages of B-cell development has suggested a constitutive, B-cell-specific expression pattern. LP cells in nodular lymphocyte predominant Hodgkin lymphoma, because they are germinal center-derived, are consistently immunoreactive for BOB.1. Conversely, only some cases of classical Hodgkin lymphoma show BOB.1 immunoreactivity within the Hodgkin and Reed-Sternberg cells. Expression of BOB.1/OBF.1 has been reported in follicular center cell lymphoma, diffuse large B-cell lymphoma and some cases of acute myeloid leukemia. B-CLL, marginal zone lymphoma, and mantle cell lymphoma may show weak to moderate immunoreactivity.
Antibody Isotype:
IgG-1
Monosan Range:
MONOSAN
Clone:
SP92
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Junker S, et al. Genomics. 1996; 33:143-5
References 2:
Steimle-Grauer SA, et al. Virchows Arch. 2003; 442:284-93
BCL2 is a protein associated with apoptosis regulation produced by the bcl-2 gene, located on chromosome 14q32.BCL2 is comprised of an alpha (239 amino acids) and beta chain. BCL2 (and thus BCL2 alpha chain) is found in mitochondrial and nuclear membranes and in the cytosol rather than the cell surface. In normal lymphoid tissue, BCL2 antibody reacts with small B-lymphocytes in the mantle zone and many cells within the T-cell areas. Anti-BCL2 has shown consistent negative reaction on reactive germinal center B-cells and positive staining of neoplastic follicles in follicular lymphoma. This antibody is valuable when distinguishing between reactive and neoplastic follicular proliferation in lymph node biopsies. This antibody may also be used in distinguishing between those follicular lymphomas that express BCL2 protein and the small number in which the neoplastic cells are BCL2 negative.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
E17
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Cooper K, et al. Journal of Pathology. 1997; 182:307-10
References 2:
Chetty R, et al. J Clin Pathol. 1995; 48:1035-1038
BCL2 is a protein associated with apoptosis regulation produced by the bcl-2 gene, located on chromosome 14q32.BCL2 is comprised of an alpha (239 amino acids) and beta chain. BCL2 (and thus BCL2 alpha chain) is found in mitochondrial and nuclear membranes and in the cytosol rather than the cell surface. In normal lymphoid tissue, BCL2 antibody reacts with small B-lymphocytes in the mantle zone and many cells within the T-cell areas. Anti-BCL2 has shown consistent negative reaction on reactive germinal center B-cells and positive staining of neoplastic follicles in follicular lymphoma. This antibody is valuable when distinguishing between reactive and neoplastic follicular proliferation in lymph node biopsies. This antibody may also be used in distinguishing between those follicular lymphomas that express BCL2 protein and the small number in which the neoplastic cells are BCL2 negative.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
E17
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Cooper K, et al. Journal of Pathology. 1997; 182:307-10
References 2:
Chetty R, et al. J Clin Pathol. 1995; 48:1035-1038
Androgen receptor (AR) is a member of the steroid receptor superfamily that is essential for the growth of prostate cancer cells. Ithas been reported that tyrosine phosphorylation of AR is induced by growth factors and elevated in hormone-refractory prostate tumors. Data suggest that growth factors and their downstream tyrosinekinases, which are elevated during hormone-ablation therapy, can induce tyrosine phosphorylation of AR. Such modification may be important for prostate tumor growth under androgen-depletedconditions. Cellular signaling occurs following androgen binding tothe AR and translocation to the nucleus. This activated complex associates with androgen-responsive elements contained in the DNAsequence of target genes, affecting the transcriptional activity of these genes.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Clone:
EP120
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Horie K, et al.Hum Reprod, 1992, 7:1461-1466
References 2:
Loda M, et al.: Mod Pathol, 1994, 7:388-391
References 3:
Miyamoto H, et al.: Prostate, 2004, 61:332-353
References 4:
Guo Z, et al.: Cancer Cell, 2006, 10:309-319
References 5:
Callewaert L, et al.: Biochem Biophys Res Commun, 2003, 306:46-52
ACTH or Adrenocorticotropic hormone is synthesized from pre-pro-opiomelanocortin (pre-POMC). ACTH is produced and secreted from corticotrophs in the anterior lobe (or adenohypophysis) of the pituitary gland. The anti-ACTH immunohistochemical reagent could be useful in the study of neoplastic and non-neoplastic pituitary diseases
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Pizarro CB, et al. Braz J Med Biol Res. 2004; 37:235-43
References 2:
Kageyama K, et al. Am J Med Sci. 2002; 324:326-30
References 3:
Fan X, et al. J Histochem Cytochem. 2002; 50:1509- 16
References 4:
Japon MA, et al. J Clin Endocrinol Metab. 2002; 87:1879-84
The immunohistochemical staining of Alpha-1-Antitrypsin is considered to be very useful in the study of inherited AAT deficiency, benign and malignant hepatic tumors and yolk sac carcinomas. Positive staining for A-1-Antitrypsin may also be used in detection of benign and malignant lesions of an histiocytic nature. Sensitivity and specificity of the results have made this antibody a useful tool in the screening of patients with cryptogenic cirrhosis or other forms of liver disease with portal fibrosis of uncertain etiology.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Callea F, et al. J Hepatol. 1986; 2:389-401
References 2:
Palmer PE, et al.Am J Clin Pathol. 1974; 62:350-4
References 3:
Palmer PE, et al. Cancer. 1980; 45:1424-31
References 4:
Raintoft I, et al. Hum Pathol. 1979; 10:419-24
References 5:
Ramsay AD, et al. Appl Immunohistochem Mol Morphol. 2008; 16:140-7
PYR1 (Abscisic acid receptor RCAR11) is a member of PYR (pyrabactin resistance) family, which function as abscisic acid sensors. Alternative names: ABI1-binding protein 6, Protein PYRABACTIN RESISTANCE 1, Regulatory components of ABA receptor 11.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica sp. Species of your interest not listed? Contact us
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Barghetti et al. (2017). Heat-shock protein 40 is the key farnesylation target in meristem size control, abscisic acid signaling, and drought resistance. Genes Dev. 2017 Nov 15;31(22):2282-2295. doi: 10.1101/gad.301242.117.
PYK10 is the main component of ER bodies. It has hydrolase activity, hydrolyzing O-glycosyl compounds It may produce defense compounds when plants are damaged by insects or wounding.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid at 2 mg/ml.
Storage Temp:
Store at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Species of your interest not listed? Contact us
Immunogen:
Conjugated peptide, derived from Arabidopsis thaliana internal part of PYK10, UniProt: A0A178VCN3, TAIR: At3g08880.
Applications:
Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western blot (WB)
Total IgG. Protein A purified in PBS, 50% glycerol. Filter sterilized.
Molecular Weight:
59,7 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Yamada et al. (2013). Identification of Two Novel Endoplasmic Reticulum Body-Specific Integral Membrane Proteins. Plant Physiol. 2013 Jan;161(1):108-20. doi: 10.1104/pp.112.207654. (Western blot, Arabidopsis thaliana) Nagano et al. (2005). Activation of an ER-body-localized -Glucosidase via a Cytosolic Binding Partner in Damaged Tissues of Arabidopsis thaliana. Plant Cell Physiol. 2005 Jul;46(7):1140-8. doi: 10.1093/pcp/pci126. (Immunoprecipiation, Western blot, Arabidopsis thaliana)Matshushima et al. (2003). A novel ER-derived compartment, the ER body, selectively accumulates a beta-glucosidase with an ER-retention signal in Arabidopsis. Plant J . 2003 Feb;33(3):493-502. doi: 10.1046/j.1365-313x.2003.01636.x. Immunofluorescence, Immunohistochemistry, Western blot, Arabidopsis thaliana)
PYK10 is the main component of ER bodies. It has hydrolase activity, hydrolyzing O-glycosyl compounds It may produce defense compounds when plants are damaged by insects or wounding. Cellular localisation: ER bodies.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid at 2 mg/ml.
Storage Temp:
Store at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Species of your interest not listed? Contact us
Immunogen:
Conjugated peptide, derived from Arabidopsis thaliana C-terminal of PYK10, UniProt: A0A178VCN3, TAIR: At3g08880.
N-terminal signal peptide including 24 amino acis and ER retention signal is removed from the mature protein
Application Details:
1:500-1:1000 (IHC), 1: 5000- 1: 20 000 (WB)
Purity:
Total IgG. Protein A purified in PBS, 50% glycerol. Filter sterilized.
Molecular Weight:
59,7 | 56 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Matsushima et al. (2003). A novel ER-derived compartment, the ER body, selectively accumulates a beta-glucosidase with an ER-retention signal in Arabidopsis. Plant J. 2003 Feb;33(3):493-502. doi: 10.1046/j.1365-313x.2003.01636.x.
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.5 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Store up to 1 year at 4°C >>> Storage of reconstituted exosomes: Stored at -20°C for up to one month or at -80°C for up to 6 months. Recommended to avoid repeated freeze-and-thraw cycles.. Avoid repeated freeze-and-thaw cycles.
Assay calibration. Control (spike-in) for exosome quantification. Protein marker analysis using different techniques. Extraction and analysis of exosome nucleic acid. Standardized positive controls for immunocapture performance evaluation. Flow cytometry. Electron microscopy.
Store up to 1 year at 4°C >>> Storage of reconstituted exosomes: Stored at -20°C for up to one month or at -80°C for up to 6 months. Recommended to avoid repeated freeze-and-thraw cycles.. Avoid repeated freeze-and-thaw cycles.
Assay calibration. Control (spike-in) for exosome quantification. Protein marker analysis using different techniques. Extraction and analysis of exosome nucleic acid. Standardized positive controls for immunocapture performance evaluation. Flow cytometry. Electron microscopy.
Store up to 1 year at 4°C >>> Storage of reconstituted exosomes: Stored at -20°C for up to one month or at -80°C for up to 6 months. Recommended to avoid repeated freeze-and-thraw cycles.. Avoid repeated freeze-and-thaw cycles.
Assay calibration. Control (spike-in) for exosome quantification. Protein marker analysis using different techniques. Extraction and analysis of exosome nucleic acid. Standardized positive controls for immunocapture performance evaluation. Flow cytometry. Electron microscopy.
Exosomes are small endosome derived lipid nanoparticles (50-120 nm) actively secreted by exocytosis by most living cells. Exosome release occurs either constitutively or upon induction, under both normal and pathological conditions, in a dynamic, regulated and functionally relevant manner. Both amount and molecular composition of released exosomes depend on the state of a parent cell. Exosomes have been isolated from diverse cell lines (hematopoietic cells, tumor lines, primary cultures, virus infected cells) as well as from biological fluids in particular blood (e.g. serum and plasma from cancer patients) and other body fluids (bronchoalveolar lavage fluid, pleural effusions, synovial fluid, urine, amniotic fluid, semen, saliva etc). Exosomes have pleiotropic physiological and pathological functions and an emerging role in diverse pathological conditions such as cancer, infectious and neurodegenerative diseases.
Exosomes are small endosome derived lipid nanoparticles (50-120 nm) actively secreted by exocytosis by most living cells. Exosome release occurs either constitutively or upon induction, under both normal and pathological conditions, in a dynamic, regulated and functionally relevant manner. Both amount and molecular composition of released exosomes depend on the state of a parent cell. Exosomes have been isolated from diverse cell lines (hematopoietic cells, tumor lines, primary cultures, virus infected cells) as well as from biological fluids in particular blood (e.g. serum and plasma from cancer patients) and other body fluids (bronchoalveolar lavage fluid, pleural effusions, synovial fluid, urine, amniotic fluid, semen, saliva etc). Exosomes have pleiotropic physiological and pathological functions and an emerging role in diverse pathological conditions such as cancer, infectious and neurodegenerative diseases.
Exosomes are small endosome derived lipid nanoparticles (50-120 nm) actively secreted by exocytosis by most living cells. Exosome release occurs either constitutively or upon induction, under both normal and pathological conditions, in a dynamic, regulated and functionally relevant manner. Both amount and molecular composition of released exosomes depend on the state of a parent cell. Exosomes have been isolated from diverse cell lines (hematopoietic cells, tumor lines, primary cultures, virus infected cells) as well as from biological fluids in particular blood (e.g. serum and plasma from cancer patients) and other body fluids (bronchoalveolar lavage fluid, pleural effusions, synovial fluid, urine, amniotic fluid, semen, saliva etc). Exosomes have pleiotropic physiological and pathological functions and an emerging role in diverse pathological conditions such as cancer, infectious and neurodegenerative diseases.
Product Type:
Concentrator | EV purification
Storage Temp:
+ 4 C
Applications:
Concentrator | EV purification
Additional Info:
TFF-MV is a filter cartridge in hollow fibers made of polysulfone. The filter is very useful for separating different EVs by size. Indeed, microvesicles bigger than 150 nm are retained inside the hollow fibers, while small EVs and molecules easily permeate the filter. Microvesicles can be recovered with a syringe in PBS buffer without additional purification steps.
Filter cartridge: Polysulfone hollow fibres
Sample volume per reaction: Recommended sample volume from 10 ml up to several liters if connected to mechanical pump
Exosomes are small endosome derived lipid nanoparticles (50-120 nm) actively secreted by exocytosis by most living cells. Exosome release occurs either constitutively or upon induction, under both normal and pathological conditions, in a dynamic, regulated and functionally relevant manner. Both amount and molecular composition of released exosomes depend on the state of a parent cell. Exosomes have been isolated from diverse cell lines (hematopoietic cells, tumor lines, primary cultures, virus infected cells) as well as from biological fluids in particular blood (e.g. serum and plasma from cancer patients) and other body fluids (bronchoalveolar lavage fluid, pleural effusions, synovial fluid, urine, amniotic fluid, semen, saliva etc). Exosomes have pleiotropic physiological and pathological functions and an emerging role in diverse pathological conditions such as cancer, infectious and neurodegenerative diseases.
Tyrosine phosphorylation is considered to be one of the key steps in signal transduction and regulation of enzymatic activity. Phosphotyrosine antibodies are helpful in facilitating the identification of tyrosine kinase substrates.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at -20 °C for one year; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Mouse
Species Reactivity:
Antibody reacts with phosphotyrosine and detects the presence of phosphotyrosine in proteins of both unstimulated and stimulated cell lysated, Does not cross react with phosphoserine or phosphothreonine
Immunogen:
Phosphotyrosine, alanine and glyceine in a 1:1:1 ratio polymerized in the presence of keyhole limpet hemocyanin KLH with 1-ethyl-3-(3’-dimentrylaminopropyl) carbodiimide
Applications:
Immunoprecipitation (IP), Immunofluorescence (IF), Immunohistochemistry (IHC), Western blot (WB)
1 g/ml of this antibody is sufficient for detection of phosphorylated tyrosine residues in 10 g of rat tissue lysate by colorimetric immunoblot analysis
Application Details:
1 : 1000 (WB)
Conjugation:
IgG1
Isotype:
IgG1
Purity:
Total IgG.
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Garton & Tonks (1999). Regulation of fibroblast motility by the protein tyrosine phosphatase PTP-PEST. J Biol Chem 6:3811-3818.Tiganis et al. (1999). The protein-tyrosine phosphatase TCPTP regulates epidermal growth factor receptor-mediated and phosphatidylinositol 3-kinase-dependent signaling. J Biol Chem 39: 27768-27775.(IF):Garton et al. (1996). Identification of p130(cas) as a substrate for the cytosolic protein tyrosine phosphatase PTP-PEST. Mol and Cell Bio 11:6408-6418.(IP):
Special application note:
Protein G purified IgG1 in PBS, pH 7,4 with 0,09 % sodium azide and 50 % glycerol at concentration 1 mg/ml
PTOX (plastid terminal oxidase) is a component of electron transfer chain responsible for desaturation of phytoene, which prevents the generation of reactive oxygen species. It is involved in the differentiation of plastids: chloroplasts, amyloplasts, and etioplasts. PTOX is expressed ubiquitously in plant tissues and is located in the lumen.Synonymes: IM, IM1, immutants, AOX4, alternative oxidase 4, ubiquinol oxidase 4, chloroplastic/chromoplastic
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
In most plants it is a minor polypeptide and consequently enrichment by analyzing membrane fractions for example is recommended
Application Details:
1 : 4000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 100 µl of sterile water
Molecular Weight:
30 | 37-41 kDa (Arabidopsis thaliana)
Not reactive in:
Galdieria sulphuraria, Phaeodactylum tricornutum
Selected references:
Urban, Rogowski & Romanowska (2022), Crucial role of the PTOX and CET pathways in optimizing ATP synthesis in mesophyll chloroplasts of C3 and C4 plants, Environmental and Experimental Botany, Volume 202, October 2022, 105024, https://doi.org/10.1016/j.envexpbot.2022.105024Pralon et al. (2020). Mutation of the Atypical Kinase ABC1K3 Partially Rescues the PROTON GRADIENT REGULATION 6 Phenotype in Arabidopsis thaliana. Front. Plant Sci., 25 March 2020Bolte et al. (2020). Dynamics of the localization of the plastid terminal oxidase PTOX inside the chloroplast. J Exp Bot. 2020 Feb 15. pii: eraa074. doi: 10.1093/jxb/eraa074.Cournac et al. (2000b). Flexibility in photosynthetic electron transport: a newly identified chloroplast oxidase involved in chlororespiration. Philos Trans R Soc Lond B Biol Sci. 2000 Oct 29;355(1402):1447-54Cournac et al. (2000a). Electron flow between photosystem II and oxygen in chloroplasts of photosystem I-deficient algae is mediated by a quinol oxidase involved in chlororespiration. J Biol Chem. 2000 Jun 9;275(23):17256-62.
Special application note:
This product can be sold containing proclin if requested
PTEN (phosphatase and tensin homolog) is a tumor suppressor that negatively regulates the PI3KAKT signaling pathway. Loss of PTEN function has been implicated in the pathogenesis of a number of different tumors, particularly endometrial cancer.
PTEN (phosphatase and tensin homolog) is a tumor suppressor that negatively regulates the PI3KAKT signaling pathway. Loss of PTEN function has been implicated in the pathogenesis of a number of different tumors, particularly endometrial cancer.
PTEN (phosphatase and tensin homolog) is a tumor suppressor that negatively regulates the PI3KAKT signaling pathway. Loss of PTEN function has been implicated in the pathogenesis of a number of different tumors, particularly endometrial cancer.
Phosphate acetyltransferase (PTA) - EC=2.3.1.8 is an enzyme from transferase family which participates in three metabolic pathways: taurine and hypotaurine metabolism, pyruvate metabolism and propanoate metabolism. Alternative names: acetyl-CoA:phosphate acetyltransferase, phosphotransacetylase, phosphoacylase.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Expected Species:
Volvox carteri Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide conjugated derived from PTA2 of Chlamydomonas reinhardtii A8IZZ9
PSY (Phytoene synthase) is a rate-limiting enzyme in the carotenoid biosynthetic pathway.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Cerda et al. (2020). Functional characterisation and in silico modelling of MdPSY2 variants and MdPSY5 phytoene synthases from Malus domestica. J Plant Physiol . 2020 Jun;249:153166.doi: 10.1016/j.jplph.2020.153166.
Phosphorylation is a post-translational modification of proteins in which a phosphate group is covalently bound to a serine, threonine or a thyrosine residue by a protein kinase. Phosphorylation of a protein can result in activation or inhibition of a proteins function and is thereby a regulatory mechanisms of protein activation.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at 2-8 C; add sodium azide to 0,05% for porlonged storage, Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Immunoglobulin Protein A purified in a 10 mM ammonium bicarbonate buffer, with 2 mg of BSA.
Reconstitution:
Recommended antibody concentration: 0.5 mg/ml (when dissolved at 0.5 mg/ml, the BSA concentration will be 1%). Recommended to dissolve in; 100 mM PBS or Tris-HCl, pH 7.0 Additional sodium azide ( up to 0.05%) is recommended for long term storage. For a 0.5 mg/ml antibody concentration in 1% BSA, dissolve in 200 μl buffer.
Psc is a polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development. Alternative names: Protein posterior sex combs
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Lyophilized antibody can be stored at -20 °C for up to 3 years. Re-constituted antibody can be stored at 4°Cfor several days to weeks. Once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Drosophila melanogaster
Immunogen:
GST-conjugated, full length Psc protein of Drosophila melanogaster, UniProt: P35820
PsbY (Small subunit Y of PSII) is a manganese-binding polypeptide with L-arginine metabolizing enzyme activity. It is a component of the core of photosystem II. Alternative names: psbY-A1, L-AME, L-arginine.metabolizing enzyme.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Glycne soja , Medicago truncatula, Morus notabilis, Oryza sativa, Populus trichocarpa, Ricinus communi, Solanum chacoense, Spinacia oleracea, Theobroma cacao , Zea mays, Zostera marina Species of your interest not listed? Contact us
Von Sydow et al. (2016). The PsbY protein of Arabidopsis Photosystem II is important for the redox control of cytochrome b559. Biochim Biophys Acta. 2016 May 21. pii: S0005-2728(16)30536-9. doi: 10.1016/j.bbabio.2016.05.004.
Plant PsbX is a nucelar encoded small 4 kDa protein associated with Photosystem II and found in all classes of oxygenic organisms.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Dictos, Oryza sativa, Zea mays Species of your interest not listed? Contact us
For an image of antibody detection in a western blot application see Garcia-Cerdan et al. (2008).
Application Details:
1 : 2500, 1 g of chlorophyll/lane (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 200 l of sterile water
Molecular Weight:
4 kDa
Not reactive in:
Cyanobacteria
Selected references:
Hackett et al. (2017). An Organelle RNA Recognition Motif Protein Is Required for Photosystem II Subunit psbF Transcript Editing. Plant Physiol. 2017 Apr;173(4):2278-2293. doi: 10.1104/pp.16.01623.
Special application note:
PsbX is a small (4 kDa) and very hydrophobic subunit of PSII, Immunoblots from SDS-gels (especially with high loading) may show higher molecular weight signals from PsbX not fully detached from other subunits of PSII, The use of 15% SDS-PAGE gels with 2-4 M urea is recommended when working with this antibody
PsbW is a nuclear-encoded protein located in the thylakoid membrane of the chloroplast. It is a core component of Photosystem II. Altrnative name: PSII 6.1 kDa protein
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Hackett et al. (2017). An Organelle RNA Recognition Motif Protein Is Required for Photosystem II Subunit psbF Transcript Editing. Plant Physiol. 2017 Apr;173(4):2278-2293. doi: 10.1104/pp.16.01623.
PsbTn (Tn protein of PSII) nuclear encoded protein involved in photosynthesis. Alternative names: photosystem II 5 kDa protein, chloroplastic, PSII-T, Nuclear encoded psbT.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Cicer arietinum, Glycine soja, Helianthus annuus, Medicago truncatula, Nicotiana attenuata, Nicotiana tabacum, Nicotiana sylvestris, Noccaea caerulescens, Petunia hybrida, Populus trichocarpa, Solanum chacoense, Solanum tuberosum Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide, derived from Arabidopsis thaliana PsbTn protein sequence, UniProt:Q39195, TAIR: AT3G21055
LMW proteins can sometimes interfere with chlorophyll, but most chlorophyll can be removed by precipitating sample in acetone before loading on a gel.Protocol: Add acetone to final concentration of 80% ice-cold acetone. Leave 10 minutes. Spin. Rresuspend pellet in solubilisation buffer and load on a gel.
Application Details:
1: 1000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 200 l of sterile water
Molecular Weight:
11 | 5 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Chen et al. (2019). The Low Molecular Mass Photosystem II Protein PsbTn is Important for Light Acclimation. Plant Physiol. Apr;179(4):1739-1753. doi: 10.1104/pp.18.01251.
The 22 kDa PsbS protein of photosystem II functions in the regulation of photosynthetic light harvesting. Along with a low thylakoid lumen pH and the presence of de-epoxidized xanthophylls, PsbS is necessary for photoprotective thermal dissipation of excess absorbed light energy in plants, measured as non-photochemical quenching of chlorophyll fluorescence. Synonymes: NPQ4 (NONPHOTOCHEMICAL QUENCHING).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Chlamydomonas reinhardtii, Cucumis sativus, Medicago truncatula, Physcomitrium patens, Picea sitchensis, Pinus radiata, Pinus taeda, Populus balsamifera, Solanum lycopersicum, Tarenaya hassleriana, Zosteria marina, Vitis viniferaSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide located in solubilized part of the protein, derived from available di- and monocot PsbS sequences, including Arabidopsis thaliana UniProt:Q9XF91, TAIR:At1g44575
This product can be sold containing proclin if requested
Application Details:
1 : 2000 - 1: 10 000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
28 | 22 kDa for Arabidopsis thaliana
Not reactive in:
Lobosphaera incisa
Selected references:
Jiang et al. (2020). Plastid chaperone HSP90C guides precursor proteins to the SEC translocase for thylakoid transport. J Exp Bot. 2020 Aug 27;eraa399.doi: 10.1093/jxb/eraa399. Barbato et al. (2020). Higher Order Photoprotection Mutants Reveal the Importance of ?pH-dependent Photosynthesis-Control in Preventing Light Induced Damage to Both Photosystem II and Photosystem I. Sci Rep . 2020 Apr 21;10(1):6770. doi: 10.1038/s41598-020-62717-1.Nikkanen et al. (2018). Multilevel regulation of non-photochemical quenching and state transitions by chloroplast NADPH-dependent thioredoxin reductase. Physiol Plant. 2018 Dec 22. doi: 10.1111/ppl.12914.Chen et al. (2018). Exogenous melatonin enhances salt stress tolerance in maize seedlings by improving antioxidant and photosynthetic capacity. Physiol Plant. 2018 Apr 6. doi: 10.1111/ppl.12737.Glowacka et al. (2018). Photosystem II Subunit S overexpression increases the efficiency of water use in a field-grown crop. Nat Commun. 2018 Mar 6;9(1):868. doi: 10.1038/s41467-018-03231-x.
The 22 kDa PsbS protein of photosystem II functions in the regulation of photosynthetic light harvesting. Along with a low thylakoid lumen pH and the presence of de-epoxidized xanthophylls, PsbS is necessary for photoprotective thermal dissipation of excess absorbed light energy in plants, measured as non-photochemical quenching of chlorophyll fluorescence.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4 C; make aliquots to avoid working with a stock. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
KLH-conjugated synthetic peptide derived from available di and monocot PsbS sequences, including Arabidopsis thaliana (At1g44575). This sequence is even conserved in conifers.
Purified, total IgY (chicken egg yolk immunoglobulin) in PBS pH 8. Contains 0.02 % sodium azide.
Molecular Weight:
28 | 22 kDa for Arabidopsis thaliana
Not reactive in:
Chlamydomonas reinhardtii, Chlorella sp.
Selected references:
Hubbart et al. (2012). The photoprotective protein PsbS exerts control over CO2 assimilation rate in fluctuating light in rice. The Plant J. March 2012.
PsbR protein is found in plant Photosystem II and anticipate to play a role in water oxidation, yet the physiological significance of PsbR has remained obscure.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Yang-Er Chen et al. (2017). Responses of photosystem II and antioxidative systems to high light and high temperature co-stress in wheat. J. of Exp. Botany, Volume 135, March 2017, Pages 45–55.Shen et al. (2016). The existence of C4-bundle-sheath-like photosynthesis in the mid-vein of C3 rice. Rice (N Y). 2016 Dec;9(1):20. doi: 10.1186/s12284-016-0094-5. Epub 2016 May 10.Albanese et al. (2016). Isolation of novel PSII-LHCII megacomplexes from pea plants characterized by a combination of proteomics and electron microscopy. Photosynth Res. 2016 Jan 9.Dixit (2015). Sulfur alleviates arsenic toxicity by reducing its accumulation and modulating proteome, amino acids and thiol metabolism in rice leaves. Sci Rep. 2015 Nov 10;5:16205. doi: 10.1038/srep16205.Ido et al. (2014). Cross-Linking Evidence for Multiple Interactions of the PsbP and PsbQ Proteins in a Higher Plant Photosystem II Supercomplex. J Biol Chem. 2014 Jul 18;289(29):20150-7. doi: 0.1074/jbc.M114.574822. Epub 2014 Jun 9.
Special application note:
This product can be sold containing proclin if requested
PsbP-like protein (sll1418) is a cyanobacterial homologue of plant PsbP-like protein. It is localized in the thylakoid membrane and associated with photosystem II. Synonymes: Sll1418 protein
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Synechocystis sp. PCC 6803
Expected Species:
Anabaena variabilis, Arthrospira maxima, Lyngbya sp. PCC 8106, Microcoleus chthonoplastes, Ostreococcus lucimarinus, Trichodesmium erythraeum, Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from PsbP -like protein of Synechocystis sp. PCC 6803, UniProt: P73952
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Gandini et al. (2017). The transporter SynPAM71 is located in the plasma membrane and thylakoids, and mediates manganese tolerance in Synechocystis PCC6803. New Phytol. 2017 Mar 20. doi: 10.1111/nph.14526.Sveshnikov et al. (2007) The PsbP-like protein (sll1418) of Synechocystis sp. PCC 6803 stabilises the donor side of Photosystem II, Photosynth. Res. 93, 101-109.Ishikawa et al. . (2005) Functional analysis of the PsbP-like protein (sll1418) in Synechocystis sp. PCC 6803, Photosynth. Res. 84, 257-262.
PSII reaction centre components are generating the redox potential required to drive highly oxidizing water splitting reaction. Four Mn atoms are present on a lumenal surface and form the catalyctic site of the water-splitting reaction which is in close association with the 33 kDa (PsbO), 23 kDa (PsbP) and 17 kDa (PsbQ) extrinistic subunits of oxygen evolving complex OEC. A 33-kDa extrinsic protein is also termed the Mn-stabilizing protein (MSP), however recent evidences shown that it is C-terminal domain of PsbA (D1) protein which is involved in in the assembly and stabilization of the OEC.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Load per well on cell extract of Pinus banksiana (Jack Pine) was 7 g.This antibody can be used as a loading control for Chlamydomonas reinhardtii while it not so suitable for higher plants as accumulation of these proteins might drop to 12.5-25 % of the WT level in mutants defective for PSII core (Schult et al. 2007).
Application Details:
1 : 2000-1 : 5000 (WB)
Purity:
Total IgG. Protein G purified in PBS pH 7.4.
Reconstitution:
For reconstitution add 200 l of sterile water
Molecular Weight:
28 | 23 kDa
Not reactive in:
Synechococcus sp. PCC 7942
Selected references:
Lim et al (2022). Arabidopsis guard cell chloroplasts import cytosolic ATP for starch turnover and stomatal opening. Nat Commun. 2022 Feb 3;13(1):652. doi: 10.1038/s41467-022-28263-2. PMID: 35115512; PMCID: PMC8814037.Lim et al (2022) Arabidopsis guard cell chloroplasts import cytosolic ATP for starch turnover and stomatal opening. Nat Commun. 2022 Feb 3;13(1):652. doi: 10.1038/s41467-022-28263-2. PMID: 35115512; PMCID: PMC8814037.Cecchin et al (2021) LPA2 protein is involved in photosystem II assembly in Chlamydomonas reinhardtii. Plant J. 2021 Jul 4. doi: 10.1111/tpj.15405. Epub ahead of print. PMID: 34218480.Jiang et al. (2020). Plastid chaperone HSP90C guides precursor proteins to the SEC translocase for thylakoid transport. J Exp Bot. 2020 Aug 27;eraa399.doi: 10.1093/jxb/eraa399. Nama et al. (2018). Non-photochemical quenching-dependent acclimation and thylakoid organization of Chlamydomonas reinhardtii to high light stress. Photosynth Res. 2018 Jul 7. doi: 10.1007/s11120-018-0551-7.
PsbP - 23 kDa extrinsic protein of photosystem II (PSII). Processing of the protein results in a protein with molecular mass of around 20 kDa. PsbP is required to optimize water splitting process in PSII, by probab y by optimisation of calcium and Cl- levels. The protein is found in higher plants and algae but is not conserved in cyanobacteria. Synonymes:Oxygen-evolving enhancer protein 2-1, chloroplastic, OEE2, 23 kDa subunit of oxygen evolving system of photosystem II, OEC 23 kDa subunit, OEC23, 23 kDa thylakoid membrane protein
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Mazur et al. (2021) The SnRK2.10 kinase mitigates the adverse effects of salinity by protecting photosynthetic machinery. Plant Physiol. 2021 Dec 4;187(4):2785-2802. doi: 10.1093/plphys/kiab438. PMID: 34632500; PMCID: PMC8644180.Tamburino et al. (2017). Chloroplast proteome response to drought stress and recovery in tomato (Solanum lycopersicum L.). BMC Plant Biol. 2017 Feb 10;17(1):40. doi: 10.1186/s12870-017-0971-0.Pavlovi? et al. (2016). Light-induced gradual activation of photosystem II in dark-grown Norway spruce seedlings. Biochim Biophys Acta. 2016 Feb 18. pii: S0005-2728(16)30028-7. doi: 10.1016/j.bbabio.2016.02.009.Albanese et al. (2016). Isolation of novel PSII-LHCII megacomplexes from pea plants characterized by a combination of proteomics and electron microscopy. Photosynth Res. 2016 Jan 9.Grassl et al. (2012). Early events in plastid protein degradation in stay-green Arabidopsis reveal differential regulation beyond the retention of LHCII and chlorophyll. J. Proteome Res. October 2.
Special application note:
This product can be sold containing ProClin if requested
PSII reaction centre components are generating the redox potential required to drive highly oxidizing water splitting reaction. Four Mn atoms are present on a lumenal surface and form the catalyctic site of the water-splitting reaction which is in close association with the 33 kDa (PsbO), 23 kDa (PsbP) and 17 kDa (PsbQ) extrinistic subunits of oxygen evolving complex OEC. A 33-kDa extrinsic protein is also termed the Mn-stabilizing protein (MSP), however recent evidences shown that it is C-terminal domain of PsbA (D1) protein which is involved in in the assembly and stabilization of the OEC.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Sorghum bicolor, Zea mays
Expected Species:
Hordeum vulgare, Oryza sativa Species of your interest not listed? Contact us
The PsbO protein is an extrinisic subunit of the water splitting photosystem II (PSII) complex. The protein is exposed on the luminal side of the thylakoid membrane, and is hihgly conserved in all known oxygenic photosynthetic organisms.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes.
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Expected Species:
Halomicronema hongdechloris, Synechocystissp., Synechococcus elongatusSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from Chlamydomonas reinhardtii PsbO protein sequence, UniProt: P12853
PSII reaction centre components are generating the redox potential required to drive highly oxidizing water splitting reaction. Four Mn atoms are present on a lumenal surface and form the catalyctic site of the water-splitting reaction which is in close association with the 33 kDa (PsbO), 23 kDa (PsbP) and 17 kDa (PsbQ) extrinistic subunits of oxygen evolving complex OEC. A 33-kDa extrinsic protein is also termed the Mn-stabilizing protein (MSP), however recent evidences shown that it is C-terminal domain of PsbA (D1) protein which is involved in in the assembly and stabilization of the OEC.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
This antibody can be used as a loading control for Chlamydomonas reinhardtii while it not so suitable for higher plants as accumulation of these proteins might drop to 12.5-25 % of the WT level in mutants defective for PSII core (Schult et al. 2007).
Application Details:
1 : 2000-1 : 5000 (WB)
Purity:
Total IgG. Protein G purified in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
35 | 33 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Cecchin et al (2021) LPA2 protein is involved in photosystem II assembly in Chlamydomonas reinhardtii. Plant J. 2021 Jul 4. doi: 10.1111/tpj.15405. Epub ahead of print. PMID: 34218480.Loudya et al. (2021) Cellular and transcriptomic analyses reveal two-staged chloroplast biogenesis underpinning photosynthesis build-up in the wheat leaf. Genome Biol. 2021 May 11;22(1):151. doi: 10.1186/s13059-021-02366-3. PMID: 33975629; PMCID: PMC8111775.Terentyev (2020: The Main Structural and Functional Characteristics of Photosystem-II-Enriched Membranes Isolated From Wild Type and cia3 Mutant Chlamydomonas reinhardtii. Life (Basel). 2020 May 14;10(5):E63. doi: 10.3390/life10050063..Tang el al. (2020). OsNSUN2-Mediated 5-Methylcytosine mRNA Modification Enhances Rice Adaptation to High Temperature. Dev Cell. 2020 May 4;53(3):272-286.e7. doi: 10.1016/j.devcel.2020.03.009.Smythers et al. (2019). Characterizing the effect of Poast on Chlorella vulgaris, a non-target organism. Chemosphere Volume 219, March 2019, Pages 704-712.
Special application note:
Total IgG fraction has been purified by 40% ammonium sulpgate precipitation followed by DEAE cellulose chromatographyThis product can be sold containing ProClin if requested
The PsbO protein is an extrinisic subunit of the water splitting photosystem II (PSII) complex. The protein is exposed on the luminal side of the thylakoid membrane, and is hihgly conserved in all known oxygenic photosynthetic organisms. Alternative names of PsbO1 include 33 kDa subunit of oxygen evolving system of photosystem II, OEC 33 kDa subunit, 33 kDa thylakoid membrane protein, manganese-stabilizing protein 1 and for PsbO2 33 kDa subunit of oxygen evolving system of photosystem II, OEC 33 kDa subunit, 33 kDa thylakoid membrane protein, manganese-stabilizing protein 2.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Mazur et al. (2021) The SnRK2.10 kinase mitigates the adverse effects of salinity by protecting photosynthetic machinery. Plant Physiol. 2021 Dec 4;187(4):2785-2802. doi: 10.1093/plphys/kiab438. PMID: 34632500; PMCID: PMC8644180.Toubiana et al. (2020). Correlation-based Network Analysis Combined With Machine Learning Techniques Highlight the Role of the GABA Shunt in Brachypodium Sylvaticum Freezing Tolerance. Sci Rep , 10 (1), 4489Wang et al. (2019). YR36/WKS1-mediated Phosphorylation of PsbO, an Extrinsic Member of Photosystem II, Inhibits Photosynthesis and Confers Stripe Rust Resistance in Wheat. Mol Plant. 2019 Oct 14. pii: S1674-2052(19)30330-2. doi: 10.1016/j.molp.2019.10.005.An et al. (2019). Protein cross-interactions for efficient photosynthesis in the cassava cultivar SC205 relative to its wild species. J Agric Food Chem. 2019 Jul 19. doi: 10.1021/acs.jafc.9b00046.Rozp?dek et al. (2018). Acclimation of the photosynthetic apparatus and alterations in sugar metabolism in response to inoculation with endophytic fungi. Plant Cell Environ. 2018 Dec 5. doi: 10.1111/pce.13485.
Special application note:
Loading based on 50-100 ng of chlorophyll is enough to obtain good signal with this antibody
The PsbO protein is an extrinisic subunit of the water splitting photosystem II (PSII) complex. The protein is exposed on the luminal side of the thylakoid membrane, and is hihgly conserved in all known oxygenic photosynthetic organisms. Alternative names of PsbO1 include 33 kDa subunit of oxygen evolving system of photosystem II, OEC 33 kDa subunit, 33 kDa thylakoid membrane protein, manganese-stabilizing protein 1 and for PsbO2 33 kDa subunit of oxygen evolving system of photosystem II, OEC 33 kDa subunit, 33 kDa thylakoid membrane protein, manganese-stabilizing protein 2.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica napus, Capsella rubella, dinoflagellate, Triticum aestivum Species of your interest not listed? Contact us
This antibody is specific to PsbO2 and does not react with PsbO1 as confirmed on deletion mutant
Application Details:
1 : 1000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
33 | 30 kDa
Selected references:
Pipitone et al. (2021). A multifaceted analysis reveals two distinct phases of chloroplast biogenesis during de-etiolation in Arabidopsis. Elife. 2021 Feb 25;10:e62709. doi: 10.7554/eLife.62709. PMID: 33629953; PMCID: PMC7906606.Pralon et al. (2019). Plastoquinone homoeostasis by Arabidopsis proton gradient regulation 6 is essential for photosynthetic efficiency. Commun Biol. 2019 Jun 20;2:220. doi: 10.1038/s42003-019-0477-4.
The PsbO protein is an extrinisic subunit of the water splitting photosystem II (PSII) complex. The protein is exposed on the luminal side of the thylakoid membrane, and is hihgly conserved in all known oxygenic photosynthetic organisms. Alternative names of PsbO1 include 33 kDa subunit of oxygen evolving system of photosystem II, OEC 33 kDa subunit, 33 kDa thylakoid membrane protein, manganese-stabilizing protein 1 and for PsbO2 33 kDa subunit of oxygen evolving system of photosystem II, OEC 33 kDa subunit, 33 kDa thylakoid membrane protein, manganese-stabilizing protein 2.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica napus, Capsella rubella, Triticum aestivum Species of your interest not listed? Contact us
This antibody is specific to PsbO1 and does not react with PsbO2 as confirmed on a deletion mutant
Application Details:
1 : 1000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
33 | 30 kDa
Not reactive in:
Oryza sativa
Selected references:
Shanmugabalaji et al. (2018). Chloroplast Biogenesis Controlled by DELLA-TOC159 Interaction in Early Plant Development. Curr Biol. 2018 Aug 20;28(16):2616-2623.e5. doi: 10.1016/j.cub.2018.06.006.
The PsbN protein is chloroplast-encoded, low molecular weight protein annotated as a photosystem II subunit however it seems that it is not a constituent subunit of PSII but is required for PSII repair from photoinhibition.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Nicotiana tabacum
Expected Species:
Arabis alpina, Camelia sp., Canna indica, Cannabis sativa, Costus pulverulentus, Glycine max, Helianthus tuberosus, Hordeum vulgare, Lactuca sativa, Lilium sp., Manihot esculenta, Oryza sativa, Phaseolus vulgaris, Pisum sativum, Populus trichocarpa, Saccharum officinarum, Solanum tuberosum, Sorghum timorense, Spinacia oleracea, Tricitum aestivum, Thaumatococcus daniellii, Vitis vinifera Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide chosen from PsbN protein of Arabidopsis thaliana Uniprot: P62113, TAIR: AtCg00700
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Torabi et al. (2014). PsbN Is Required for Assembly of the Photosystem II Reaction Center in Nicotiana tabacum. Plant Cell. 2014 Mar;26(3):1183-99. doi: 10.1105/tpc.113.120444. Epub 2014 Mar 11.
The PsbI protein, previously named the 4.8-kDa protein, is encoded by the plastome. PsbI is a universal component of PSII and is highly conserved (e.g. there is 71% amino acid identicality between the Arabidopsis and Synechocystis 6803 proteins). The protein contains 36 to 38 amino acids in most species, with molecular masses ranging between 4.1 and 4.5 kDa. Synonymes: PSII-I, PSII 4.8 kDa protein
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Synechocystis sp. PCC 6803
Expected Species:
Cyanobacteria Species of your interest not listed? Contact us
Loads higher than 0,5 g of chlorophyll per well are not recommended
Application Details:
1 : 5000-1 : 10 000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 200 l of sterile water
Molecular Weight:
4.3 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Dobakova et. al (2007). Role of the PsbI Protein inPhotosystem II Assembly and Repair in the Cyanobacterium Synechocystis sp. PCC 6803 Plant Physiol 145:1681-1691.
The PsbI protein, previously named the 4.8-kDa protein, is encoded by the plastome. PsbI is a universal component of PSII and is highly conserved (e.g. there is 71% amino acid identicality between the Arabidopsis and Synechocystis 6803 proteins). The protein contains 36 to 38 amino acids in most species, with molecular masses ranging between 4.1 and 4.5 kDa. Synonymes: PSII-I, PSII 4.8 kDa protein
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Hordeum vulgare
Expected Species:
Cannabis sativa, Glycne max, Phaseolus vulgaris, Populus trichocarpa, Spinacia oleracea, Triticum aestivum, Zea mays Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from PsbI protein of Arabidopsis thaliana P62100, AtCg00080
Hackett et al. (2017). An Organelle RNA Recognition Motif Protein Is Required for Photosystem II Subunit psbF Transcript Editing. Plant Physiol. 2017 Apr;173(4):2278-2293. doi: 10.1104/pp.16.01623.
The PsbH protein was originally named 10- or 9-kDa phosphoprotein in higher plant chloroplasts. It is encoded by the plastome in algae and higher plants. PsbH is also present in cyanobacteria, where it exhibits 56% amino acid identity with the corresponding protein from Arabidopsis. The protein contains 63–90 amino acids, depending on the species, with molecular masses between 7.0 and 9.9 kDa.PsbH is an intrinsic membrane protein with a single transmembrane helix and its N-terminal region has been suggested to be exposed to the stromal side of the thylakoid membrane. Presence of PsbH already present in etiolated tissue can indicate that the protein may be involved in early stages of PSII assembly.Obtained biochemical data from PSII complexes isolated from spinach suggest that PsbH, together with other PSII phosphoproteins, may be required for D1 protein turnover by regulating dimeric and monomeric PSII transition through their phosphorylation and dephosphorylation.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
LMW proteins can sometimes interfere with chlorophyll, but most chlorophyll can be removed by precipitating sample in acetone before loading on a gel.Protocol: Add acetone to final concentration of 80% ice-cold acetone. Leave 10 minutes. Spin. Rresuspend pellet in solubilisation buffer and load on a gel.
Application Details:
1 : 5000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 100 µl of sterile water
Molecular Weight:
7.7 | 4 (Arabidopsis thaliana)
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Hackett et al. (2017). An Organelle RNA Recognition Motif Protein Is Required for Photosystem II Subunit psbF Transcript Editing. Plant Physiol. 2017 Apr;173(4):2278-2293. doi: 10.1104/pp.16.01623.Levey et al. (2014). Expression of a nuclear-encoded psbH gene complements the plastidic RNA processing defect in the PSII mutant hcf107 in Arabidopsis thaliana. Plant J. 2014 Oct;80(2):292-304. doi: 10.1111/tpj.12632. Epub 2014 Sep 8.Verhoeven et al. (2009). Seasonal changes in abundance and phosphorylation status of photosynthetic proteins in eastern white pine and balsam fir. Tree Physiol. 29:361-374.
Special application note:
This product can be sold containing ProClin if requested
Cytochrome b559 (Cyt b559) is encoded by the chloroplast genes psbE and psbF and is comprised of two low molecular mass polypeptides, α and subunits, with molecular masses of 9 and 4 kDa, respectively. The Cyt b559 is closely associated with PSII in all oxygenic photosynthetic organisms. The α and subunits of the Cyt b559 are components of the minimal PSII reaction center complex that is still capable of primary charge separation In summary, both PsbE and PsbF are essential components for PSII assembly, and they are probably involved in electron transport mechanisms that help to protect PSII from photodamage.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
This antibody works better on thylakoid and chloroplast fractions than on a total cell extract
Application Details:
1 : 1000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 200 l of sterile water
Molecular Weight:
4 kDa
Not reactive in:
Chlamydomonas reinhardtii, cyanobacteria
Selected references:
Hackett et al. (2017). An Organelle RNA Recognition Motif Protein Is Required for Photosystem II Subunit psbF Transcript Editing. Plant Physiol. 2017Yang-Er Chen et al. (2017). Responses of photosystem II and antioxidative systems to high light and high temperature co-stress in wheat. J. of Exp. Botany, Volume 135, March 2017, Pages 45–55.Nishimura et al. (2016). The N-terminal sequence of the extrinsic PsbP protein modulates the redox potential of Cyt b559 in photosystem II. Sci Rep. 2016 Feb 18;6:21490. doi: 10.1038/srep21490.Lucinski et al. (2011). Involvement of Deg5 protease in wounding-related disposal of PsbF apoprotein. Plant Physiol Biochem. 49(3):311-20.Garcia-Cerdan et al. (2008). Antisense inhibition of the PsbX protein affects PSII integrity in the higher plant Arabidopsis thaliana. Plant Cell Physiol 50: 191-202
Special application note:
This product can be sold containing ProClin if requested
PsbE (Cytochrome b559 subunit alpha) is tightly associated with the reaction center of photosystem II (PSII). Alternative name: PSII reaction center subunit V
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Synechocystis PCC 6803
Expected Species:
Bathycoccus prasinos, Capsosiphon fulvescens, Chlamydomonas sp., Gonium pectorale,Mesostigma viride, Microglena monadina, Nannochloropsis granulata,Neglectella solitaria, Ostreococcus tauri, Pandorina morum, Planctonema lauterbornii, Thermosynechococcus vulcanus, Tupiella akineta, Ulva lactuca, Volvulina compacta, Volvox africanus, Yamagishiella unicoccaSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from algal PsbE sequences, including Chlamydomonas reinhardtii PsbE UniProt: P48268
Cytochrome b559 (Cyt b559) is encoded by the chloroplast genes psbE and psbF and is comprised of two low molecular mass polypeptides, a and h subunits, with molecular masses of 9 and 4 kDa, respectively. The Cyt b559 is closely associated with PSII in all oxygenic photosynthetic organisms. The a and h subunits of the Cyt b559 are components of the minimal PSII reaction center complex that is still capable of primary charge separation In summary, both PsbE and PsbF are essential components for PSII assembly, and they are probably involved in electron transport mechanisms that help to protect PSII from photodamage. Alternative protein name: PSII reaction center subunit V
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Hackett et al. (2017). An Organelle RNA Recognition Motif Protein Is Required for Photosystem II Subunit psbF Transcript Editing. Plant Physiol. 2017 Apr;173(4):2278-2293. doi: 10.1104/pp.16.01623.Yang-Er Chen et al. (2017). Responses of photosystem II and antioxidative systems to high light and high temperature co-stress in wheat. J. of Exp. Botany, Volume 135, March 2017, Pages 45–55.Nishimura et al. (2016). The N-terminal sequence of the extrinsic PsbP protein modulates the redox potential of Cyt b559 in photosystem II. Sci Rep. 2016 Feb 18;6:21490. doi: 10.1038/srep21490.Grieco et al. (2015). Light-harvesting II antenna trimers connect energetically the entire photosynthetic machinery - including both photosystems II and I. Biochim Biophys Acta. 2015 Jun-Jul;1847(6-7):607-19. doi: 10.1016/j.bbabio.2015.03.004. Epub 2015 Apr 3.Hojka et al. (2014). Inducible repression of nuclear-encoded subunits of the cytochrome b6f complex in tobacco reveals an extraordinarily long lifetime of the complex. Plant Physiol. 2014 Jun 24. pii: pp.114.243741.
Special application note:
Cellular [compartment marker] of thylakoid membraneThis product can be sold containing ProClin if requested.
D2 protein (PsbD) forms the reaction core of PSII (Photosystem II) as a heterodimer with the D1 protein (PsbA). PsbD is homologous to the D1 protein, with slightly higher molecular mass of about 39,5 kDa. Accumulation of D2 protein is an important step in the assemply of the PSII reaction centre complex.This product is a recombinant protein standard, source Synechocystis strain PCC 6803.
Product Type:
Antibody
Format:
Lyophilized in glycerol
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Concentration: after adding 225 l of milliQ water final concentration of the standard is 0.25 pmoles/ulProtein standard buffer composition: Glycerol 10%, Tris Base 141 mM, Tris HCl 106 mM, LDS 2%, EDTA 0.51 mM, SERVA Blue G250 0.22 mM, Phenol Red 0.175 mM, pH 8.5, 0.1mg/ml PefaBloc protease inhibitor (Roche), 50mM DTT.This standard is ready-to-load and does not require any additions or heating. It needs to be fully thawed and thoroughly mixed prior to using. Avoid vigorous vortexing, as buffers contain detergent. Following mixing, briefly pulse in a microcentrifuge to collect material from cap.This standard is stabilized and ready and does not require heating before loading on the gel. Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Application Details:
Standard curve: 3 loads are recommended (0.5, 2 and 4μl).For most applications a sample load of 0.2 μg of chlorophyll will give a PsbD signal in this range.Positive control: a 2 μl load per well is optimal for most chemiluminescent detection systems. This standard is stabilized and ready and does not require heating before loading on the gel.Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Reconstitution:
For reconstitution add 225 l of sterile water, Please notice that this product contains 10% glycerol and might appear as liquid but is provided lyophilized
Molecular Weight:
In most gel systems PsbD migrates around 28-30 kDa
Selected references:
Partensky et al. (2018). Comparison of photosynthetic performances of marine picocyanobacteria with different configurations of the oxygen-evolving complex. Photosynth Res. 2018 Jun 25. doi: 10.1007/s11120-018-0539-3.Li et al. (2016). A Hard Day's Night: Diatoms Continue Recycling Photosystem II in the Dark. Front. Mar. Sci., 08 November 2016Li et al. (2014). The nitrogen costs of photosynthesis in a diatom under current and future pCO2. New Phytol. 2014 Sep 25. doi: 10.1111/nph.13037.
Special application note:
The PsbD protein standard can be used in combination with global anti-PsbD antibodies to quantitate PsbD from a wide range of species. Global antibodies are raised against highly conserved amino acid sequences in the PsbD protein.Quantitative western blot: detailed method description, video tutorial
D2 protein (PsbD) forms the reaction core of PSII (Photosystem II) as a heterodimer with the D1 protein (PsbA). PsbD is homologous to the D1 protein, with slightly higher molecular mass of about 39.5 kDa. Accumulation of D2 protein is an important step in the assemply of the PSII reaction centre complex.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
There is a confirmed cross-reaction with TLA1 protein in Chlamydomonas reinhardtii.For samples with a very low PSII content theremight be detection problems independent of the antibody. PSII proteins can vary in level depending upon liquid culture conditions. When the cells are in a stationary phase PSII content can drop to a very low level.
Application Details:
1: 10 000 (CN-PAGE), 1: 5000 - 1 : 50 000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
39,4 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Burlacot et al. (2022) Alternative photosynthesis pathways drive the algal CO2-concentrating mechanism. Nature 605, 366–371 (2022). https://doi.org/10.1038/s41586-022-04662-9Bychkov et al. (2022) The role of PAP4/FSD3 and PAP9/FSD2 in heat stress responses of chloroplast genes. Plant Sci. 2022 Sep;322:111359. doi: 10.1016/j.plantsci.2022.111359. Epub 2022 Jun 20. PMID: 35738478.Mazur et al. (2021) The SnRK2.10 kinase mitigates the adverse effects of salinity by protecting photosynthetic machinery. Plant Physiol. 2021 Dec 4;187(4):2785-2802. doi: 10.1093/plphys/kiab438. PMID: 34632500; PMCID: PMC8644180.von Bismarck et al. (2021) Light acclimation interacts with thylakoid ion transport to govern the dynamics of photosynthesis. Research Square; 2021. DOI: 10.21203/rs.3.rs-948381/v1.Cecchin et al (2021) LPA2 protein is involved in photosystem II assembly in Chlamydomonas reinhardtii. Plant J. 2021 Jul 4. doi: 10.1111/tpj.15405. Epub ahead of print. PMID: 34218480.
Special application note:
The peptide used to elicit this antibody has a perfect conservation across all full-length PsbD sequences from higher plants, lower plants, cyanobacteria and unicellular algae except: minor substitutions in some Prochlorococcus & Dinoflagellate sequences, The antibody should still work against these taxa, but it has not been tested yet, This antibody does not detect PsbA protein (D1),This product can be sold containing ProClin if requested
PsbC (CP43) acts as an antenna to the PSII core and its presence seem to be also necessary for maintaining water splitting activity. This protein is more weakly associated with the PSII reaction centre and can be removed from the isolated core.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
In C4 plants like Echinochloa crus-galli and Zea mays antibody detects 2 bands.
Application Details:
1 : 3 000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
45 | 43 kDa
Not reactive in:
diatoms
Selected references:
Beckova et al. (2022). Photosystem II antenna modules CP43 and CP47 do not form a stable 'no reaction centre complex' in the cyanobacterium Synechocystis sp. PCC 6803. Photosynth Res. 2022 Jan 11. doi: 10.1007/s11120-022-00896-w. Epub ahead of print. PMID: 35015206.Cecchin et al (2021) LPA2 protein is involved in photosystem II assembly in Chlamydomonas reinhardtii. Plant J. 2021 Jul 4. doi: 10.1111/tpj.15405. Epub ahead of print. PMID: 34218480.Okegawa et al (2021) Maintaining the Chloroplast Redox Balance Through the PGR5-Dependent Pathway and the Trx System is Required for Light-Dependent Activation of Photosynthetic Reactions. Plant Cell Physiol. 2021 Oct 8:pcab148. doi: 10.1093/pcp/pcab148. Epub ahead of print. PMID: 34623443.Sakuraba at al. (2020). Multilayered regulation of membrane-bound ONAC054 is essential for abscisic acid-induced leaf senescence in rice. Plant Cell. 2020 Jan 6. pii: tpc.00569.2019. doi: 10.1105/tpc.19.00569.Dong et al. (2020). Plastid ribosomal protein LPE2 is involved in photosynthesis and the response to C/N balance in Arabidopsis thaliana. J Integr Plant Biol. 2020 Jan 15. doi: 10.1111/jipb.12907.
PsbB (CP47) is a chlorophyll-binding protein located in the membrane, where it serves as the core antenna of Photosystem II.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
This product can be sold containing ProClin if requestedin bis-tris gel systems PsbB protein migrates between 40-45 kDa
Application Details:
1: 10 000 (CN-PAGE), 1 : 2000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
56 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Vidal-Meireles, et al. (2023)The lifetime of the oxygen-evolving complex subunit PSBO depends on light intensity and carbon availability in Chlamydomonas. Plant Cell Environ. 2023;46(2):422-439. doi:10.1111/pce.14483Miernicka et al. (2022) The Adjustment Strategy of Venus Flytrap Photosynthetic Apparatus to UV-A Radiation. Cells. 2022;11(19):3030. Published 2022 Sep 27. doi:10.3390/cells11193032Konert et al (2022). High-light-inducible proteins HliA and HliB: pigment binding and protein-protein interactions. Photosynth Res. 2022 Jun;152(3):317-332. doi: 10.1007/s11120-022-00904-z. Epub 2022 Feb 26. PMID: 35218444.Guardini et al. (2022). Loss of a single chlorophyll in CP29 triggers re-organization of the Photosystem II supramolecular assembly. Biochim Biophys Acta Bioenerg. 2022 Jun 1;1863(5):148555. doi: 10.1016/j.bbabio.2022.148555. Epub 2022 Apr 2. PMID: 35378087.Xiong et al. (2022) a chloroplast nucleoid protein of bacterial origin linking chloroplast transcriptional and translational machineries, is required for proper chloroplast gene expression in Arabidopsis thaliana. Nucleic Acids Res. 2022 Jun 23;50(12):6715-34. doi: 10.1093/nar/gkac501. Epub ahead of print. PMID: 35736138; PMCID: PMC9262611.
Special application note:
This antibody can be used as a loading control for studies of PSIi or photosynthetic acclimation in diatoms Blommaert et al. 2017. Limnol. Oceanogr. DOI: 10.1002/lno.10511.This product can be sold containing ProClin if requested.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples.This is a recombinant protein standard, source: Synechocystis PCC 6803.
Product Type:
Antibody
Format:
Lyophilized in glycerol.
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Concentration: after adding 95 l of sterile milliQ water final concentration of the standard is 0.25 pmoles/ lProtein standard buffer composition: Glycerol 10%, Tris Base 141 mM, Tris HCl 106 mM, LDS 2%, EDTA 0.51 mM, SERVA Blue G250 0.22 mM, Phenol Red 0.175 mM, pH 8.5, 0.1mg/ml PefaBloc protease inhibitor (Roche), 50mM DTT.This standard is ready-to-load and does not require any additions or heating. It needs to be fully thawed and thoroughly mixed prior to using. Avoid vigorous vortexing, as buffers contain detergent. Following mixing, briefly pulse in a microcentrifuge to collect material from cap.This standard is stabilized and ready and does not require heating before loading on the gel. Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Application Details:
Standard curve: 3 loads are recommended (0.5, 2 and 4μl).For most applications a sample load of 0.2 μg of chlorophyll will give a PsbA signal in this range.Positive control: a 2 μl load per well is optimal for most chemiluminescent detection systems.Non-disulphie dependent dimers and complexes can be also detected using standard western blot methods with more sensitive detection reagents as ECL Advance or West Pico when loading per well more standard than recommended. They have not been included in the standard calibration.This standard is stabilized and ready and does not require heating before loading on the gel. Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Reconstitution:
For reconstitution add 95 l of sterile water, Please notice that this product contains 10% glycerol and might appear as liquid but is provided lyophilized
Molecular Weight:
The standard has an actual MW of 41,5 kDa, The presence of a His6 tag causes it to run ~1,7 kDa higher on the gel than the native protein, Note that in most systems, PsbA migrates with an apparent MW of between 30 and 35 kDa,
Selected references:
Pipitone et al. (2021). A multifaceted analysis reveals two distinct phases of chloroplast biogenesis during de-etiolation in Arabidopsis. Elife. 2021 Feb 25;10:e62709. doi: 10.7554/eLife.62709. PMID: 33629953; PMCID: PMC7906606.Fern ndez-Gonz lez et al. (2020). Effects of Temperature and Nutrient Supply on Resource Allocation, Photosynthetic Strategy, and Metabolic Rates of Synechococcus Sp . J Phycol . 2020 Mar 4. doi: 10.1111/jpy.12983. Levitan et al. (2019). Structural and functional analyses of photosystem II in the marine diatom Phaeodactylum tricornutum. Proc Natl Acad Sci U S A. 2019 Aug 27;116(35):17316-17322. doi: 10.1073/pnas.1906726116.Ryan-Keogh et al. (2018). Seasonal regulation of the coupling between photosynthetic electron transport and carbon fixation in the Southern Ocean. Limnology and Oceanography.Yuan et al. (2018). Combined effects of ocean acidification and warming on physiological response of the diatom Thalassiosira pseudonana to light challenges. Mar Environ Res. 2018 Apr;135:63-69. doi: 10.1016/j.marenvres.2018.01.016.
Special application note:
The PsbA protein standard can be used in combination with global anti-PsbA antibodies to quantitate PsbA from a wide range of species. Global antibodies are raised against highly conserved amino acid sequences in the PsbA protein.Quantitative western blot: detailed method description, video tutorialThe goals when doing quantitative work:The sample PsbA must fall somewhere between the upper and lower standard loads. There should be at least 3 points on the standard curve.if possible, try to make the entire range of the curve around one order of magnitude or less (as in the application example).if possible, load <5 g total sample protein.1pmol of PsbA standard is a strong load for chemiluminescence, but may be appropriate for the less sensitive reagents, for example alkaline phosphatase.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Dictos, Conifers, Monocts Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant PsbA sequences with phosphorylated (T), including Arabidopsis thaliana UniProt: P83755, TAIR:AtCg00020, Oryza sativa P0C434 and other higher plant PsbA sequences
This antibody is detecting phosphorylated PsbA protein.Antibodies are purified on a non-phosphorylated peptide.
Application Details:
1 : 10 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
Cyanobacteria
Selected references:
Mazur et al. (2021) The SnRK2.10 kinase mitigates the adverse effects of salinity by protecting photosynthetic machinery. Plant Physiol. 2021 Dec 4;187(4):2785-2802. doi: 10.1093/plphys/kiab438. PMID: 34632500; PMCID: PMC8644180.Upadhyaya and Jagadeeshwar Rao (2019). Reciprocal regulation of photosynthesis and mitochondrial respiration by TOR kinase in Chlamydomonas reinhardtii. Plant Direct Volume 3, Issue 11.Xing et al. (2017). Deletion of CGLD1 Impairs PSII and Increases Singlet Oxygen Tolerance of Green Alga Chlamydomonas reinhardtii. Front. Plant Sci., 15 December 2017. https://doi.org/10.3389/fpls.2017.02154.Li et al. (2015). Effect of hydrogen sulfide on D1 protein in wheat under drought stress. Acta Physiologiae Plantarum November 2015, 37:225.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Algae (brown and red), Conifers, Cyanobacteria, Brassica napus, Diatoms, Glycine max, Manihot esculenta, Medicago truncatula, Nicotiana tabacum, Oryza sativa, Phaseolus vulgaris, Pisum sativum, Solanum lycopersicum, Solanum tuberosum, Spinacia oleracea, Triticum aestivum, Zea mays, Vitis vinifera Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from N-terminal of available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel
Application Details:
1 : 1000-1 : 10 000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Chen et al. (2021)Degradation of the photosystem II core complex is independent of chlorophyll degradation mediated by Stay-Green Mg2+ dechelatase in Arabidopsis,Plant Science,Volume 307,2021,110902,ISSN 0168-9452,https://doi.org/10.1016/j.plantsci.2021.110902. Fukura et al. (2021) Enrichment of chlorophyll catabolic enzymes in grana margins and their cooperation in catabolic reactions. J Plant Physiol. 2021 Nov;266:153535. doi: 10.1016/j.jplph.2021.153535. Epub 2021 Sep 25. PMID: 34607178.Terentyev (2020: The Main Structural and Functional Characteristics of Photosystem-II-Enriched Membranes Isolated From Wild Type and cia3 Mutant Chlamydomonas reinhardtii. Life (Basel). 2020 May 14;10(5):E63. doi: 10.3390/life10050063..G recka et al. (2019). Photosystem II 22kDa protein level a prerequisite for excess light-inducible memory, cross-tolerance to UV-C, and regulation of electrical signalling. Plant Cell Environ. 2019 Nov 23. doi: 10.1111/pce.13686.Liu et al. (2018). Effects of PSII Manganese-Stabilizing Protein Succinylation on Photosynthesis in the Model Cyanobacterium Synechococcus sp. PCC 7002. Plant Cell Physiol. 2018 Jul 1;59(7):1466-1482. doi: 10.1093/pcp/pcy080.
Special application note:
Peptide target used for antibody production comes from Helix 1 of PSII, lumenal exposed loop. Antibodies are going to recognize the target in a wide range of species.This product can be sold containing ProClin if requested.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Cucumis sativus, Glycine max, Nannochloropsis sp., Oryza sativa, Populus balsamifera, Ricinus communis, Zea mays, Vitis viniferaSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide, amino acids 234-242 of Arabidopsis thaliana D1 protein UniProt: P83755, TAIR:AtCg00020
Antibody is recognizing a 23 kDa fragment in spinach and Arabidopsis thylakoidsfor usage on total cell extracts the dilution needs to be determined experimentally
Application Details:
1 : 10 000, thylakoid fraction (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Lu et al. (2021). Role of an ancient light-harvesting protein of PSI in light absorption and photoprotection. Nat Commun. 2021 Jan 29;12(1):679. doi: 10.1038/s41467-021-20967-1. PMID: 33514722; PMCID: PMC7846763. (blue-native PAGE)Mazur et al. (2021) The SnRK2.10 kinase mitigates the adverse effects of salinity by protecting photosynthetic machinery. Plant Physiol. 2021 Dec 4;187(4):2785-2802. doi: 10.1093/plphys/kiab438. PMID: 34632500; PMCID: PMC8644180.Rantala et al. (2020). PGR5 and NDH-1 systems do not function as protective electron acceptors but mitigate the consequences of PSI inhibition. Biochim Biophys Acta Bioenerg. 2020 Jan 11;1861(3):148154. doi: 10.1016/j.bbabio.2020.148154.Grieco et al. (2020). Adjustment of photosynthetic activity to drought and fluctuating light in wheat. Plant Cell Environ. 2020 Mar 16. doi: 10.1111/pce.13756. Rantala and Tikkanen et al. (2018). Phosphorylation?induced lateral rearrangements of thylakoid protein complexes upon light acclimation. Plant Direct Vol. 2, Issue 2.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Algae (brown and red), Brassica napus, Conifers, Cyanobacteria, Dictos, Cannabis sativa, Galdieria sulphuraria, Lactuca sativa, Lycopersicum esculentum, Medicago sativa, Nannochloropsis sp., Oryza sativa, Ostreococcus sp. Pisum sativum, Sesamum indicum, Thalassiosira pseudonana, Zosteria marina, Vitis vinifera cellular [compartment marker] of thylakoid membraneSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
Applications:
Immunofluorescence (IF), ImmunoGold (IG), Western blot (WB)
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions. In our analysis we have seen both, ca. 24 kDa and ca. 10 kDa fragments from different samples, depending on treatments and isolation procedures.Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e.g. precursor and mature protein as compare to the hen anti-PsbA antibodies AS01 016.This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel.The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43.The peptide is conserved in cyanobacterial D1:1 and D1;2.
Application Details:
1: 500 (IF), 1: 200 (IG), 1 : 10 000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Ivanov et al. (2022) The decreased PG content of pgp1 inhibits PSI photochemistry and limits reaction center and light-harvesting polypeptide accumulation in response to cold acclimation. Planta 255, 36 (2022). https://doi.org/10.1007/s00425-022-03819-0Byeon et al. (2022) Canopy height affects the allocation of photosynthetic carbon and nitrogen in two deciduous tree species under elevated CO2. J Plant Physiol. 2022 Jan;268:153584. doi: 10.1016/j.jplph.2021.153584. Epub 2021 Dec 2. PMID: 34890847.Ye et al. (2022) Effect of increased CO2 on iron-light-CO2 co-limitation of growth in a marine diatom, ASLO, Limnol. Oceanogr. 2022, 172-176Pavlovic & Kocab. (2021) Alternative oxidase (AOX) in the carnivorous pitcher plants of the genus Nepenthes: what is it good for? Ann Bot. 2021 Dec 18:mcab151. doi: 10.1093/aob/mcab151. Epub ahead of print. PMID: 34922341.Cano-Ramirez et al. (2021) M. Plasma Membrane Fluidity: An Environment Thermal Detector in Plants. Cells. 2021 Oct 17;10(10):2778. doi: 10.3390/cells10102778. PMID: 34685758; PMCID: PMC8535034.
Special application note:
Due to biology of PsbA (D1) protein a number of degradation products can apprear in a sample and may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands.Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.This product can be sold containing ProClin if requested.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
Algae (brown and red), Dictos, Conifers, Cyanobacteria, Medicago sativa, Nannochloropsis sp., Pisum sativum, Triticum aestivum, cellular [compartment marker] of thylakoid membrane. Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions. In our analysis we have seen both, ca. 24 kDa and ca. 10 kDa fragments from different samples, depending on treatments and isolation procedures.Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e.g. precursor and mature protein as compare to the hen anti-PsbA antibodies AS01 016.This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel.The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43.
Application Details:
1 : 15 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to HRP.
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Thurotte et al. (2020). DnaK3 Is Involved in Biogenesis and/or Maintenance of Thylakoid Membrane Protein Complexes in the Cyanobacterium Synechocystis Sp. PCC 6803. Life (Basel). 2020 Apr 30;10(5):E55. doi: 10.3390/life10050055.
Special application note:
Due to biology of PsbA (D1) protein a number of degradation products can apprear in a sample and may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands.Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Algae (brown and red), Brassica napus, Conifers, Cyanobacteria, Dictos, Manihot esculenta, Medicago sativa, Nannochloropsis sp., Pisum sativum, Triticum aestivum, cellular [compartment marker] of thylakoid membrane.Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions. In our analysis we have seen both, ca. 24 kDa and ca. 10 kDa fragments from different samples, depending on treatments and isolation procedures.Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e.g. precursor and mature protein as compare to the hen anti-PsbA antibodies AS01 016.This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel.The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43.
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to FITC.
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
PsbA | D1 protein of PSII, C-terminal, FITC conjugated
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria, The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II, PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts, Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples, Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Algae (brown and red), Dictos, Conifers, Cyanobacteria, Medicago sativa, Nannochloropsis sp., Pisum sativum, Triticum aestivum, cellular [compartment marker] of thylakoid membrane.Species of your interest not listed? Contact us
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions, In our analysis we have seen both, ca, 24 kDa and ca, 10 kDa fragments from different samples, depending on treatments and isolation procedures,Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e,g, precursor and mature protein as compare to the hen anti-PsbA antibodies AS01 016,This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel,The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43,
Application Details:
To be determined by end user
Purity:
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 650.
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known,
Selected references:
To be added when available. Antibody released in May 2023.
Special application note:
Due to biology of PsbA (D1) protein a number of degradation products can apprear in a sample and may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands,Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.DyLight 650 has Amax = 652 nm, Emax = 672 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II, PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Algae (brown and red), Dictos, Conifers, Cyanobacteria, Medicago sativa, Nannochloropsis sp., Pisum sativum, Triticum aestivum, cellular [compartment marker] of thylakoid membrane.Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions, In our analysis we have seen both, ca, 24 kDa and ca, 10 kDa fragments from different samples, depending on treatments and isolation procedures,Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e,g, precursor and mature protein as compare to the hen anti-PsbA antibodies AS01 016,This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel,The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43,
Application Details:
To be determined by end user
Purity:
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 594.
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known,
Selected references:
To be added when available. Antibody release in May 2023.
Special application note:
Due to biology of PsbA (D1) protein a number of degradation products can apprear in a sample and may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands,Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.DyLight 594 has Amax = 593 nm, Emax = 618 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7.4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Algae (brown and red), Dictos, Conifers, Cyanobacteria, Medicago sativa, Nannochloropsis sp., Pisum sativum, Triticum aestivum, cellular [compartment marker] of thylakoid membrane.Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions. In our analysis we have seen both, ca, 24 kDa and ca, 10 kDa fragments from different samples, depending on treatments and isolation procedures. Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e.g. precursor and mature protein as compare to the hen anti-PsbA antibodies AS01 016. This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel,The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43.
Application Details:
To be determined by end user
Purity:
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 488.
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known.
Selected references:
To be added when available. Antibody release in May 2023.
Special application note:
Due to biology of PsbA (D1) protein a number of degradation products can apprear in a sample and may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands. Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.DyLight 488 Amax = 493 nm, Emax = 519 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
The PsbA (D1) protein of Photosystem II is rapidly cycled under illumination in all oxygenic photobionts. Disruption of PsbA cycling or losses of PsbA pools are central to photoinhibition of photosynthesis in cyanobacteria, algae and plants under a wide range of conditions including excess light, low temperature and UV exposure. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4 C; make aliquots to avoid working with a stock. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Algae (brown and red), Conifers, Cryptomonads, Legumes, Stramenopiles, Euglenoids, Prochlorophytes, XantophytesSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions.In our analysis we have seen both, ca. 24 kDa and ca. 10 kDa fragments from different samples, depending on treatments and isolation procedures.This antibody will also detect the phosphorylated form of D1as an alternate band to the main band on a high resolution gel.
Application Details:
1 :4000-1 : 8000, 5 g of total protein, (WB)
Purity:
Purified, total IgY (chicken egg yolk immunoglobulin) in PBS pH 8. Contains 0.02 % sodium azide.
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Vitale et al.(2022) Manipulation of light quality is an effective tool to regulate photosynthetic capacity and fruit antioxidant properties of Solanum lycopersicum L. cv. 'Microtom' in a controlled environment. PeerJ. 2022;10:e13677. Published 2022 Jul 1. doi:10.7717/peerj.13677Toubiana et al. (2020). Correlation-based Network Analysis Combined With Machine Learning Techniques Highlight the Role of the GABA Shunt in Brachypodium Sylvaticum Freezing Tolerance. Sci Rep , 10 (1), 4489Sicora et al. (2019). Regulation of PSII function in Cyanothece sp. ATCC 51142 during a light-dark cycle. Photosynth Res. 2019 Mar;139(1-3):461-473. doi: 10.1007/s11120-018-0598-5,Sevilla et al. (2019). Regulation by FurC in Anabaena links the oxidative stress response to photosynthetic metabolism. Plant Cell Physiol. 2019 May 21. pii: pcz094. doi: 10.1093/pcp/pcz094.Figlioli et al. (2019). Overall plant responses to Cd and Pb metal stress in maize: Growth pattern, ultrastructure, and photosynthetic activity. Environ Sci Pollut Res Int. 2019 Jan;26(2):1781-1790. doi: 10.1007/s11356-018-3743-y.
Special application note:
A number of degradation products may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands. Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.Example of a simulataneous western blot detection with RbcL, PsbA and PsaC antibodies.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
Algae (brown and red), Dictos, Conifers, Cyanobacteria, Medicago sativa, Nannochloropsis sp., Pisum sativum, Triticum aestivum, cellular [compartment marker] of thylakoid membraneSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions. In our analysis we have seen both, ca. 24 kDa and ca. 10 kDa fragments from different samples, depending on treatments and isolation procedures.Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e.g. precursor and mature protein as compare to the chicken anti-PsbA antibodies AS01 016.This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel.The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43.
Application Details:
1 : 15 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to biotin.
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Due to biology of PsbA (D1) protein a number of degradation products can apprear in a sample and may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands.Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
Algae (brown and red), Dictos, Conifers, Cyanobacteria, Medicago sativa, Nannochloropsis sp., Pisum sativum, Triticum aestivum, cellular [compartment marker] of thylakoid membrane Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions. In our analysis we have seen both, ca. 24 kDa and ca. 10 kDa fragments from different samples, depending on treatments and isolation procedures.Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e.g. precursor and mature protein as compare to the chicken anti-PsbA antibodies AS01 016.This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel.The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43.
Application Details:
1 : 15 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to ALP.
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Due to biology of PsbA (D1) protein a number of degradation products can apprear in a sample and may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands.Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Algae (brown and red), Brassica napus, Conifers, Cyanobacteria, Dictos, Manihot esculenta, Medicago sativa, Nannochloropsis sp., Pisum sativum, Triticum aestivum, cellular [compartment marker] of thylakoid membrane. Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions. In our analysis we have seen both, ca. 24 kDa and ca. 10 kDa fragments from different samples, depending on treatments and isolation procedures.Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e.g. precursor and mature protein as compare to the hen anti-PsbA antibodies AS01 016.This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel.The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43.
Application Details:
1 : 15 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Wada et al. (2021) Identification of a Novel Mutation Exacerbated the PSI Photoinhibition in pgr5/pgrl1 Mutants; Caution for Overestimation of the Phenotypes in Arabidopsis pgr5-1 Mutant. Cells. 2021 Oct 26;10(11):2884. doi: 10.3390/cells10112884. PMID: 34831107; PMCID: PMC8616342.Sorrentino et al. (2018). Performance of three cardoon cultivars in an industrial heavy metal-contaminated soil: Effects on morphology, cytology and photosynthesis. J Hazard Mater. 2018 Jun 5;351:131-137. doi: 10.1016/j.jhazmat.2018.02.044.Kanazawa et al. (2017). Chloroplast ATP Synthase Modulation of the Thylakoid Proton Motive Force: Implications for Photosystem I and Photosystem II Photoprotection. Front Plant Sci. 2017 May 3;8:719. doi: 10.3389/fpls.2017.00719.Li et al. (2016). A Hard Day's Night: Diatoms Continue Recycling Photosystem II in the Dark. Front. Mar. Sci., 08 November 2016
Special application note:
Due to biology of PsbA (D1) protein a number of degradation products can apprear in a sample and may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands.Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.
PSB33 or TEF5 is a Rieske (2Fe-2S) domain-containing protein located in chloroplast thylakoid membrane. The protein has oxireductase activity and is involved in oxidation reaction.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Oryza sativa
Expected Species:
Species of your interest not listed? Contact us
Immunogen:
part of Arabidopsis thaliana recombinant TEF5 protein, corresponding to epitopes 61-242, UniProt: Q9C9I7 , TAIR: At1g71500
This product can be sold with ProClin if requested
Application Details:
1 : 4000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
31 | 25 kDa (without transit peptide)
Not reactive in:
Chlamydomonas reinhardii
Selected references:
Kato et al. (2017). Deficiency of the Stroma-Lamellar Protein LIL8/PSB33 Affects Energy Transfer Around PSI in Arabidopsis. Plant Cell Physiol. 2017 Nov 1;58(11):2026-2039. doi: 10.1093/pcp/pcx124.Fristedt et al. (2017). PSB33 sustains photosystem II D1 protein under fluctuating light conditions. Journal of Experimental Botany doi:10.1093/jxb/erx218.Dixit (2015). Sulfur alleviates arsenic toxicity by reducing its accumulation and modulating proteome, amino acids and thiol metabolism in rice leaves. Sci Rep. 2015 Nov 10;5:16205. doi: 10.1038/srep16205.Fristedt at al. (2014). PSB33, a protein conserved in the plastid lineage, is associated with the chloroplast thylakoid membrane and provides stability to Photosystem II supercomplexes in Arabidopsis. Plant Physiol. Dec, 2014, open access.
Psb29 (THF1) is a conserved 22 kDa protein which functions in biogenesis of photosystem II complexes. This protein is required for organization of vesicles into mature thylakoid stacks for chloroplast development. Mediates G-protein signalling between the plasma membrane and the plastid.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Nicotiana tabacum, Oryza sativa, Ostreococcus sp., Picea sitcHensis, Populus balsamifera, Physcomitrium patens, Solanum lycopersicum, Solanum tuberosumSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from known sequences of Psb29 including Arabidopsis thaliana Q9SKT0, At2g20890
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Hamel et al. (2016). The chloroplastic protein THF1 interacts with the coiled-coil domain of the disease resistance protein N' and regulates light-dependent cell death. Plant Physiol. 2016 Mar 7. pii: pp.00234.2016Huang et al. (2013). Arabidopsis Thylakoid Formation 1 Is a Critical Regulator for Dynamics ofPSII-LHCII Complexes in Leaf Senescence and Excess Light. Mol Plant. May 13.
Psb27-H1 (Photosystem II repair protein 27) is involved in repair of photodamaged photosystem II (PSII). Localized in the chloroplast lumen, and involved in cellular response to light intensity. Alternative name: Thylakoid lumenal protein PSB27-H1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica oleracea, Brassica rapa,Capsella rubella, Coffea arabica,Camellia sinensis,Cucurbita pepo subsp. pepo, Erythranthe guttata,Gossypium hirsutum, Hevea brasiliensis, Hibiscus syriacu,Morus notabilis, Populus alba, Populus trichocarpa,Raphanus sativus, Quillaja saponaria Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana PSB27-H1 protein sequence, UniProt: Q9LR64, TAIR: At1g03600
Freshly extracted samples are recommended for the analysis. For protein transfer, use a membrane with a pore size of 0.2 m to secure that the protein will transfer correctly, as described here.
Application Details:
1 : 1000 (WB)
Purity:
Antigen affinity purified serum, in PBS pH 7.4
Reconstitution:
For reconstitution, add 50 l, of sterile or deionized water.
Molecular Weight:
18.8 | 11.7 | kDa (due to terminal processing)
Not reactive in:
Chlamydomonas reinhardtii
Selected references:
To be added when available, antibody available in April 2023.
Prostate-Specific Antigen (PSA) is a serine protease of the kallikrein family that is produced by the prostate epithelium and epithelial lining of the periurethral glands. Although considered prostate-specific, PSA has also been detected in breast tissue, breast tumours, endometrium, adrenal neoplasms, and renal cell carcinomas. Anti-PSA can be used for differentiating high-grade prostate adenocarcinoma from high-grade urothelial carcinoma, as well as for determining the prostatic origin of carcinomas in non-prostate tissues. Anti-PSA recognizes primary and metastatic prostatic neoplasms, but not tumours of nonprostatic origin, and can be useful as an aid to confirm prostatic acinar cell origin in primary and metastatic carcinomas.
Prostatic Specific Acid Phosphatase (PSAP) is a prostatic enzyme found in the glandular epithelium of the prostate. PSAP levels are elevated in hyperplastic prostate and prostate carcinoma, with the highest levels being detected in metastasized prostate cancer. Moderate overexpression of PSAP is also characteristic of diseases of the bone (such as Paget's disease or hyperparathyroidism), diseases of blood cells (such as sickle-cell disease), multiple myeloma, or lysosomal storage diseases (such as Gaucher's disease). PSAP is considered more sensitive, yet less specific, than PSA, however Anti-PSAP can act as a useful complement to Anti-PSA under suitable clinical contexts.
Prostatic Specific Acid Phosphatase (PSAP) is a prostatic enzyme found in the glandular epithelium of the prostate. PSAP levels are elevated in hyperplastic prostate and prostate carcinoma, with the highest levels being detected in metastasized prostate cancer. Moderate overexpression of PSAP is also characteristic of diseases of the bone (such as Paget's disease or hyperparathyroidism), diseases of blood cells (such as sickle-cell disease), multiple myeloma, or lysosomal storage diseases (such as Gaucher's disease). PSAP is considered more sensitive, yet less specific, than PSA, however Anti-PSAP can act as a useful complement to Anti-PSA under suitable clinical contexts.
Prostatic Specific Acid Phosphatase (PSAP) is a prostatic enzyme found in the glandular epithelium of the prostate. PSAP levels are elevated in hyperplastic prostate and prostate carcinoma, with the highest levels being detected in metastasized prostate cancer. Moderate overexpression of PSAP is also characteristic of diseases of the bone (such as Paget's disease or hyperparathyroidism), diseases of blood cells (such as sickle-cell disease), multiple myeloma, or lysosomal storage diseases (such as Gaucher's disease). PSAP is considered more sensitive, yet less specific, than PSA, however Anti-PSAP can act as a useful complement to Anti-PSA under suitable clinical contexts.
PsaO - photosystem I subunit O. The mature PsaO is a 10-kDa protein with two transmembrane helices. It has no counterpart in Photosystem I of cyanobacteria but seems to be present in higher plants, in mosses, and in green algae.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Spinacia oleracea
Immunogen:
fusion protein between DHFR and the mature part of PSI-O of Arabidopsis thaliana UniProt: Q949Q5TAIR: At1g08380
Jensen et al. (2004) The PSI-O subunit of plant photosystem I is involved in balancing the excitation pressure between the two photosystems. J. Biol. Chem. 279: 24212-24217.
Photosystem I (PSI) of chloroplasts is a multisubunit membrane-protein complex that catalyzes the electron transfer from the reduced plastocyanin (or cytochrome c6) in the thylakoid lumen to the oxidized ferredoxin (or flavodoxin) in the chloroplast stroma. PsaN is necessary for docking plastocyanin to the PSI complex. PSI-N is the only subunit located entirely on the lumenal side of PSI.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophikized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Hansson et al. (2007). Knock-out of the chloroplast encoded PSI-J Subunit of Photosystem I in Nicotiana tabacum: PSI-J is required for efficient electron transfer and stable accumulation of photosystem I. FEBS J. 274: 1734-1746.
PsaL (PSI-L) is a conserved subunit of type I photosynthetic reaction centers (Photosystem I, PSI). PSI is an integral membrane multi-protein complex that catalyzes the electron transfer from plastocyanin (or cytochrome c6) to ferredoxin (or flavodoxin). Psa-L is binding pigments and has been shown to be involved in trimerization of PSI in cyanobacteria (but not in plants) and bind pigments in plants and cyanobacteria.In plants and algae Psa-L is nuclear encoded and imported post-translationally into the chloroplast where it inserts into the thylakoid membrane.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Nicotiana benthamiana, Monocots (Zea mays)Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from PsaL protein sequence from Arabidopsis thaliana (At4g12800). This sequence is well conserved in most mono- and dicots but not in Physcomitrella patens.
Wang et al. (2020). Post-translational coordination of chlorophyll biosynthesis and breakdown by BCMs maintains chlorophyll homeostasis during leaf development. Nat Commun. 2020; 11: 1254. Koh et al. (2019). Heterologous synthesis of chlorophyll ? b ? in ? Nannochloropsis salina ? enhances growth and lipid production by increasing photosynthetic efficiency. Biotechnol Biofuels. ? 2019 May 14;12:122. doi: 10.1186/s13068-019-1462-3. eCollection 2019.Sch ttler et al. (2017). The plastid-encoded PsaI subunit stabilizes photosystem I during leaf senescence in tobacco. J Exp Bot. ? 2017 Feb 1;68(5):1137-1155. doi: 10.1093/jxb/erx009.Sook Seok et al. (2013). AtFKBP16-1, a chloroplast lumenal immunophilin, mediates response to photosynthetic stress by regulating PsaL stability. Physiologia Plantarum, DOI: 10.1111/ppl.12116.Bock (2012). The plastid genome-encodedYcf4 protein functions as a non-essential assembly factor for photosystem I in higher plants. Plant Physiol. ahead of print.
PsaK is a subunit of photosystem I. It has a role in organizing the peripheral light-harvesting complexes on the core antenna of photosystem I. Alternative names: photosystem I subunit X, PSI-K
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Bock (2012). The plastid genome-encodedYcf4 protein functions as a non-essential assembly factor for photosystem I in higher plants. Plant Physiol. ahead of print.
PsaH (PSI-H) is a conserved subunit of type I photosynthetic reaction centers (Photosystem I, PSI). PSI is an integral membrane multi-protein complex that catalyzes the electron transfer from plastocyanin (or cytochrome c6) to ferredoxin (or flavodoxin). Psa-H has been suggested to be involved in regulation of state1-state2 transitions. In plants and algae Psa-H is nuclear encoded and imported post-translationally into the chloroplast where it inserts into the thylakoid membrane.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Arachis hypogaea, Brassica rapa, Medicago truncatula, Nicotiana sylvestris, Nicotiana tabaccum, Populus trichocarpa, Ricinus communis Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from the protein sequence of Arabidopsis thaliana for PsaH1(At3g16240) and PsaH2 (At1g52230). This peptide sequence is quite conserved in some dicots but not in monocots.
Wang et al. (2017). The Phytol Phosphorylation Pathway Is Essential for the Biosynthesis of Phylloquinone, which Is Required for Photosystem I Stability in Arabidopsis.Mol Plant. 2017 Jan 9;10(1):183-196. doi: 10.1016/j.molp.2016.12.006.Schwarz et al. (2017). Photosystem I-LHCII megacomplexes respond to high light and aging in plants. Photosynth Res. 2017 Oct 3. doi: 10.1007/s11120-017-0447-y.Tiwari et al. (2016). Photodamage of iron–sulphur clusters in photosystem I induces non-photochemical energy dissipation. Nature Plants Article number: 16035 (2016) doi:10.1038/nplants.2016.35.
PsaH (PSI-H) is a conserved subunit of type I photosynthetic reaction centers (Photosystem I, PSI). PSI is an integral membrane multi-protein complex that catalyzes the electron transfer from plastocyanin (or cytochrome c6) to ferredoxin (or flavodoxin). Psa-H has been suggested to be involved in regulation of state1-state2 transitions. In plants and green algae Psa-H is nuclear encoded and imported post-translationally into the chloroplast where it inserts into the thylakoid membrane.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Nama et al. (2018). Non-photochemical quenching-dependent acclimation and thylakoid organization of Chlamydomonas reinhardtii to high light stress. Photosynth Res. 2018 Jul 7. doi: 10.1007/s11120-018-0551-7.Winck (2011). Nuclear proteomics and transcription factor profiling. Dissertation, University of Posdam.
PsaG is subunit located in the Photosystem I complex. It plats a role in stablizing the binding of the peripheral antenna. PsaG, together with PsaH and PsaN, are unique to higher plants and algae. Alternative names: PSI-G, light-harvesting complex I 10 kDa protein, P35 protein
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Expected Species:
Chlamydomonas reinhardtii
Immunogen:
fusion protein between DHFR and the mature part of Chlamydomonas PsaG, UniProt: P14224
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Nama et al. (2018). Non-photochemical quenching-dependent acclimation and thylakoid organization of Chlamydomonas reinhardtii to high light stress. Photosynth Res. 2018 Jul 7. doi: 10.1007/s11120-018-0551-7.
PsaG (PSI-G subunit of photosystem I) is a 11-kDa membrane protein that plays an important role in electron transport between plastocyanin and PSI and is involved in the stability of the PSI complex. PSI-G subunit is bound to PSI-B and is in contact with Lhca1. The protein inserts into thylakoids by a direct or "spontaneous" pathway that does not involve the activities of any known chloroplast protein-targeting machinery. PSI-G appears to be directly or indirectly involved in the interaction between Photosystem I and plastocyanin.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Chicken
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Medicago truncatula, Spinacia oleracea, Vitis viniferaSpecies of your interest not listed? Contact us
PsaF (PSI-F) is a conserved subunit of type I photosynthetic reaction centers (Photosystem I, PSI). PSI is an integral membrane multi-protein complex that catalyzes the electron transfer from plastocyanin (or cytochrome c6) to ferredoxin (or flavodoxin). PsaF has been shown to be involved in the orientation of the soluble electron donor. In plants PSI-F is nuclear encoded and imported post-translationally into the chloroplast where it inserts into the thylakoid membrane.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Catalpa bungei, Micromonas sp. , Populus trichocarpa, Physcomitrium patens, Ricinus communisSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from the PsaF protein sequence of Arabidopsis thaliana (At1g31330). This peptide sequence is not completely conserved in mono- and dicots.
Schmid et al. (2018). PUMPKIN, the sole Plastid UMP Kinase, Associates with Group II Introns and Alters Their Metabolism. Plant Physiol. 2018 Nov 8. pii: pp.00687.2018. doi: 10.1104/pp.18.00687.Patil et al. (2018). FZL is primarily localized to the inner chloroplast membrane however influences thylakoid maintenance. Plant Mol Biol. 2018 Jul;97(4-5):421-433. doi: 10.1007/s11103-018-0748-3.Myouga et al. (2018). Stable accumulation of photosystem II requires ONE-HELIX PROTEIN1 (OHP1) of the light harvesting-like family. Plant Physiol. 2018 Feb 1. pii: pp.01782.2017. doi: 10.1104/pp.17.01782.Kanazawa et al. (2017). Chloroplast ATP Synthase Modulation of the Thylakoid Proton Motive Force: Implications for Photosystem I and Photosystem II Photoprotection. Front Plant Sci. 2017 May 3;8:719. doi: 10.3389/fpls.2017.00719.Qin et al. (2014). Isolation and characterization of a PSI-LHCI super-complex and its sub-complexes from a siphonaceous marine green alga, Bryopsis Corticulans. Photosynth Res. 2014 Sep 12.
PsaF (PSI-F subunit of photosystem I) is a plastocyanin-docking protein, involved in electron transfer from plastocyanin to c553. Alternative names: PSI-F.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles, Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Immunogen:
PsaF of Chlamydomonas reinhardtii, UniProt: A8J4S1
PsaE is a nucleus encoded subunit of the Photosystem I reaction center. It is located on the stroma side and interacts with PsaF. PsaE may be involved in Fd reduction. Alternative name: Photosystem I 10.8 kDa polypeptide
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Hordeum vulgare, Oryza sativa
Expected Species:
Catalpa bungei, Nicotiana sylvestris, Zea mays Species of your interest not listed? Contact us
Immunogen:
10 kDa PSI-E protein purified from barley thylakoids corresponding to PSI-E protein of Horderum vulgare, UniProt: P13194
Yoshida et al. (2016). Hisabori T1.Two distinct redox cascades cooperatively regulate chloroplast functions and sustain plant viability. Proc Natl Acad Sci U S A. 2016 Jul 5;113(27):E3967-76. doi: 10.1073/pnas.1604101113. Epub 2016 Jun 22.Ye et al. (2012). A Mutation of OSOTP 51 Leads to Impairment of Photosystem I Complex Assembly and Serious Photo-damage in Rice. J Integr Plant Biol. Feb 2012.Yadavalli et al. (2012). Differential degradation of photosystem I subunits under iron deficiency in rice. J Plant Physiol. March 22.
PsaE (PSI-E subunit of photosystem I) assists in docking of the ferredoxin to PSI and stabilizes the interaction between PsaC and the PSI core. Alternative names: P30 protein, Photosystem I 8.1 kDa protein,Photosystem I reaction center subunit IV, chloroplastic, PSI-E.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles, Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Immunogen:
PsaE of Chlamydomonas reinhardtii, UniProt: P12352
PsaE is a nucleus encoded subunit of the Photosystem I reaction center. It is located on the stroma side and interacts with PsaF. PsaE may be involved in Fd reduction.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Hordeum vulgare
Expected Species:
Chlamydomonas reinhardtii, Chlorella, Oryza sativa, Populus canadensis, Solanum lycopersicum, Spinacia oleracea, Zea mays Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from PsaE N-terminal part, conserved in di and monocots and some green algae PsaE protein (not Chlamydomonas), including Arabidopsis thaliana PSI-E A Q9S831, At4g28750 and PSI-E B Q9S714, At2g20260
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Simakawa et al. (2020). Near-infrared in Vivo Measurements of Photosystem I and Its Lumenal Electron Donors With a Recently Developed Spectrophotometer. Photosynth Res. , 144 (1), 63-72 Li et al. (2018). Modulating plant growth-metabolism coordination for sustainable agriculture. Nature. 2018 Aug 15. doi: 10.1038/s41586-018-0415-5.Yang et al. (2017). Tetratricopeptide repeat protein Pyg7 is essential for photosystem I assembly by interacting with PsaC in Arabidopsis. Plant J. 2017 Jun 21. doi: 10.1111/tpj.13618.
PsaD (PSI-D subunit of photosystem I) can form complexes with ferredoxin and ferredoxin-oxidoreductase in photosystem I (PS I) reaction center. Alternative names: Photosystem I 20 kDa subunit, PSI-D.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles, Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Immunogen:
PsaD of Chlamydomonas reinhardtii, UniProt: Q39615
PsaD (PSI-D) is a core subunit of photosystem I highly conserved in all photosynthetic organisms (including bacteria with Fe-S type reaction centers). In eukaryots its encoded by 1 to 2 nuclear gene(s) and imported as a precursor into the chloroplast. In the thylakoid membrane it associates with PsaA and PsaB on the stromal site of the PSI core forming the Fd-docking site. PsaD is also required for the stable assembly of PsaC.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Alge, Dicots, Catalpa bungei, Cucumis melo, Conifers, Cyanidioschyzon merolae, Bigelowiella natans, Nannochloropsis sp. , Phaeodactylum tricornutum, Phyla dulcis, Zosteria marinaSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide 100% conserved in all known plant PsaD sequences including Arabidopsis thaliana PSI-D1 UniProt:Q9S7H1 , TAIR: At4g02770 and PSI-D2 UniProt: Q9SA56 , TAIR At1g03130 as well as Physcomitrella patens. The conservation in Chlamydomonas reinhardtii is high (14 of 16 aminoacids are identical).
Applications:
Clear-native PAGE (CN-PAGE), Immunoprecipitation (IP), Western blot (WB)
This antibody is a replacement for former product, anti-PsaD AS04 046 Contains 0.1% ProClin.
Application Details:
1: 10 000 (CN-PAGE), 1 : 1000 - 1: 5 000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
17.9 | 20 (for Arabidopsis thaliana)
Not reactive in:
Synechococcus elongatus sp. PCC 7942
Selected references:
Ivanov et al. (2022) The decreased PG content of pgp1 inhibits PSI photochemistry and limits reaction center and light-harvesting polypeptide accumulation in response to cold acclimation. Planta 255, 36 (2022). https://doi.org/10.1007/s00425-022-03819-0Fukura et al. (2021) Enrichment of chlorophyll catabolic enzymes in grana margins and their cooperation in catabolic reactions. J Plant Physiol. 2021 Nov;266:153535. doi: 10.1016/j.jplph.2021.153535. Epub 2021 Sep 25. PMID: 34607178.Fattore et al. (2021). Acclimation of photosynthetic apparatus in the mesophilic red alga Dixoniella giordanoi. Physiol Plant. 2021 Nov;173(3):805-817. doi: 10.1111/ppl.13489. Epub 2021 Jul 5. PMID: 34171145; PMCID: PMC8596783.Chen et al. (2021)Degradation of the photosystem II core complex is independent of chlorophyll degradation mediated by Stay-Green Mg2+ dechelatase in Arabidopsis,Plant Science,Volume 307,2021,110902,ISSN 0168-9452,https://doi.org/10.1016/j.plantsci.2021.110902. Pipitone et al. (2021). A multifaceted analysis reveals two distinct phases of chloroplast biogenesis during de-etiolation in Arabidopsis. Elife. 2021 Feb 25;10:e62709. doi: 10.7554/eLife.62709. PMID: 33629953; PMCID: PMC7906606.
Special application note:
PsaD has frequently been used as a marker for intact PSI reaction centers.This product can be sold containing proclin if requested.
PsaC is a conserved, chloroplast-encoded, Fe-S binding protein of approximately 10kDa, present in all known Photosystem I complexes. It is located on the stromal side of the thylacoid membranes. PsaC coordinates the Fe–S clusters FA and FB through two cysteine-rich domains.This product is a recombinant protein standard, source: Synechocystis PCC 6803.The PsaC protein standard can be used in combination with global anti-PsaC antibodies to quantitate PsaC from a wide range of species. Global antibodies are raised against highly conserved amino acid sequences in the PsaC protein.Quantitative western blot: detailed method description, video tutorial
Product Type:
Antibody
Format:
Lyophilized in glycerol.
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Protein standard buffer composition: Protein standard buffer composition: Glycerol 10%, Tris Base 141 mM, Tris HCl 106 mM, LDS 2%, EDTA 0.51 mM, SERVA Blue G250 0.22 mM, Phenol Red 0.175 mM, pH 8.5, 0.1mg/ml PefaBloc protease inhibitor (Roche), 50mM DTT.
Application Details:
Positive control: a 2 μL load per well is optimal for most chemiluminescent detection systems. Standard curve: 3 loads are recommended (eg. 0.5, 2 and 4μL). For most applications a sample load of 0.2 μg of chlorophyll will give a PsaC signal in this range. Exact loads can vary with the sensitivity of your system and the abundance of the target protein in your samples. Note: Optimal quantitation is achieved using moderate sample loads/well, generally 1 to 5 ug total protein. A trial experiment may be required i) to bring your sample load within the standard curve range and ii) to obtain a signal that is strong enough to reliably quantify but not so strong as to consume ECL reagents too quickly or saturate your detection system. These goals may achieved by adjusting both sample and standard loads.
Reconstitution:
For reconstitution add 95 l of sterile water. Note that due to glycerol in buffer, the lyophilized product appears as a dense liquid rather than a powder. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently. Avoid vigorous vortexing, as buffer contains detergent. Upon reconstitution, this standard is ready-to-load and does not require any additions or heating. See additional Handling Instructions below. PsaC standard protein concentration: 0.10 pmol/ l.
Molecular Weight:
11,5 kDa (larger than native protein due to the addition of His-tag), In most gels PsaC migrates between 9 and 14 kDa
Selected references:
Pipitone et al. (2021). A multifaceted analysis reveals two distinct phases of chloroplast biogenesis during de-etiolation in Arabidopsis. Elife. 2021 Feb 25;10:e62709. doi: 10.7554/eLife.62709. PMID: 33629953; PMCID: PMC7906606.Rogowski et al. (2021) Light as a substrate: migration of LHCII antennas in extended Michaelis-Menten model for PSI kinetics. J Photochem Photobiol B. 2021 Dec;225:112336. doi: 10.1016/j.jphotobiol.2021.112336. Epub 2021 Oct 19. PMID: 34736069.Levitan et al. (2019). Structural and functional analyses of photosystem II in the marine diatom Phaeodactylum tricornutum. Proc Natl Acad Sci U S A. 2019 Aug 27;116(35):17316-17322. doi: 10.1073/pnas.1906726116.Li et al. (2016). A Hard Day's Night: Diatoms Continue Recycling Photosystem II in the Dark. Front. Mar. Sci., 08 November 2016 | http://dx.doi.org/10.3389/fmars.2016.00218Vandenhecke et al. (2015). Changes in the Rubisco to photosystem ratio dominates photoacclimation across phytoplankton taxa. Photosynth Res. 2015 Apr 11.
Special application note:
Handling Instructions*IMPORTANT: In our experience, viscous liquids are surprisingly stable; insufficient mixing is the most common reason for unsatisfactory results. Following mixing, briefly pulse in a microcentrifuge to collect material from cap.Standard needs to be fully thawed and thoroughly mixed before each use. Proteins tend to stratify with the more dense layer after freezing. We recommend bringing the product to room temperature and either mixing by inverting or flicking tube 5-10 times. Pipetting up and down may also provide sufficient mixing, provided the tip is moved within the tube while taking up and expelling the liquid.
PsaC is a conserved, chloroplast-encoded, Fe-S binding protein of approximately 10kDa, present in all known Photosystem I complexes. It is located on the stromal side of the thylacoid membranes. PsaC coordinates the Fe–S clusters FA and FB through two cysteine-rich domains.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
In some species minor cross reactions with some larger proteins are seen. These may contain related iron-sulfur binding motifs. Therefore size verification of the reacting band is required. Due to the small size of the protein, care should be taken to differentiate between chemiluminescent signal from PsaC and non-specific signals from chlotophylls or lipids if pigment is retained near the bottom of the blot.For the most optimal results use:thylakoid membranes or PSI particles, solubilized in a SDS sample buffer (final concentrations: 63 mM Tris HCl, 10% glycerol, 2% SDS, 0.0025% bromophenol blue) with 2.5% beta-mercaptoethanol at 85C for 2 minutes. The samples were spun softly, then the supernatant loaded. This product can be sold containing ProClin if requested.
Application Details:
1 : 5000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
9 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Burlacot et al. (2022) Alternative photosynthesis pathways drive the algal CO2-concentrating mechanism. Nature 605, 366–371 (2022). https://doi.org/10.1038/s41586-022-04662-9Ye et al. (2022) Effect of increased CO2 on iron-light-CO2 co-limitation of growth in a marine diatom, ASLO, Limnol. Oceanogr. 2022, 172-176Rogowski et al. (2021) Light as a substrate: migration of LHCII antennas in extended Michaelis-Menten model for PSI kinetics. J Photochem Photobiol B. 2021 Dec;225:112336. doi: 10.1016/j.jphotobiol.2021.112336. Epub 2021 Oct 19. PMID: 34736069.Levitan et al. (2019). Structural and functional analyses of photosystem II in the marine diatom Phaeodactylum tricornutum. Proc Natl Acad Sci U S A. 2019 Aug 27;116(35):17316-17322. doi: 10.1073/pnas.1906726116.Zavrel et al. (2019). Quantitative insights into the cyanobacterial cell economy. Elife. 2019 Feb 4;8. pii: e42508. doi: 10.7554/eLife.42508.
Special application note:
Peptide target used to elicit this antibody is well conserved in all photoautotrophs except some cyanobacteria, some red algae and Cyanophora paradoxa, which contain a conserved substitution of a valine to an isoleucine. The performance of the antibodies has been confirmed against taxa containing both the valine and isoleucine variants.Example of a simulataneous western blot detection with RbcL, PsbA and PsaC antibodies. More information about quantitative western blot using PsaC antibody can be found here.
Prostate-Specific Antigen (PSA) is a serine protease of the kallikrein family that is produced by the prostate epithelium and epithelial lining of the periurethral glands. Although considered prostate-specific, PSA has also been detected in breast tissue, breast tumours, endometrium, adrenal neoplasms, and renal cell carcinomas. Anti-PSA can be used for differentiating high-grade prostate adenocarcinoma from high-grade urothelial carcinoma, as well as for determining the prostatic origin of carcinomas in non-prostate tissues. Anti-PSA recognizes primary and metastatic prostatic neoplasms, but not tumours of nonprostatic origin, and can be useful as an aid to confirm prostatic acinar cell origin in primary and metastatic carcinomas.
Prostate-Specific Antigen (PSA) is a serine protease of the kallikrein family that is produced by the prostate epithelium and epithelial lining of the periurethral glands. Although considered prostate-specific, PSA has also been detected in breast tissue, breast tumours, endometrium, adrenal neoplasms, and renal cell carcinomas. Anti-PSA can be used for differentiating high-grade prostate adenocarcinoma from high-grade urothelial carcinoma, as well as for determining the prostatic origin of carcinomas in non-prostate tissues. Anti-PSA recognizes primary and metastatic prostatic neoplasms, but not tumours of nonprostatic origin, and can be useful as an aid to confirm prostatic acinar cell origin in primary and metastatic carcinomas.
Photosystem I (PSI) of chloroplasts is a multisubunit membrane-protein complex that catalyzes the electron transfer from the reduced plastocyanin (or cytochrome c6) in the thylakoid lumen to the oxidized ferredoxin (or flavodoxin) in the chloroplast stroma. PsaB is a core protein of PSI complex. Synonymes: Photosystem I P700 chlorophyll a apoprotein A2, PSI-B
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
This product can be sold containing ProClin if requested
Application Details:
1 : 1000 (BN-PAGE), (WB)
Purity:
Antigen affinity purified in PBS pH 7.4
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
82,7 | 55-60 kDa
Not reactive in:
Chlamydomonas reinhardtii, dinoflagellate
Selected references:
Shukla et al. (2020). A novel method produces native LHCII aggregates from the photosynthetic membrane revealing their role in non-photochemical quenching. J Biol Chem. 2020 Oct 20:jbc.RA120.016181. doi: 10.1074/jbc.RA120.016181. Epub ahead of print. PMID: 33082138.Grieco et al. (2020). Adjustment of photosynthetic activity to drought and fluctuating light in wheat. Plant Cell Environ. 2020 Mar 16. doi: 10.1111/pce.13756. Liu et al. (2020). Acid treatment combined with high light leads to increased removal efficiency of Ulva prolifera. Algal Research,Volume 45, January 2020, 101745Frede et al. (2019). Light quality-induced changes of carotenoid composition in pak choi Brassica rapa ssp. chinensis. J Photochem Photobiol B. 2019 Apr;193:18-30. doi: 10.1016/j.jphotobiol.2019.02.001.Lima-Melo et al. (2019). Consequences of photosystem-I damage and repair on photosynthesis and carbon use in Arabidopsis thaliana. Plant J. 2018 Nov 29. doi: 10.1111/tpj.14177.
PsaA is a core protein of photosystem I. In plants and cyanobacteria, the primary step in oxygenic photosynthesis, the light induced charge separation, is driven bytwo large membrane intrinsic protein complexes, the photosystems I and II. Synonym: Photosystem I P700 chlorophyll a apoprotein A1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Immunogold localization has been done in leaf material of Arabidopsis thaliana.
Application Details:
1 : 20 (IG), 1 : 1000-1 : 5000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
82 | 55-60 kDa
Not reactive in:
Chromera velia
Selected references:
Ivanov et al. (2022) The decreased PG content of pgp1 inhibits PSI photochemistry and limits reaction center and light-harvesting polypeptide accumulation in response to cold acclimation. Planta 255, 36 (2022). https://doi.org/10.1007/s00425-022-03819-0Lim et al (2022). Arabidopsis guard cell chloroplasts import cytosolic ATP for starch turnover and stomatal opening. Nat Commun. 2022 Feb 3;13(1):652. doi: 10.1038/s41467-022-28263-2. PMID: 35115512; PMCID: PMC8814037.Lim et al (2022) Arabidopsis guard cell chloroplasts import cytosolic ATP for starch turnover and stomatal opening. Nat Commun. 2022 Feb 3;13(1):652. doi: 10.1038/s41467-022-28263-2. PMID: 35115512; PMCID: PMC8814037.Spaniol et al. (2022) Complexome profiling on the Chlamydomonas lpa2 mutant reveals insights into PSII biogenesis and new PSII associated proteins, Journal of Experimental Botany, Volume 73, Issue 1, 5 January 2022, Pages 245–262Rogowski et al. (2021) Light as a substrate: migration of LHCII antennas in extended Michaelis-Menten model for PSI kinetics. J Photochem Photobiol B. 2021 Dec;225:112336. doi: 10.1016/j.jphotobiol.2021.112336. Epub 2021 Oct 19. PMID: 34736069.
Special application note:
PsaA is a hydrophobic protein and we recommend to use PVDF membrane for transfer to assure best results.This product can be sold containing ProClin if requested.
PSA3 (Photosystem I Assembly 3) is involved in promotion of photosystem I biogenesis in angiosperms. It is a nucleus-encoded protein.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles,Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Zea mays
Immunogen:
Recombinant PSA3, amino acids 110 to 269 derived from Zea mays Zm00001d013295
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Shen J, Williams-Carrier R, and Barkan A. (2017) PSA3, a protein on the stromal face of the thylakoid membrane, promotes photosystem I accumulation in cooperation with the assembly factor PYG7. Plant Physiol. 2017 Jul;174(3):1850-1862. doi: 10.1104/pp.17.00524.
PSA2 (Photosystem I assembly factor 2) is a protein coded by a gene belonging to the "Green Cut" set, found only in green algae and plants but not in non-photosynthetic organisms. PSA2 is localized in thylakoid lumen.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica rapa Species of your interest not listed? Contact us
Immunogen:
recombinant protein corresponding to amino acids 87 to 186 of Arabidopsis thaliana PSA2, UniProt:O64750, TAIR: AT2G34860
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Fristedt et al. (2014). A Thylakoid Membrane Protein Harboring a DnaJ-type Zinc Finger Domain is Required for Photosystem I Accumulation in Plants. J Biol Chem. 2014 Sep 16. pii: jbc.M114.587758.
Peroxiredoxins (EC=1.11.1.15) belong to the enzyme family which is ubiquitous in all kingdoms of life. Prx Q enzyme acting by reducing hydroperoxides. Peroxiredoxins have no heme group, unlike the other peroxidases, but perform their enzymatic activity using cysteine residues with redox-active thiol groups. The ability of peroxiredoxins to hydrolyze hydroperoxides suggests that this protein family has a general function in oxidant defence.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Marchantia polymorpha, Populus sp. , Triticum aestivum, Oryza sativa Species of your interest not listed? Contact us
Immunogen:
His-tagged full length protein (with presequence) of Arabidopsis thaliana was overexpressed in in E.coli. Isolated with HiTrap column (GE Healthcare) Q9LU86, At3g26060
In stroma fractions a weak background reaction at 28 kDa is visible, No crossreactivity in any thylakoid fractions
Application Details:
1 : 5000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 200 l of sterile water
Molecular Weight:
16 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Yoshida et al. (2018). Thioredoxin-like2/2-Cys peroxiredoxin redox cascade supports oxidative thiol modulation in chloroplasts. Proc Natl Acad Sci U S A. 2018 Aug 13. pii: 201808284. doi: 10.1073/pnas.1808284115.Yoshida et al. (2016). Hisabori T1.Two distinct redox cascades cooperatively regulate chloroplast functions and sustain plant viability. Proc Natl Acad Sci U S A. 2016 Jul 5;113(27):E3967-76. doi: 10.1073/pnas.1604101113. Epub 2016 Jun 22.Yoshida et al. (2015). Thioredoxin Selectivity for Thiol-Based Redox Regulation of Target Proteins in Chloroplasts. J Biol Chem. 2015 Apr 15. pii: jbc.M115.647545.Feifei et al. (2014). Comparison of Leaf Proteomes of Cassava (Manihot esculenta Crantz) Cultivar NZ199 Diploid and Autotetraploid Genotypes. PLoS One. 2014 Apr 11;9(4):e85991. doi: 10.1371/journal.pone.0085991. eCollection 2014.Wu et al. (2013). Proteomic and Phytohormone Analysis of the Response of Maize (Zea mays L.) Seedlings to Sugarcane Mosaic Virus. PLoS One. July 23;8(7).
Special application note:
This product can be sold containing proclin if requested
PRP40B (pre-mRNA-processing protein 40B) protein that binds the carboxyl-terminal domain (CTD) of the largest subunit of RNA polymerase II and functions as a scaffold for RNA processing machineries. Ubiquitously expressed and localized to the nucleus.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica rapa Species of your interest not listed? Contact us
PRP39a (pre-mRNA-processing factor 39) is involved in RNA processing, mRNA 5'-splice site recognition, regulation of timing of transition from vegetative to reproductive phase.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica rapa Species of your interest not listed? Contact us
Immunogen:
Recombinant, full length PRP39a of Arabidopsis thaliana , UniProt: F4I448, TAIR: At1g04080
Chicken anti-Proto-oncogene tyrosine-protein kinase receptor Ret (RET) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
The RET proto-oncogene is a receptor tyrosine kinase for members of the glial cell line-derived neurotrophic factor family of extracellular signalling molecules
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid: Concentrated ammonium sulphate in PBS pH 7.4
Host Animal:
Chicken
Species Reactivity:
Human
Immunogen:
Recombinant His-tagged extracellular fragment of human RET protein produced using CHO cell line. The extracellular fragment of hRET was expressed and secreted to the cell culture supernatant. Protein was purified by Ni-affinity chromatography following gel-filtration from cell culture supernatant.
Applications:
ICC,WB
Antibody Isotype:
IgY
Application Details:
WB, ICC. A dilution of 1:5 000 to 1:10 000 is recommended for Western blot and 1:250 to 1:500 for immunocytochemistry. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Cadherin family member 12; Ret;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human RET
Storage:
Store at 2-8°C upon receipt; DO NOT FREEZE. As product is (NH4)2SO4 (ammonium sulfate) precipitate, mix well by pipetting or vortexing prior to use. See reconstitution instructions for more information.
Purification:
Affinity purified
Target:
Proto-oncogene tyrosine-protein kinase receptor Ret (RET)
Rabbit anti-Protein painting of fourth Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
Protein painting of fourth (Pof) is a probable RNA-binding protein that binds to the fourth chromosome and may bind a RNA that spreads the fourth chromosome (Ref: Swissprot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS (pH 7.4) with 0.02% Sodium azide added
Host Animal:
Rabbit
Species Reactivity:
Drosophila
Immunogen:
A synthetic peptide from Drosophila melanogaster Protein painting of fourth (22-36 aa) conjugated to KLH.
Applications:
ELISA
Antibody Isotype:
IgG
Application Details:
ELISA. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Zeste-interacting protein 16; Zip16; Pof;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Protein painting of fourth ;Zeste-interacting protein 16;
Storage:
Store lyophilized product at -20°C or below. After reconstitution, keep aliquots for 2-3 weeks at 2-8°C or at -20°C for up to 12 months. Avoid repetitive freeze/thaw cycles.
Prostate-Specific Antigen (PSA) is a serine protease of the kallikrein family that is produced by the prostate epithelium and epithelial lining of the periurethral glands. Although considered prostate-specific, PSA has also been detected in breast tissue, breast tumours, endometrium, adrenal neoplasms, and renal cell carcinomas. Anti-PSA can be used for differentiating high-grade prostate adenocarcinoma from high-grade urothelial carcinoma, as well as for determining the prostatic origin of carcinomas in non-prostate tissues. Anti-PSA recognizes primary and metastatic prostatic neoplasms, but not tumours of nonprostatic origin, and can be useful as an aid to confirm prostatic acinar cell origin in primary and metastatic carcinomas.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC720
GMDN Code:
57548
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Prostate, Prostate Carcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Prostate-Specific Antigen (PSA) is a serine protease of the kallikrein family that is produced by the prostate epithelium and epithelial lining of the periurethral glands. Although considered prostate-specific, PSA has also been detected in breast tissue, breast tumours, endometrium, adrenal neoplasms, and renal cell carcinomas. Anti-PSA can be used for differentiating high-grade prostate adenocarcinoma from high-grade urothelial carcinoma, as well as for determining the prostatic origin of carcinomas in non-prostate tissues. Anti-PSA recognizes primary and metastatic prostatic neoplasms, but not tumours of nonprostatic origin, and can be useful as an aid to confirm prostatic acinar cell origin in primary and metastatic carcinomas.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC720
GMDN Code:
57548
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Prostate, Prostate Carcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Prostate-Specific Antigen (PSA) is a serine protease of the kallikrein family that is produced by the prostate epithelium and epithelial lining of the periurethral glands. Although considered prostate-specific, PSA has also been detected in breast tissue, breast tumours, endometrium, adrenal neoplasms, and renal cell carcinomas. Anti-PSA can be used for differentiating high-grade prostate adenocarcinoma from high-grade urothelial carcinoma, as well as for determining the prostatic origin of carcinomas in non-prostate tissues. Anti-PSA recognizes primary and metastatic prostatic neoplasms, but not tumours of nonprostatic origin, and can be useful as an aid to confirm prostatic acinar cell origin in primary and metastatic carcinomas.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC720
GMDN Code:
57548
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Prostate, Prostate Carcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Prostate Cocktail is a combination of Cytokeratin 1, Cytokeratin 5, Cytokeratin 10, Cytokeratin 14, and p63. These four high molecular weight cytokeratins are found in basal epithelia of the prostate gland. p63 is a tumour suppressor protein found in basal epithelial nuclei of the normal prostate, while being negative in malignant tumours associated with the prostate gland. It is therefore useful in differentiating between benign and malignant prostate lesions.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC653
GMDN Code:
57548
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Prostate
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Prostate Cocktail is a combination of Cytokeratin 1, Cytokeratin 5, Cytokeratin 10, Cytokeratin 14, and p63. These four high molecular weight cytokeratins are found in basal epithelia of the prostate gland. p63 is a tumour suppressor protein found in basal epithelial nuclei of the normal prostate, while being negative in malignant tumours associated with the prostate gland. It is therefore useful in differentiating between benign and malignant prostate lesions.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC653
GMDN Code:
57548
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Prostate
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Prostate Cocktail is a combination of Cytokeratin 1, Cytokeratin 5, Cytokeratin 10, Cytokeratin 14, and p63. These four high molecular weight cytokeratins are found in basal epithelia of the prostate gland. p63 is a tumour suppressor protein found in basal epithelial nuclei of the normal prostate, while being negative in malignant tumours associated with the prostate gland. It is therefore useful in differentiating between benign and malignant prostate lesions.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC653
GMDN Code:
57548
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Prostate
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
PROPEP1 (cleaved and matured) act as elicitor of plant defense. Induces the production of plant defensin (PDF1.2) and of hydrogen peroxide (components of the innate immune response), which promote resistance to the root fungal pathogen P.irregulare.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store at -20 °C; make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabidopsis thaliana
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana C-terminal of PROPEP1, UniProt: Q9LV87-1, TAIR: At5g64900 The peptide has 84 % homology to PROPE2.
Nerve growth factor (NGF) is synthesized as a precursor (proNGF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proNGF is synthesized in target tissues and glia, transported retrogradely and may be released. This antibody is raised in sheep to detect the prodomain of NGF not the mature peptide.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
The recombinant prodomain fragment of human nerve growth factor
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, Immunofluorescence, ELISA, Western Blot, biological neutralization of proNGF. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
pro-brain nerve growth factor; proNGF; NGF;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Sugimoto J et al. (2021). Fabry disease-associated globotriaosylceramide induces mechanical allodynia via activation of signaling through proNGF p75NTR but not mature NGF TrkA. Eur. J. Pharmacol. 895. Application: Neutralising ( in-vivo ). Ryu JC et al. (2018). Role of proNGF/p75 signaling in bladder dysfunction after spinal cord injury. J Clin Invest. [Epub ahead of print]. Application: Western Blotting.
Specificity:
The specificity of this antibody has been confirmed by WB. It does NOT crossreact with proBDNF, proNT-3 or mature NGF. Confirmed to react with purified human proNGF and crossreact with mouse and rat proNGF
Storage:
Maintain lyophilized antibody at 2-8°C for up to 12 months after date of receipt. After reconstitution keep undiluted aliquots at -20°C for up to 6 months for higher stability or at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Nerve growth factor (NGF) is synthesized as a precursor (proNGF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proNGF is synthesized in target tissues and glia, transported retrogradely and may be released.<br /><br />Biosensis now offers <strong>biotinylated proNGF antibody</strong> allowing more flexibility in experimental design by using the biotin-avidin/streptavidin detection method. The ability of biotinylated proNGF antibody to detect proNGF has been validated by WB.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a solution containing PBS buffer pH 7.4 with 3% trehalose, without preservatives.
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
A synthetic peptide (C-HTIPQAHWTKLQ, aa: 30-41) of human proNGF protein has been used as the immunogen. The sequence is located on the pro-domain of the proNGF full-length protein and is 80% homologous to mouse and rat proNGF.
Applications:
WB
Clone number:
BS312
Antibody Isotype:
IgG2, lambda
Application Details:
The biotinylated proNGF antibody has been tested by Western Blotting (0.1-0.5 µg/mL) and is also expected to work in applications validated for the unlabelled antibody M-1738-100 at same or higher dilutions: Flow Cytometry and Immunofluorescence.<br><br>Other applications not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Pro-brain nerve growth factor; proNGF; NGF
Biosensis Brand:
Biosensis®
Conjugate:
Biotin
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Species cross-reactivity not tested.
Storage:
After reconstitution divide into aliquots and store at -20°C for a higher stability. Antibody contains no preservatives. Store at 2-8°C with an appropriate antibacterial agent. Use sterile methods. Highest purity Glycerol (1:1) may be added for an additional stability when stored at refrigerated or freezing temperatures. Avoid repetitive freeze/thaw cycles.
Purification:
Antibody was purified from cell culture supernatant by Protein G chromatography, biotinylated and buffer-exchanged into PBS, pH 7.4 buffer
Nerve growth factor (NGF) is synthesized as a precursor (proNGF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proNGF is synthesized in target tissues and glia, transported retrogradely and may be released.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a solution containing PBS buffer pH 7.4 with 3% trehalose, without preservatives.
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
A synthetic peptide (C-HTIPQAHWTKLQ, aa: 30-41) of human proNGF protein has been used as the immunogen. The sequence is located on the pro-domain of the proNGF full-length protein and is 80% homologous to mouse and rat proNGF.
Applications:
FC,ICC,WB
Clone number:
BS312
Antibody Isotype:
IgG2b, lambda
Application Details:
Flow Cytometry (2 ug/ 10^6 cells). Immunocytochemistry (1-2 µg/mL), Western Blotting (1-2 µg/mL). Other applications not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Pro-brain nerve growth factor; proNGF; NGF
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Species cross-reactivity not tested.
Storage:
Store lyophilized antibody at 2-8ºC. After reconstitution divide into aliquots and store at -20°C for a higher stability. Antibody contains no preservatives. Store at 2-8°C with an appropriate antibacterial agent. Use sterile methods. Highest purity Glycerol (1:1) may be added for an additional stability when stored at refrigerated or freezing temperatures. Avoid repetitive freeze/thaw cycles.
Prolactin (PRL) is a peptide hormone synthesized and secreted by lactotroph cells in the adenohypophysis (anterior pituitary gland). PRL plays a role in a number of processes including cell growth, reproduction, and immune function, with its primary function being associated with lactation. Anti-Prolactin reacts with lactotroph cells, and is useful in classification of pituitary tumours and the study of pituitary disease.
Prolactin (PRL) is a peptide hormone synthesized and secreted by lactotroph cells in the adenohypophysis (anterior pituitary gland). PRL plays a role in a number of processes including cell growth, reproduction, and immune function, with its primary function being associated with lactation. Anti-Prolactin reacts with lactotroph cells, and is useful in classification of pituitary tumours and the study of pituitary disease.
Prolactin (PRL) is a peptide hormone synthesized and secreted by lactotroph cells in the adenohypophysis (anterior pituitary gland). PRL plays a role in a number of processes including cell growth, reproduction, and immune function, with its primary function being associated with lactation. Anti-Prolactin reacts with lactotroph cells, and is useful in classification of pituitary tumours and the study of pituitary disease.
Mouse anti-Pro-glial cell line-derived neurotrophic factor (proGDNF) Monoclonal Antibody (Unconjugated), suitable for ICC, FC.
Background Info:
Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake (Ref: uniprot.org). ProGDNF is the unprocessed precursor molecule of mature GDNF and exists as homodimer.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a solution containing PBS buffer pH 7.4 with 3% trehalose, without preservatives.
Host Animal:
Mouse
Species Reactivity:
Human,Mouse (Predicted),Rat
Immunogen:
A synthetic peptide (C-EDYPDQFDDVMD, aa: 55-66) of human proGDNF protein has been used as the immunogen. The sequence is located on the pro-domain of the proGDNF full-length protein and is homologous with mouse and rat form of proGDNF.
Applications:
FC,ICC
Clone number:
BS376
Antibody Isotype:
IgG3, kappa
Application Details:
Flow Cytometry (2 ug/ 10<sup>6</sup> cells). Immunocytochemistry (1-2 µg/mL). Other applications not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human Rat. Antibody is expected to detect mouse proGDNF protein due to 100% amino acid sequence homology.
Storage:
After reconstitution divide into aliquots and store at -20°C for a higher stability. Antibody contains no preservatives. Store at 2-8°C with an appropriate antibacterial agent. Use sterile methods. Highest purity Glycerol (1:1) may be added for an additional stability when stored at refrigerated or freezing temperatures. Avoid repetitive freeze/thaw cycles.
Progesterone Receptor (PR), also known as NR3C3 (Nuclear Receptor Subfamily 3, Group C, Member 3), is an intracellular steroid receptor which mediates the physiological effects of progesterone, a female sex hormone involved in the menstrual cycle, pregnancy, and embryogenesis. Progesterone receptor expression has been linked to the prediction of prognosis in breast cancer, as well as associated responses to endocrine therapy. The progesterone receptor has also been linked to risk for ovarian cancer.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC751
Antibody Isotype:
IgG1, kappa
GMDN Code:
57534
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Breast, Breast Carcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Progesterone Receptor (PR), also known as NR3C3 (Nuclear Receptor Subfamily 3, Group C, Member 3), is an intracellular steroid receptor which mediates the physiological effects of progesterone, a female sex hormone involved in the menstrual cycle, pregnancy, and embryogenesis. Progesterone receptor expression has been linked to the prediction of prognosis in breast cancer, as well as associated responses to endocrine therapy. The progesterone receptor has also been linked to risk for ovarian cancer.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC751
Antibody Isotype:
IgG1, kappa
GMDN Code:
57534
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Breast, Breast Carcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Progesterone Receptor (PR), also known as NR3C3 (Nuclear Receptor Subfamily 3, Group C, Member 3), is an intracellular steroid receptor which mediates the physiological effects of progesterone, a female sex hormone involved in the menstrual cycle, pregnancy, and embryogenesis. Progesterone receptor expression has been linked to the prediction of prognosis in breast cancer, as well as associated responses to endocrine therapy. The progesterone receptor has also been linked to risk for ovarian cancer.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC751
Antibody Isotype:
IgG1, kappa
GMDN Code:
57534
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Breast, Breast Carcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Brain derived neurotrophic factor (BDNF) is synthesized as a precursor (proBDNF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proBDNF is synthesized in neurons and glia (eg., microglia), transported anterogradely and retrogradely and may be released in an activity dependent manner. This antibody is raised in sheep to detect the prodomain of BDNF and not the mature peptide.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
The recombinant prodomain fragment of human brain-derived neurotrophic factor
Applications:
ELISA,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
ELISA, Western Blot, biological neutralization of proBDNF, Immunocytochemistry/Immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Proform brain derived neurotrophic factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed to react with purified human proBDNF, crossreact with mouse and rat proBDNF Cross reactivity with other species than human, mouse and rat has not yet been tested
Storage:
After reconstitution keep aliquots at -20ºC for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
BDNF belongs to the neurotrophin family and promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. Post translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Immunogen:
A synthetic peptide (C-ELLDEDQKVRPNEE) as a part of human BDNF precursor protein (aa: 69-82) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, WB. 1-5 µg/mL is recommended for both applications, Flow Cytometry (2?g/10^6 cells). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Le Blanc J et al. (2020) Platelets Selectively Regulate the Release of BDNF, But Not That of Its Precursor Protein, proBDNF. Front Immunol. 11:575607 Application: Human, WB. Macias M et al. (2007) Locomotor exercise alters expression of pro-brain-derived neurotrophic factor, brain-derived neurotrophic factor and its receptor TrkB in the spinal cord of adult rats. Eur J Neurosci. 25(8):2425-44 Application: Rat
Specificity:
Used in western blot, this antiserum detects a 35 kDa band corresponding to the molecular weight of proBDNF. No cross reactivity with other proneurotrophins was detected. This antibody is known to react with human, mouse and rat proBDNF and also expected to recognise other mammalian proBDNF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
BDNF belongs to the neurotrophin family and regulates the survival and differentiation of neurons during development. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. FUNCTION: Promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. Post Translation Modification (PTM): The propeptide is N-glycosylated and glycosulfated. PTM: Converted into mature BDNF by plasmin (PLG) (By similarity). DISEASE: Defects in BDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. CCHS is frequently complicated with neurocristopathies such as Hirschsprung disease that occurs in about 16% of CCHS cases. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Immunogen:
A synthetic peptide (C-ELLDEDQKVRPNEE) as a part of human BDNF precursor protein (aa: 69-82) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1:1000 to 1:5000 is recommended for both applications. ICC: 1:500 to 1:2000, antibody works on 4% formaldehyde fixed cells. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Used in western blot, this antiserum detects a 35 kDa band corresponding to the molecular weight of proBDNF. No cross reactivity with other proneurotrophins was detected. This antiserum is known to react with human, mouse and rat proBDNF and also expected to recognise other mammalian proBDNF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Brain derived neurotrophic factor (BDNF) is synthesized as a precursor (proBDNF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proBDNF is synthesized in neurons and glia (eg., microglia), transported anterogradely and retrogradely and may be released in an activity dependent manner.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a solution containing PBS buffer pH 7.4 with 3% trehalose, without preservatives.
Host Animal:
Mouse
Species Reactivity:
Human,Mouse (Predicted),Rat
Immunogen:
A synthetic peptide (C-NGPKAGSRGLTS, aa: 47-58) of human proBDNF protein has been used as the immunogen. The sequence is located on the pro-domain of the proBDNF full-length protein.
Applications:
FC,ICC
Clone number:
BS375
Antibody Isotype:
IgG1, kappa
Application Details:
Flow Cytometry (2 ug/10<sup>6</sup> cells).<br>Immunocytochemistry (1-2 µg/mL).<br>Other applications not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Abrineurin
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Not yet tested. Antibody may detect mouse and rat proBDNF protein due to high degree of amino acid sequence homology.
Storage:
After reconstitution divide into aliquots and store at -20°C for a higher stability. Antibody contains no preservatives. Store at 2-8°C with an appropriate antibacterial agent. Use sterile methods. Highest purity Glycerol (1:1) may be added for an additional stability when stored at refrigerated or freezing temperatures. Avoid repetitive freeze/thaw cycles.
PRN2 (PIRIN) belongs to a functionally diverse cupin protein superfamily with four family members of Arabidopsis thaliana PRN proteins.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Zhang et al. (2014). PIRIN2 stabilizes cysteine protease XCP2 and increases susceptibility to the vascular pathogen Ralstonia solanacearum in Arabidopsis. Plant J. 2014 Jun 20. doi: 10.1111/tpj.12602.
Rabbit anti-PRKR-like endoplasmic reticulum kinase (phosphorylated and non phosphorylated) (PERK) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
PERK (PKR-like ER kinase) is a single-pass type I ER membrane protein with a stress-sensing luminal domain connected by a transmembrane segment to a cytoplasmic-kinase domain.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. 50% glycerol
Host Animal:
Rabbit
Species Reactivity:
Mouse
Immunogen:
A recombinant peptide from mouse PERK.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunoprecipitation (IP). A dilution of 1:500 is recommended for WB. A dilution of 30 µL of antibody in a total reaction mixture of 500 µL is recommended for IP. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Feliziani C. et al (2022) Ca2+ signalling system initiated by Endoplasmic reticulum stress stimulates PERK activation Cell Calcium. 2022 [Epub ahead of print] Bollo M. et al (2010) Calcineurin interacts with PERK and dephosphorylates calnexin to relieve ER stress in mammals and frogs PLoS One. 2010 Aug 5;5(8)
Specificity:
This antiserum is known to recognise both phosphorylated and non phosphorylated mouse PERK.
Storage:
Aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
PRKR-like endoplasmic reticulum kinase (phosphorylated and non phosphorylated) (PERK)
PRK ribulose-5-P-kinase| phosphoribulokinase is an enzyme that catalyzes the chemical reaction ATP + D-ribulose 5-phosphate to ADP + D-ribulose 1,5-bisphosphate
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
PRK ribulose-5-P-kinase phosphoribulokinase is an enzyme that catalyzes the chemical reaction ATP + D-ribulose 5-phosphate to ADP + D-ribulose 1,5-bisphosphate.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 650.
Molecular Weight:
44 | 39 kDa (A. thaliana)
Not reactive in:
Proteobacteria
Selected references:
To be added when available. Antibody released in May 2023.
Special application note:
Antibody can be used as a marker of chloroplast stroma.DyLight 650 has Amax = 652 nm, Emax = 672 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
PRK ribulose-5-P-kinase| phosphoribulokinase is an enzyme that catalyzes the chemical reaction ATP + D-ribulose 5-phosphate to ADP + D-ribulose 1,5-bisphosphate.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 594.
Molecular Weight:
44 | 39 kDa (A. thaliana)
Not reactive in:
Proteobacteria
Selected references:
To be added when available. Antibody released in May 2023.
Special application note:
Antibody can be used as a marker of chloroplast stroma.DyLight 594 has Amax = 593 nm, Emax = 618 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
PRK ribulose-5-P-kinase| phosphoribulokinase is an enzyme that catalyzes the chemical reaction ATP + D-ribulose 5-phosphate to ADP + D-ribulose 1,5-bisphosphate.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 488.
Molecular Weight:
44 | 39 kDa (A. thaliana)
Not reactive in:
Proteobacteria
Selected references:
To be added when available. Antibody released in May 2023.
Special application note:
Antibody can be used as a marker of chloroplast stroma.DyLight 488 Amax = 493 nm, Emax = 519 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
PRK ribulose-5-P-kinase| phosphoribulokinase is an enzyme that catalyzes the chemical reaction ATP + D-ribulose 5-phosphate to ADP + D-ribulose 1,5-bisphosphate.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
PRK ribulose-5-P-kinase| phosphoribulokinase is an enzyme that catalyzes the chemical reaction ATP + D-ribulose 5-phosphate to ADP + D-ribulose 1,5-bisphosphate.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
PRK ribulose-5-P-kinase| phosphoribulokinase is an enzyme that catalyzes the chemical reaction ATP + D-ribulose 5-phosphate to ADP + D-ribulose 1,5-bisphosphate.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Antibody detects PRK using a load from 4-20 g/well of a chloroplast fraction, incubation over night at 4 C
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
44 | 39 kDa (A. thaliana)
Not reactive in:
Proteobacteria
Selected references:
Fukayama et al. (2018). Expression level of Rubisco activase negatively correlates with Rubisco content in transgenic rice. Photosynth Res. 2018 May 30. doi: 10.1007/s11120-018-0525-9.P rez-Ruiz et al. (2017). NTRC-dependent redox balance of 2-Cys peroxiredoxins is needed for optimal function of the photosynthetic apparatus. Proc Natl Acad Sci U S A. 2017 Nov 7;114(45):12069-12074. doi: 10.1073/pnas.1706003114.Rai et al. (2017). Real-time iTRAQ-based proteome profiling revealed the central metabolism involved in nitrogen starvation induced lipid accumulation in microalgae. Sci Rep. 2017 Apr 5;7:45732. doi: 10.1038/srep45732. (microalga, western blot)Nikkanen et al. (2016). Crosstalk between chloroplast thioredoxin systems in regulation of photosynthesis. Plant Cell Environ. 2016 Aug;39(8):1691-705. doi: 10.1111/pce.12718.
Special application note:
Antibody can be used as a marker of chloroplast stroma
Chicken anti-Presenilin-2 (PS-2) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Presenilin-2 (PSEN2) is a multi-pass membrane protein and component of the gamma-secretase complex. Defects in PSEN2 are a cause of Alzheimer disease type 4 (AD4), an autosomal dominant Alzheimer disease. (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Mixture of two human Presenilin 2 peptides (319-330 and 349-360 aa). Both sequences are highly conserved in human, mouse and rat.
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
WB and ELISA. Suggested dilution of 1:1,000 to 1:4,000. To minimise background staining, a higher concentration of detergent (such as Tween-20) is suggested in the dilution and washing steps. Biosensis recommends that the optimal working dilution should be determined by the end user.
Rabbit anti-Presenilin 2 loop region Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Autosomal dominant mutations in presenilin 2 are the second major cause of early-onset familial Alzheimer's disease. Presenilin 2 is a multi-transmembrane protein which undergoes endoprotelysis to form an N-terminal fragment of about 29 kDa and C-terminal fragment of about 22 kDa. Presenilin 2 forms the catalytic core of the gamma-secretase complex which cleaves type 1 transmembrane proteins including the amyloid precursor protein to generate the C-terminus of the amyloid beta peptide.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested dilution of 1:1,000 is recommended for WB. Full length presenilin 2 (448 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 22 kDa with this antibody. Human or mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. The suggested dilution for IP is 1:100 . Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
AD3LP, AD5, E5-1, STM-2
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by Western blot using mouse and human brain and knock down of presenilin 2 in vitro using siRNA see ref 6 below. Not reactive with presenilin 1.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Presenilin 1 (PS-1) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Presenilin-1 (PSEN1) is a multi-pass membrane protein and component of the gamma-secretase complex. PSEN1 is thought to play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. It may also play a role in hematopoiesis. Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3), a familial early-onset form of Alzheimer disease (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide corresponding to a region (1-20 aa) from the N-terminus of human Presenilin 1 conjugated to Diptheria toxoid.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
IF and WB. Suggested dilution of 1:2,000 is recommended for WB. On SDS-PAGE, the predominant form detected by this antibody is the N-terminal Presenilin 1 fragment of approx 29 kDa. The uncleaved form of Presenilin 1 migrates to approx 45 kDa. Human and mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3M), SDS (1%) in 62.5 mM Tris-HCl pH 6.8 sample buffer heated to 50C for 15 min. The suggested dilution for IF is 1:100 for acetone or paraformaldehyde fixed cells or tissue. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Presenilin 1; PS-1; Protein S182; PS1-CTF12; PSEN1; AD3; PS1; PSNL1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity confirmed by WB and IF using transfected cells, Presenilin 1 knock-out mouse cells, mouse and human brain.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Chicken anti-Presenilin-1 (PS-1) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Presenilin-1 (PSEN1) is a multi-pass membrane protein and component of the gamma-secretase complex. PSEN1 is thought to play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. It may also play a role in hematopoiesis. Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3), a familial early-onset form of Alzheimer disease (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Mixture of two human Presenilin 1 peptides (311-322 and 341-352 aa). Both sequences are highly conserved in human, mouse and rat.
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
WB and ELISA. Suggested dilution of 1:1,000 to 1:4,000. To minimise background staining, a higher concentration of detergent (such as Tween-20) is suggested in the dilution and washing steps. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Presenilin 1; PS-1; Protein S182; PS1-CTF12; PSEN1; AD3; PS1; PSNL1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Presenilin 1
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Presenilin 1 loop region Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Presenilin-1 (PSEN1) is a multi-pass membrane protein and component of the gamma-secretase complex. PSEN1 is thought to play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. It may also play a role in hematopoiesis. Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3), a familial early-onset form of Alzheimer disease (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (GDPEAQRRVSKNSKYNA-C) corresponding to human PS1 [301-317] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blot. Suggested dilution of 1:1,000 is recommended for WB. Full length presenilin 1 (467 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 19 kDa. Human or mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Presenilin 1; PS-1; Protein S182; PS1-CTF12; PSEN1; AD3; PS1; PSNL1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by Western blotting using transfected cells, presenilin 1 knock-out mouse cells and mouse and human brain.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Plastocyanin is a “blue” copper protein which catalyzes electron transfer between the cytochrome b6 .f complex and P-700, the reaction center of photosystem I. Plastocyanin is a nuclear encoded polypeptide in all eukaryotic photosynthetic organisms where it has been studied. It is synthesized as a pre-protein of approximate molecular weight 17,000, imported post-translationally into chloroplasts, and processed to its mature form of approximate molecular weight 10,500 within the plastid.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Expected Species:
Chlorella fusca, Pediastrum boryanumSpecies of your interest not listed? Contact us
Immunogen:
GST fusion to Pre-apoplastocyanin of Chlamydomonas reinhartii P18068
This antibody is recognizing pre-apoplatosyanin 17 kDa precursor and a mature protein. There is a slight cross-reactivity with cytochreom c6 in extract from Chlamydomonas reinhardtii cells grown under conditions of cooper deficiency.
Application Details:
1 : 1000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
17 kDa (precursor)
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Li et al. (1996). Molecular genetic analysis of plastocyanin biosynthesis in Chlamydomonas reinhardtii.. J. Biol. Chem. 271:31283-31289
Special application note:
This product can be sold containing ProClin if requested.
The PRAME [IHC092] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC092
GMDN Code:
65250
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Melanoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
The PRAME [IHC092] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC092
GMDN Code:
65250
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Melanoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
The PRAME [IHC092] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC092
GMDN Code:
65250
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Melanoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
PR-5 (Pathogenesis-related protein 5) is involved in plant pathogen defence.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabidopsis thaliana
Immunogen:
KLH-conjugated synthetic peptide derived from Arabidopsis thaliana UniProt: P28493,TAIR:AT1G75040The peptide is not found in other thautamin-like proteins.
PR-4 (Pathogenesis-related protein 4) involved in defence response. Similar to the antifungal chitin-binding protein hevein from rubber tree latex. mRNA levels increase in response to ethylene and turnip crinkle virus infection.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Capsicum chinense , Carica papaya, Chimonanthus praecox, Drosera adelae, Eutrema japonicum, Ficus pumila var. awkeotsang , Hevea brasiliensis, Hordeum vulgare, Glycine max, Medicago truncatula, Morus notabilis, Phaseolus vulgaris, Pisum sativum, Populus trichocarpa, Prunus dulcis, Ricinus communis, Solanum tuberosum, Theobroma cacao, Triticum aestivum, Triticum urartu , Vitis pseudoreticulata Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from Arabidopsis thaliana PR-4 protein sequence, UniProt:P43082 , TAIR:AT3G04720
Pathogenesis-related (PR) proteins, are induced in response to the infection of plants with microbial pathogens. Combinations of glucanase I and chitinase I are potent inhibitors of fungal growth in vitro however precise mechanism of that is still not known. Glucanase I (PR-2) and chitinase I (PR-3) contribute to defense against fungal infection and are currently used as markers for innate immunity, and in particular the ethylene/jasmonate signalling pathway in pathogenesis.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Arabidopsis thaliana, Manihot esculenta, Zea maysSpecies of your interest not listed? Contact us
Immunogen:
Purified tobacco class I chitinase. The preparation used is a mixture of two class I isoforms (Shinshi et al., 1990; van Buuren et al., 1992): 1) Chitinase A (CHN A) P08252 encoded by gene chn48 derived from the N. tomentosiformis ancestor of tobacco. 2) Chitinase B (CHN B) P24091 encoded by gene chn50 derived from the N. sylvestris ancestor of tobacco.
Applications:
Co-Immunoprecipitation (IP) (Co-IP), Immunolocalization (IL), Western blot (WB)
Important note: For blocking 5 % skim milk in PBS without Ca++ should be used,This antibody is purified by affinity chromarography on Portein G
Application Details:
8 g/ml (WB)
Purity:
Total IgG. Protein G purified in PBS pH 7.4.
Reconstitution:
For reconstitution add 100 l of sterile water
Molecular Weight:
35, 34 | 32 and 34 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Mansilla et al. (2020).- Characterization of functionalized bentonite as nanocarrier of salicylic acid with protective action against Pseudomonas syringae in tomato plants. Eur J Plant Pathol 158, 211?222 (2020). https://doi.org/10.1007/s10658-020-02067-wColman et al. (2019). Chitosan microparticles improve tomato seedling biomass and modulate hormonal, redox and defense pathways. Plant Physiology and Biochemistry Volume 143, October 2019, Pages 203-211. Kumari et al. (2017), Overexpression of a Plasma Membrane Bound Na+/H+ Antiporter-Like Protein (SbNHXLP) Confers Salt Tolerance and Improves Fruit Yield in Tomato by Maintaining Ion Homeostasis. Front Plant Sci. 2017 Jan 6;7:2027. doi: 10.3389/fpls.2016.02027.Jespersen et al. (2017). Metabolic Effects of Acibenzolar-S-Methyl for Improving Heat or Drought Stress in Creeping Bentgrass. Front Plant Sci. 2017 Jul 11;8:1224. doi: 10.3389/fpls.2017.01224. eCollection 2017. (western blot, Agostis stolonifera cv. ?Penncross?)Ko et al. (2016). Constitutive expression of a fungus-inducible carboxylesterase improves disease resistance in transgenic pepper plants. Planta. 2016 Aug; 244(2):379-92. doi: 10.1007/s00425-016-2514-6. Epub 2016 Apr 13.
Special application note:
Antibody is recognizing closely related tobacco class I isoforms: endochitinase A CHN-A (ca. 34 kDa) and endochitinase B CHN-B (ca. 32 kDa)This antibody can be used as a marker of vacuolar contents Keefe et al. (1990). The effect of ethylene on the cell-type-specific and intracellular localization of β-1,3-glucanase and chitinase in tobacco leave. Plant 182: 43-51.
PR-2 (Pathogenesis-related protein 2) is involved in the defence of plants against pathogens. This protein has a catalytic activity and is hydrolysing of (1->3)-beta-D-glucosidic linkages in (1->3)-beta-D-glucans, EC=3.2.1.39. Alternative names:Glucan endo-1,3-beta-glucosidase, acidic isoform,(1->3)-beta-glucan endohydrolase, Beta-1,3-endoglucanase, Beta-1,3-glucanase 2
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Agostis stolonifera cv. ‘Penncross’, Arabidopsis thaliana, Glycine max (roots)
Expected Species:
Brassica juncea, Brassica oleracea, Citrus chinensis, Glycine max, Litchi chinensis, Manihot esculenta, Nicotiana tabacum Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from Arabidopsis thaliana PR-2 UniProt P33157, TAIR AT3G57260
Does not cross-react with other 1,3-beta glucosidases
Application Details:
1 : 1000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
37,3 kDa (processing aa 1-30, mature peptide 34,1 kD)
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Dong et al. (2020). Overexpression of BrAFP1 gene from winter rapeseed (Brassica rapa) confers cold tolerance in Arabidopsis. Plant Physiol Biochem. 2020 Jul 25;155:338-345.doi: 10.1016/j.plaphy.2020.07.011. Lv et al. (2019). Uncoupled Expression of Nuclear and Plastid Photosynthesis-Associated Genes Contributes to Cell Death in a Lesion Mimic Mutant. Plant Cell. 2019 Jan;31(1):210-230. doi: 10.1105/tpc.18.00813.Jespersen et al. (2017). Metabolic Effects of Acibenzolar-S-Methyl for Improving Heat or Drought Stress in Creeping Bentgrass. Front Plant Sci. 2017 Jul 11;8:1224. doi: 10.3389/fpls.2017.01224. eCollection 2017. (western blot, Agostis stolonifera cv. ?Penncross?)Kim et al. (2014). The Arabidopsis Immune Adaptor SRFR1 Interacts with TCP Transcription Factors thatRedundantly Contribute to Effector-Triggered Immunity. Plant J. 2014 Apr 1. doi: 10.1111/tpj.12527.
Special application note:
This product can be sold containing Proclin if requested
Pathogenesis-related (PR) proteins, are induced in response to the infection of plants with microbial pathogens. Combinations of glucanase I and chitinase I are potent inhibitors of fungal growth in vitro however precise mechanism of that is still not known. Glucanase I and chitinase I contribute to defense against fungal infection and are currently used as markers for innate immunity, and in particular the ethylene/jasmonate signalling pathway in pathogenesis. Alternative names of the protein: basic beta-1,3-glucanase
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Dicots, Oryza sativa, Prunus persicaSpecies of your interest not listed? Contact us
Immunogen:
Purified tobacco class I, basic -1,3-glucanase. Purified GLU I consists of a mixture of closely related polypeptides encoded by a family of GLU I genes comprising GLA B5APL3 derived from the sylvestris ancestor of tobacco, GLB P27666 derived from the tomentosiformis ancestor of tobacco and homeologous recombinants (Sperisen et al., 1991). Mature GLU I is processed from a pre-pro-polypeptide (Shinshi et al., 1988).
Important note: for blocking 5 % skim milk in PBS without Ca++ should be used.This antibody is purified by affinity chromarography on Portein G.
Application Details:
8 g/ml (WB)
Purity:
Total IgG in PBS pH 7.4. (without Ca++).
Reconstitution:
For reconstitution add 100 l of sterile water
Molecular Weight:
37 | 33 kDa
Not reactive in:
Arabidopsis thaliana
Selected references:
Li et al. (2021) Penicillium chrysogenum polypeptide extract protects Nicotiana benthamiana against TMV infection through modulation of ABA biosynthesis and callose priming. J Exp Bot. 2021 Mar 4:erab102. doi: 10.1093/jxb/erab102. Epub ahead of print. PMID: 33687058. (Immunolocalization)Colman et al. (2019). Chitosan microparticles improve tomato seedling biomass and modulate hormonal, redox and defense pathways. Plant Physiology and Biochemistry. Volume 143, October 2019, Pages 203-211. Martin-Saladana et al. (2018). Salicylic acid loaded chitosan microparticles applied to lettuce seedlings: Recycling shrimp fishing industry waste. Carbohydrate Polymers Volume 200, 15 November 2018, Pages 321-331.Wang et al. (2014). Elicitation of Hypersensitive Responses in Nicotiana glutinosa by the Suppressor of RNA Silencing Protein P0 from Poleroviruses. Mol Plant Pathol. 2014 Sep 4. doi: 10.1111/mpp.12201.Huey-wen et al. (2014). Harpin Protein, an Elicitor of Disease Resistance, Acts as a Growth Promoter in Phalaenopsis Orchids. Journal of Plant Growth Regulation May 2014.
Special application note:
For more details on immunolocalization, please referr to Keefe et al (1990). Plant 182: 43-51.This antibody can be used as a marker of vacuolar contents Keefe et al. (1990). The effect of ethylene on the cell-type-specific and intracellular localization of β-1,3-glucanase and chitinase in tobacco leave. Plant 182: 43-51.
Pathogenesis-related protein 1 (PR-1) is partially responsible for acquired pathogen resistance. Induced by INA, salicylic acid and pathogen infection.This product is a recombinant PR-1 protein, trunctated by first 26 amino acids, source: Arabidopsis thaliana, UniProt: P33154, TAIR: At2g14610
Product Type:
Antibody
Format:
Lyophilized in glycerol.
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Concentration: after adding 90 l of sterile milliQ water final concentration of the standard is 0.10 pmoles/ lProtein standard buffer composition: Glycerol 10%, Tris Base 141 mM, Tris HCl 106 mM, LDS 2%, EDTA 0.51 mM, SERVA Blue G250 0.22 mM, Phenol Red 0.175 mM, pH 8.5, 0.1mg/ml PefaBloc protease inhibitor (Roche), 50mM DTT.This standard is ready-to-load and does not require any additions or heating. It needs to be fully thawed and thoroughly mixed prior to using. Avoid vigorous vortexing, as buffers contain detergent. Following mixing, briefly pulse in a microcentrifuge to collect material from cap.This standard is stabilized and ready and does not require heating before loading on the gel.Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Application Details:
Standard curve: 3 loads are recommended eg.0.5, 2 and 4μl.For most applications a sample load of 10-20 μg of protein will provide with a signal in this range.Positive control:a 2μl load per well is optimal for most chemiluminescent detection systems.This standard is stabilized and ready and does not require heating before loading on the gel.Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Reconstitution:
For reconstitution add 90 l of sterile water, Please notice that this product contains 10% glycerol and might appear as liquid but is provided lyophilized
Molecular Weight:
16,4 kDa
Special application note:
The PR-1 protein standard can be used in combination with anti-PR-1 antibodies to quantitate PR-1 protein. Quantitative western blot: detailed method description, video tutorialThis product can be sold containing ProClin if requested
Pathogenesis-related protein 1 (PR-1), small antimicrobial protein which acts as a marker of plant immune signaling and is partially responsible for acquired pathogen resistance. Induced by INA, salicylic acid and pathogen infection.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Re-using of antibody solution is not recommended, It will contribute to incrteased background signal
Application Details:
1 : 2500 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
17.7 kDa (Arabidopsis thaliana)
Not reactive in:
Citrus sinensis,
Selected references:
Li et al. (2020). N-terminal acetylation stabilizes SIGMA FACTOR BINDING PROTEIN 1 involved in salicylic acid-primed cell death. Plant Physiol. 2020 Mar 5. pii: pp.01417.2019. doi: 10.1104/pp.19.01417.Jung et al. (2020). Pathogen-associated Molecular Pattern-triggered Immunity Involves Proteolytic Degradation of Core Nonsense-mediated mRNA Decay Factors During the Early Defense Response. Plant Cell, February 2020. Chang et al. (2019). PBS3 Protects EDS1 from Proteasome-Mediated Degradation in Plant Immunity. Mol Plant. 2019 Feb 11. pii: S1674-2052(19)30055-3. doi: 10.1016/j.molp.2019.01.023.Lv et al. (2019). Uncoupled Expression of Nuclear and Plastid Photosynthesis-Associated Genes Contributes to Cell Death in a Lesion Mimic Mutant. Plant Cell. 2019 Jan;31(1):210-230. doi: 10.1105/tpc.18.00813.Cecchini et al. (2018). Underground azelaic acid-conferred resistance to Pseudomonas syringae in Arabidopsis. Mol Plant Microbe Interact. 2018 Aug 29. doi: 10.1094/MPMI-07-18-0185-R.Chakraborty et al. (2018). Epigenetic and transcriptional control of chickpea WRKY40 promoter activity under Fusarium stress and its heterologous expression in Arabidopsis leads to enhanced resistance against bacterial pathogen. Plant Science, doi.org/10.1016/j.plantsci.2018.07.014Izquierdo et al. (2018). Arabidopsis nonresponding to oxylipins locus NOXY7 encodes a yeast GCN1 homolog that mediates noncanonical translation regulation and stress adaptation. Plant Cell Environ. 2018 Mar 2. doi: 10.1111/pce.13182.Seguel et al. (2018). PROHIBITIN 3 forms complexes with ISOCHORISMATE SYNTHASE 1 to regulate stress-induced salicylic acid biosynthesis in Arabidopsis. Plant Physiol. Jan 2018. DOI:10.1104/pp.17.00941Huh et al. (2017). Protein-protein interactions in the RPS4/RRS1 immune receptor complex. PLoS Pathog. 2017 May 5;13(5):e1006376. doi: 10.1371/journal.ppat.1006376.Zhang et al. (2017). A suite of receptor-like kinases and a putative mechano-sensitive channel are involved in autoimmunity and plasma membrane-based defenses in Arabidopsis. Mol Plant Microbe Interact. 2017 Jan 4. doi: 10.1094/MPMI-09-16-0184-R.Zhu et al. (2016). CML8, an Arabidopsis calmodulin-like protein plays a role in Pseudomonas syringae plant immunity. Plant Cell Physiol. 2016 Nov 10. pii: pcw189. [Epub ahead of print]
Special application note:
PR-1 protein is present in very low amonts in non-induced plant material.Overnight antibody incubation is not recommended.This product can be sold containing Proclin if requested.
PPR (Pentatricopeptide repeat-containing protein, chloroplastic - SOT1) is located in chloroplast. Alternative name: Pentatricopeptide repeat-containing protein At5g46580, chloroplastic.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabidopsis lyrata, Capsella rubellaSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana SOT 1 sequence, Uniprot: Q9LS25, TAIR: At5g46580
Polyphenol oxidase participates in the response of plants to wounding and herbivore attack, mediated by the octadecanoid wound-signalling pathway. Chloroplast polyphenol oxidase is a nuclear-encoded protein that is targeted to the thylakoid lumen. It was found that polyphenol oxidase is one of the most strongly phosphorylated protein in thylakoid lumen although the role of this protein modification is not known. Alternative name: catechol oxidase.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at short-term 4 C, Long-term -20 . Repeated freezing and thawing is not recommended. It ontains 0,01% sodium azide.
Host Animal:
Rabbit
Species Reactivity:
Spinacia oleracea
Expected Species:
Spinacia oleracea
Immunogen:
recombinant lumenal polyphenol oxidase of Spinacia oleracea UniProt: P43310
Papain (EC=3.4.22.2) is a cysteine protease which belongs to peptidase C1 family. Can cause an allergic reaction in humans. Alternative names: Papaya proteinase I, allergen= Car p 1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Carica papaya
Expected Species:
Carica papaya
Immunogen:
Native papain isolated and purified from Carica papaya
Applications:
ELISA (ELISA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western blot (WB)
Biotin/IgG protein molar ration is approximately 6,2, No foreign proteins are added
Application Details:
1 : 1000-1 : 100 000 (ELISA), (IF), (IHC), (WB)
Purity:
Purified IgG in PBS.
Reconstitution:
For reconstitution add 0,5 ml of sterile destilled water
Molecular Weight:
38,9 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Antibody is labelled with biotin using N-hydroxysuccinimidobiotin, Antibody potency and purity has been evaluated by immunoelectrophoresis, single radial immunodiffusion (Ouchterlony), ELISA,immunoblotting and enzyme inhibition
Papain (EC=3.4.22.2) is a cysteine protease which belongs to peptidase C1 family. Can cause an allergic reaction in humans. Alternative names: Papaya proteinase I, allergen= Car p 1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Carica papaya
Expected Species:
Carica papaya
Immunogen:
native papain isolated and purified from Carica papaya
Applications:
ELISA (ELISA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western blot (WB)
Antibodies have been purified using solid phase affinity chromatography and are stabilized with dextran
Application Details:
1 : 1000-1 : 100 000 (ELISA), (IF), (IHC), (WB)
Purity:
Immunogen affinity purified IgG in PBS.
Reconstitution:
For reconstitution add 0,5 ml of sterile destilled water
Molecular Weight:
38,9 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Antibody potency and purity has been evaluated by immunoelectrophoresis, single radial immunodiffusion (Ouchterlony), ELISA,immunoblotting and enzyme inhibition
Papain (EC=3.4.22.2) is a cysteine protease which belongs to peptidase C1 family. Can cause an allergic reaction in humans. Alternative names: Papaya proteinase I, allergen= Car p 1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Carica papaya
Expected Species:
Carica papaya
Immunogen:
native papain isolated and purified from Carica papaya
Applications:
ELISA (ELISA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western blot (WB)
The IgG (7S) fraction is prepared from the antiserum by ammonium sulphate precipitation and ion exchange chromatography
Application Details:
1 : 1000-1 : 100 000 (ELISA), (IF), (IHC), (WB)
Purity:
Purified IgG in PBS.
Reconstitution:
For reconstitution add 1 ml of sterile destilled water
Molecular Weight:
38,9 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Antibody potency and purity has been evaluated by immunoelectrophoresis, single radial immunodiffusion (Ouchterlony), ELISA,immunoblotting and enzyme inhibition
PPH1/TAP38 (Protein phosphatase 1) is a choroplast protein phosphatase TAP38/PPH1, required for efficient dephosphorylation of the LHCII anthena and state transition from state 2 to state 1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Cajanus cajan, Cephalotus follicularis, Cicer arietinum, Cucumis melo, Glycine soja, Gossypium hirsutum, Ilex paraguariensis, Mesembryanthemum crystallinum, Nelumbo nucifera, Nicotiana tabacum, Noccaea caerulescens, Populus trichocarpa, Ricinus communis, Theobroma caca, Vigna radiata var. radiata Species of your interest not listed? Contact us
PPDK (Pyruvate, phosphate dikinase 1) is involved in formation of phosphoenolpyruvate and activated by light-induced dephosphorylation. Inhibited by dark-induced phosphorylation. PPDK is a low-abundance enzyme in C3 plants while it is a key enzyme of C4 photosynthesis.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Hordeum vulagre, Kalanchoe fedtschenkoiSpecies of your interest not listed? Contact us
Immunogen:
Purified recomibinant enzyme consisting of residues 72-947 of Zea mays, UniProt: P11155Peptide used to elicit this antibody is conserved in both isoforms of PPDK in rice: PPDK1 and PPDK2.
PPDK levels inr C3 plants like Arabidopsis thaliana and Hordeum vulgare are very low and PPDK protein is very dilute in most tissues of C3 plants. To perform detection in C3 plants leaf proteins needs to be concentrated before western blot, Chastain et al. (2002).
Application Details:
1 : 25 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 200 l of sterile water in 40% glycerol to a final protein concentration of 100 ng/ l
Molecular Weight:
102 | 95 kDa
Not reactive in:
Cucumis sativus
Selected references:
Shen et al. (2016). The existence of C4-bundle-sheath-like photosynthesis in the mid-vein of C3 rice. Rice (N Y). 2016 Dec;9(1):20. doi: 10.1186/s12284-016-0094-5. Epub 2016 May 10.
PPD2 (protein PEABOD 2) belongs to the TIFY/JAZ family and is involved in lamina development, regulating leaf size and its curvature. Alternative name: Protein TIFY4B
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
PP2A (Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit B' gamma isoform) is required for the formation of the PP2A holoenzyme that negatively regulates brassinosteroid signaling by dephosphorylating and inactivating BRI1 in the cytoplasm and is involved in growth regulation and stress signaling. Alternative names: AtB' gamma, PP2A, B' subunit, gamma isoform
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Oryza sativa
Expected Species:
Brassica olereacea, Pisum sativum Species of your interest not listed? Contact us
Chlorophylls are one of the most abundant classes of natural pigments and have an essential role in radiant energy absorptions during photosynthesis in bacteria, algae, and higher plants. Chlorophylls occur as noncovalently bound components of pigment-protein complexes, chloroplast-localized light-harvesting antennas LHC and photosynthetic reaction centers of PSI and PSII. Upon illumination the arrest in chlorophyll biosynthesis is ended and the etiolated parts of the plant and enzymatic photoreduction of protochlorophyllide (Pchlide) to chlorophyllide (Chlide), catalysed by POR enzyme.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
POR is present in high amounts in chloroplasts not exposed to light (etioplasts),
Application Details:
1: 500 (IL), 1 : 2000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
36-37 kDa (Arabidopsis thaliana)
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Lee et al (2021). Chaperone-like protein DAY plays critical roles in photomorphogenesis. Nat Commun. 2021 Jul 7;12(1):4194. doi: 10.1038/s41467-021-24446-5. PMID: 34234144; PMCID: PMC8263706.Floris & K hlbrandt. (2021). Molecular landscape of etioplast inner membranes in higher plants. Nat Plants. 2021 Apr;7(4):514-523. doi: 10.1038/s41477-021-00896-z. Epub 2021 Apr 19. PMID: 33875833.Dogra et al. (2019). Oxidative post-translational modification of EXECUTER1 is required for singlet oxygen sensing in plastids. Nat Commun. 2019 Jun 27;10(1):2834. doi: 10.1038/s41467-019-10760-6. Zhang et al. (2018). Nitric oxide regulates chlorophyllide biosynthesis and singlet oxygen generation differently between Arabidopsis and barley. Nitric Oxide. 2018 Mar 3;76:6-15. doi: 10.1016/j.niox.2018.03.001.Han et al. (2015). A nuclear-encoded chloroplast-targeted S1 RNA-binding domain protein affects chloroplast rRNA processing and is crucial for the normal growth of Arabidopsis thaliana. Plant J. 2015 Jul;83(2):277-89. doi: 10.1111/tpj.12889. Epub 2015 Jun 15.
Mouse anti-Polyubiqutin-B Monoclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
Ubiquitin is a highly conserved 76 amino acid protein with an estimated molecular weight of 8.56 kDa which has a central role in regulated protein degradation. It is a protein modifier which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Several types of polymeric chains can be formed depending on the lysine used for the assembly. Attachment to proteins as a polymer leads to their degradation by the 26S proteosome; a complex, multicatalytic cytosolic and nuclear protease. Attachment to proteins as a monomer or as an alternatively linked polymer does not lead to proteasomal degradation and may be required for numerous functions, including maintenance of chromatic structure, regulation of gene expression, stress response, ribosome biogenesis and DNA repair. Ubiquitin is synthesized as a polyubiquitin precursor with exact head to tail repeats, the number of repeats of which differ between species and strains. In some species there is a final amino-acid after the last repeat, here in bovine a Cys. Some ubiquitin genes contain a single copy of ubiquitin fused to a ribosomal protein (either L40 or S27a).
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Mouse
Species Reactivity:
Bovine,C. elegans,Chicken,Drosophila,Human
Immunogen:
Raised against purified ubiquitin conjugated with glutaraldehyde to keyhole limpet hemocyanin.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Clone number:
Ubi-1
Antibody Isotype:
IgG1
Application Details:
Western Blotting (WB), Immunohistochemistry - paraffin embedded tissue (IH-P) and ELISA. Suggested dilution for WB is 1:500-1,000. This antibody can be used on mildly fixed histological sections of human brain for studies of Alzheimer's disease. This antibody also works on paraffin embedded material. It also recognises other ubiquinated inclusion bodies such as Lewy bodies of Parkinson's disease and the Pick bodies in Pick's disease in formalin fixed tissues. Suggested dilution for IH is 1:500. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Josephs K.A. et al (2006) Atypical progressive supranuclear palsy with corticospinal tract degeneration. J Neuropathol Exp Neurol. 2006 Apr;65(4):396-405. Josephs K.A. et al (2007) Neuropathologic features of frontotemporal lobar degeneration with ubiquitin-positive inclusions with progranulin gene (PGRN) mutations. J Neuropathol Exp Neurol. 2007 Feb;66(2):142-51. Rudzinski L.A. et al (2008) Early onset familial Alzheimer Disease with spastic paraparesis, dysarthria, and seizures and N135S mutation in PSEN1. Alzheimer Dis Assoc Disord. 2008 Jul-Sep;22(3):299-307. Josephs K.A. et al (2009) Evaluation of subcortical pathology and clinical correlations in FTLD-U subtypes. Acta Neuropathol. 2009 Sep;118(3):349-58.
Specificity:
The specificity of this antibody has been confirmed by WB. This antibody detects ~8.5 kDa Ubiquitin. Hu, Bov, Chk, Drosophila, and C. elegans
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Poly-L-Lysine coated glass slides. Adhesive to frozen and paraffin embedded tissue sections, cyto-centrifuge preparations and cytology smears. Used keep cells and or tissue from peeling off the slides during the experiment.
Product Type:
Plastics & Consumables
Storage Temp:
RT
Additional Info:
Poly-L-Lysine coated glass slides. Adhesive to frozen and paraffin embedded tissue sections, cyto-centrifuge preparations and cytology smears. Used keep cells and or tissue from peeling off the slides during the experiment.
Sheep anti Human C3c antibody recognizes the C3c component of human complement, formed as a result of the inactivation of C3b. Sheep anti Human C3c antibody may be used for the detection of C3 deposits in tissues following complement activation.
The ZAP70 (zeta-associated protein of 70 kDa) tyrosine kinase was identified as a tyrosine phosphoprotein that associates with TCR zeta subunit and undergoes tyrosine phosphorylation following TCR stimulation. ZAP70 is a Syk family tyrosine kinase primarily expressed in T and NK cells that plays an essential role in signaling through the TCR. TCR-mediated activation of T cells is crucial to the immune response. In humans, ZAP70 gene mutations resulting in lower ZAP70 protein expression levels or expression of catalytically inactive ZAP70 proteins, have been identified. ZAP70 deficiency results in the absence of mature CD8+ T cells and the prevention of TCR-mediated activation of CD4+ T cells, and it can lead to severe combined immunodeficiency.In patients with chronic lymphocytic leukemia (B-CLL), ZAP70 expression on B cell was shown to be correlated with disease progression and survival. ZAP70 contains two N-terminal SH2 domains (Src homology domain 2) and a C-terminal kinase domain. During T cell activation, the binding of ZAP70 SH2 domains to the phosphorylated zeta subunit on the activated TCR complex causes a colocalization with the Lck tyrosine kinase that phosphorylates ZAP70 on Tyr493 in the activation loop. ZAP70 autophosphorylates multiple tyrosines in the region between the SH2 domains and the kinase domain, including the binding sites for additional SH2-containing signaling proteins such as SLP76, LAT, Lck, PLCgamma1, Vav, Shc, Ras-GAP, and Abl. ZAP70-mediated activation of these downstream effectors leads to the release of intracellular calcium stores, and the transcription of interleukin-2 and other genes important for an immune response.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
The vesicular monoamine transporter is responsible for the vesicular uptake of monoamines, like dopamine, norepinephrine, epinephrine, serotonin and histamine. The antiserum recognizes monoaminergic neurons of the CNS, the ECL-cells of the stomach, as well as enteric nerve fibers. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of rat small intestine.
VIP is localized in nerve fibers of the central and peripheral nervous system, and is probably acting as a neurotransmitter. Smooth muscle relaxation, vasodilation and secretion from exocrine glands are some of the effects of VIP. The Verner-Morrison or Watery Diarrhea Hypokaliemia and Achlorhydria (WDHA) syndrome is a characteristic clinical syndrome associated with overproduction of VIP from endocrine tumors. These VIP-producing tumors are usually neuroblastomas of endocrine tumors in the pancreas. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while PHI, secretin, glucagon, GIP, and CCK do not. Positive control: formalin-fixed paraffin sections of cat ileum.
Regulates the level of GABA available for secretion via secretory vesicles. Marker for neurons using GABA as signaling substance. <br> Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: frozen sections of rat cerebellum.
The antiserum against the vesicular acetylcholine transporter is a unique immunohistochemical marker for cholinergic nerves, more specific than the commonly used acetylcholinesterase (AchE), since it does not react with postsynaptic neurons, and is more sensitive than choline acetyltransferase (ChAT). The antiserum recognizes VAChT both in the CNS and PNS. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of human small intestine (Stefanini fixation).
The antiserum against the vesicular acetylcholine transporter is a unique immunohistochemical marker for cholinergic nerves, more specific than the commonly used acetylcholine esterase (AchE), since it does not react with postsynaptic neurons, and is more sensitive than choline acetyltransferase (ChAT). The antiserum recognizes VAChT both in the CNS and PNS of rat and mouse. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of rat small intestine.
The antibody reacts with human natural and recombinant TNF-alpha as assessed by ELISA. The antibody inhibits the biological activity of human natural and recombinant TNF-alpha as determined with L929 and WEHI cells in a cytotoxicity assay. The antibody cross reacts with rhesus and cynomolgus natural TNF-alpha and lacks cross reactivity with human lymphotoxin.
Substance P occurs in nerve fibers of the central and peripheral nervous system and in endocrine cells of the gut. It stimulates smooth muscle contraction, gives rise to vasodilation and is involved in sensory functions. Substance P-containing tumors arising in the ileum are often associated with the carcinoid syndrome, characterized by flushing of the skin, diarrhea, broncho-constriction and sudden drops in blood pressure. Substance P is commonly found in the midgut carcinoids and some of the symptoms may be related to this peptide.<br>Absorption with 10-100 ug SP 1-4 per ml diluted antiserum abolishes the staining. Positive control: frozen sections of rat colon.
SLP76 (SH2 domain-containing leukocyte protein of 76 kDa) is a cytosolic adaptor protein which translocates to the plasma mambrane and is involved in multiple signaling pathways in T cells, mast cells, neutrophils and platelets; B cells express its analog SLP65/BLNK (B cell linker protein). SLP76 is phosphorylated by Syk-family and Tec-family tyrosine kinases and couples them to the phosphorylation and activation of PLC-gamma. Via Gads or Grb2, SLP76 also associates with LAT adaptor by involvement of SLP76 proline-rich region. The SH2 domain of SLP76 has been identified as the region involved in binding the serine/threonine kinase HPK1. HPK1 may act as both a positive and a negative regulator by promoting the Jnk-mitogen activated protein kinase (MAPK) pathway and inhibiting the pathway leading to AP-1 activation.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
Serotonin is produced by endocrine cells of the stomach, duodenum and ileum. The polyclonal antibody to serotonin can be used to differentiate tumors of serotoninergic origin. The antigen localization is cytoplasmic. <br>Absorption with 10-100 ug serotonin per ml diluted antiserum abolishes the staining. Positive control: duodenum.
The antibody reacts with secretory leukocyte proteinase inhibitor (SLPI; also known as antileukoprotease (ALP)). SLPI is a 11.7 kDa cationic inhibitor of neutrophil elastase and to a lesser extent of cathepsin G. It is locally produced by epithelial cells in the lung, skin and other organs, by Polymorphonuclear leukocytes (PMN) and (in mice) by macrophages. In addition to its proteinase inhibitory properties that may serve to protect against proteolytic injury, it was recently shown that SLPI also displays several other functions such as antimicrobial and anti-inflammatory activities. These appear to be independent of its ability to inhibit PMN serine proteinases. SLPI has also been demonstrated to display antibacterial and antifungal activity at concentrations in which SLPI is present in mucosal secretions including those of the lung. Another possible role for SLPI is inhibition of protein-disulphide isomerase that is considered essential for invasion of a cell by the Human Immunodeficiency Virus (HIV).
Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while glucagon, GIP, PP and VIP do not. Positive control: frozen sections of rat duodenum.
Pancreastatin is a fragment of chromogranin A and is produced by proteolytic processing of chromogranin A in several peptide hormone-producing cells, such as pancreatic islet cells and gut endocrine cells, as well as tumors arising from these cells. <br> Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: Bouin-fixed paraffin sections of rat pancreas.
Nitric oxide synthase is an enzyme catalizing the synthesis of NO from L-arginine. The antiserum was raised against a synthetic peptide of rat cerebellar NOS, that shows no homology with other related proteins. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: frozen sections of rat colon.
Located in the cell membrane of thyroid cells, NIS can allow sodium and iodine flow across the membrane. The antiserum is raised against the C-terminus of rat NIS. Suitable for studying the sensitivity of thyroid tumors to iodine treatment. Absorption with 50-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of rat thyroid.
The antibody reacts with rat Interferon gamma (IFN-gamma) of both natural and recombinant origin. IFN-gamma is a pluripotent cytokine with important pro-inflammatory functions. The antibody inhibits the biological activity of natural and recombinant rat IFN-gamma. The antigen specificity was further assessed by ELISA and Western blotting. No cross-reactivities with other cytokines have been detected.
The antiserum is raised against a synthetic peptide (SHMSTSAPPP) from the C-terminus of the rat CCK-A receptor. Suitable for labelling the receptors for the gastrointestinal hormone and neuropeptide CCK. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of rat pancreas.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Ohlsson, B. et al. J. Gastroenterol. 2000;35: 612-8
Specificity: absorption with 10-100 ug PYY per ml diluted antiserum abolishes the staining, while NPY and PP do not. Positive control: Bouin-fixed paraffin sections of rat colon and frozen sections of rat colon.
Neuropeptide Y is a peptide belonging to the PP-family and occurs in neurons and adrenal medullary cells. Antisera raised against NPY often cross-react with PP and PYY. This antiserum was raised using a synthetic peptide from the prepro-NPY sequence which has no homologies to PP and NPY. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: Stefanini-fixed sections of rat small intestine.
Pituitary adenylate cyclase activating peptide (PACAP), originally isolated from ovine hypothalamus, belongs to the VIP-family of peptides. PACAP-related peptide (PRP) is a 29-amino acid peptide, which is produced together with PACAP-27 and PACAP-38 when PreproPACAP is being processed. PRP is abundant in the brain, but can be also found in the respiratory and gastrointestinal tracts.<br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while PACAP-27, PACAP-38, VIP, PHI, CRF, oxytocin and vasopressin do not.<br>Positive control: Stefanini-fixed frozen sections of rat duodenum, fundus or antrum.
Oxytocin is synthesized in nerve cell bodies in the supraoptic nucleus and paraventricular nucleus, and carried by axonal transport to the neural stalk and pars nervosa where they are stored. Oxytocin nerve terminals can also be found throughout the CNS, even reaching the lower spinal cord. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of pig pituitary.
Ornithine decarboxylase is the rate-limiting enzyme in polyamine biosynthesis converting ornithine into putrescine. In normal tissue ornithine decarboxylase activity is low but increases in proliferating tissue. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: Stefanini-fixed frozen sections of renal cortex from testosterone-treated mice.
Neuropeptide Y is a peptide belonging to the PP-family and occurs in neurons and adrenal medullary cells. The brain contains large quantities of NPY and it is also found in the peripheral nervous system, where it coexists with noradrenaline in sympathetic fibers. NPY inhibits gut motility and causes vasoconstriction. Pheochromocytomas contain NPY. Absorption with 10-100 ug NPY 1-20 per ml diluted antiserum abolishes the staining, while PYY and PP do not. Positive control: Stefanini-fixed sections of rat small intestine.
Nitric oxide synthase is an enzyme catalizing the synthesis of NO from L-arginine. The antiserum was raised against a synthetic peptide of rat cerebellar NOS, that shows no homology with other related proteins. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: frozen sections of rat colon.
Absorption with 10-100 ug neurotensin per ml diluted antiserum abolishes the staining while glucagon, insulin, gastrin, GIP and VIP do not. Positive control: Bouin-fixed paraffin or Stefanini-fixed frozen sections of cat ileum.
Neuromedin U was found in porcine spinal cord. Neuromedin U-8 is contained within a larger polypeptide form neuromedin U-25. Neuromedin U is present in central and peripheral neurons, particularly in the enteric nervous system. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: frozen sections of chicken small intestine.
Neurokinin A/Substance K represents a member of the tachykinin family of peptides. Neurokinin A, which arises by cleavage of the substance P precursor, occurs in neurons in the central and peripheral nervous systems, and is particularly numerous in the gastrointestinal tract. The biological actions of neurokinin A are similar to those of substance P, and include vasodilation and stimulation of smooth muscle contraction. <br>Absorption with 10-100 ug NKA per ml diluted antiserum abolishes the staining, while substance P does not. Positive control: formalin-fixed paraffin sections of rat colon.
Rabbit anti Mycobacterium tuberculosis polyclonal antibody recognizes PPD from Mycobacterium tuberculosis. Rabbit anti M. tuberculosis has not been cross absorbed and may react with related micro-organisms, however the antibody is non-reactive with E.coli K12, Salmonella typhimurium, Pseudomonas aeruginosa, Streptococcus (group B), Candida albicans and Neisseria meningitidis.
The polyclonal antibody recognizes the extracellular part of the mouse Tumor Necrosis Factor Receptor type 2 (TNF-RII) of the membrane-bound as well as the soluble receptor. TNF-RII (~75-80 kDa) is present on most cell types and is considered to play a prominent role in cell stimulation by TNF-alpha. TNF-alpha activates inflammatory responses, induces apoptosis, regulates cellular proliferation, and may even promote cancer progression. The effects of TNF-alpha are mediated by TNF-RI and TNF-RII, which have both distinct and overlapping downstream signaling cascades. Induction of cytotoxicity and other functions are mediated largely via TNF-RI. TNF-RI is equally well activated by both the 17 kDa soluble and 26 kDa membrane-bound form, whereas TNF-RII is efficiently activated only by the membrane bound form of TNF-alpha. Binding of the inherently trimeric TNF-alpha to TNFR1 and TNFR2 induces receptor trimerization and recruitment of several signaling proteins to the cytoplasmic domains of the receptors. Occupancy of TNFR2 results in direct recruitment of TNF Receptor Associated Factor 2 (TRAF2), which in turn recruits TRAF1.
Tumor Necrosis Factor alpha (TNF-alpha) is a cytokine which has diverse immunomodulatory, anti-tumor and toxic effects. TNF-alpha has been detected in diverse inflammatory status and appears to be a critical mediator in the lethality of septic shock. Furthermore, TNF-alpha has also been found in inflammatory foci such as synovial effusions in rheumatoid arthritis, systemic circulation in septic shock, parasitemia and rejection of renal transplants. The antibody reacts with both rat and mouse natural and recombinant TNF-alpha and recognizes membrane and receptor bound TNF-alpha. The antibody shows neutralizing activity.
The antibody reacts with natural and recombinant mouse interleukin 6 (IL-6) as assessed by ELISA. The antibody inhibits the biological activity of natural and recombinant mouse IL-6 as determined with the B9 cell bio-assay. The antibody cross-reacts with natural rat IL-6. IL-6 is a pluripotent 20-22 kDa cytokine which plays a role in the pathophysiology of severe infection and regulates the immune response, acute phase reaction and hematopoiesis. IL-6 plays a critical role in B-cell differentiation to plasma cells and is a potent growth factor for plasmacytoma and myeloma. Continuous IL-6 gene expression makes an essential contribution to a multistep oncogenesis of plasma cell neoplasia. IL-6 is a very useful culture supplement for the generation of a high number of antibody-producing hybridomas.
SLP65 / BLNK (SH2 domain-containing leukocyte-specific phosphoprotein of 65 kDa; B cell linker protein), also known as BASH, is an adaptor protein that plays key role in B cell activation initiated by cross-linking the B cell receptor (BCR). Phosphorylated by Syk tyrosine kinase, SLP65 serves as a scaffold for Btk tyrosine kinase, Vav1 guanine nucleotide exchange factor, phospholipase C gamma2, as well as Grb2 and Nck adaptor proteins; thus represents a central linker protein that bridges the BCR-associated kinases with a multitude of signaling pathways.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
Specificity: absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: formalin-fixed paraffin sections of pig duodenum.
Lysozyme is a 14 kd enzyme directed against the b 1 a 4 glycosidic bond between N-acetylglucosamine and N-acetylmuramic acid residues that make up peptidoglycan. Lysozyme is an antimicrobial protein secreted by polymorphonuclear leukocytes and is widely distributed in secretions such as airway secretions and nasal fluid whereas it is the most effective antimicrobial protein. It is also produced by monocytes, macrophages and epithelial cells. Lysozyme is able to kill bacteria by enzymatic lysis of bacterial cell walls and by a nonenzymatic mechanism. Allthough lysozyme is highly active against many gram-positive bacteria it is ineffective against gram-negative bacteria unless potentiated by certain cofactors (lactoferrin, antibody-complement or hydrogen peroxide-ascorbic acid). Next to its antimicrobial activity lysozyme has many other physiological functions including inactivation of certain viruses, important roles in surveillance of membranes of mammalian cells, immune regulatory activity, anti-inflammatory and antitumor activity
LIME (Lck-interacting molecule) is a 30 kDa double-palmitoylated protein with unusually basic cytoplasmic domain, expressed by T cells. After ligation of CD4 or CD8 T cell coreceptors, LIME is phosphorylated by Src-family kinases and associates with Lck and Fyn kinases and with their negative regulator Csk. Interestingly, Csk-mediated phosphorylation of C-terminal negative-regulatory tyrosine of LIME-associated Lck can result in increase of enzymatic activity compared with the total pool of Lck, thus, LIME serves as a positive regulator of TCR-dependent T cell signaling. However, under some circumstances, LIME may mediate inhibitory signals.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
Laminin is a glycoprotein (Mr 850 - 1.000 kD, consisting of 3 glycosylated polypeptide chains with molecular weights of 440 and 225 (2x) kD) produced by various human epithelial and mesenchymal cells, and forms an extracellular matrix of thin filaments. In normal tissues, laminin is invariably present in all basal laminas surrounding muscle, nerve, fat and decidua cells and separates epithelial and endothelial cells from abutting connective tissues. Laminin has also been identified within the cytoplasm of breast epithelia, stromal cells of the endometrium, and within endothelial, bile duct epithelial and mesenchymal cells of the liver. Laminin has been found to be involved in cellular activities such as adhesion, spreading, differentiation, polarization, proliferation, locomotion, tissue invasion and chemotactic responses. <br />No cross reaction was obtained with human type I, III, IV and V collagen in immunoblotting, whereas the antibody reacted with a distinct band of appr. 200-220 kD from a 8M Urea extract from amnion basement membrane. Positive control: skin, kidney.
Kinesin belongs to the group of microtubule-associated motor proteins known to convert chemical energy released from nucleoside triphosphates (preferentially from ATP) into mechanical energy. Conventional kinesin, member of the kinesin superfamily comprising more than 100 proteins, is involved in the anterograde vesicle transport in neuronal cells. Kinesin purified from mammalian brain homogenates is a heterotetramer consisting of two heavy (120 to 130 kDa) and two light chains (60 to 70 kDa), resulting in a molecular mass about 400 kDa. Each heavy chain contains an N-terminal globular motordomain with both a microtubule-binding site and an ATPase active center, stalk region responsible for heavy chain dimerization and finally C-terminal globular tail domain, which is implicated in cargo binding. Light chains may have a regulatory function.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
The antiserum reacts positively with all stratified squamous epithelia and epidermal appendages such as hairfollicles, sebaceous glands. Also positive on epithelia of the urinary tract, stomach, intestine, uterine endometrium and prostate. Identifies mesotheliomas, squamous cell carcinomas, adenocarcinomas, transitional cell carcinomas and anaplastic carcinomas. Recommended for positive control: Squamous cell carcinoma, skin, cervix.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Contains 0.01% sodium azide
Storage:
2-8°C
References 1:
Ramaekers F et al. A Pathol Anat Histopathol 1985;408:127-142
The polyclonal antibody recognizes human intestinal fatty acid binding protein (I-FABP) of both natural and recombinant origin. The I-FABP protein is derived from the human FABP2 gene. FABPs are small intracellular proteins (~13-14 kDa) with a high degree of tissue specificity that bind long chain fatty acids. They are abundantly present in various cell types and play an important role in the intracellular utilization of fatty acids, transport and metabolism. There are at least nine distinct types of FABP, each showing a specific pattern of tissue expression. Due to its small size, FABP leaks rapidly out of ischemically damaged necrotic cells leading to a rise in serum levels. Ischemically damaged tissues are characterized histologically by absence (or low presence) of FABP facilitating recognition of such areas. I-FABP is localized in the small bowel epithelium, with highest expression level in the jejunum.
The polyclonal antibody reacts with human natural and recombinant Interleukin-8 (IL-8) as assessed by ELISA. The antibody inhibits the biological activity of human native and recombinant IL-8. The antibody cross reacts with rhesus and cynomolgus natural IL-8.
The antibody reacts specificly with human Interleukin (IL-1)RII. The IL-1 system includes two agonists (IL-1alpha and IL-1beta), converting enzymes, antagonists, two receptors (IL-1RI and IL-1RII) and the IL-1 receptor accessory protein. The IL-1RII is part of the antagonistic IL-1 mechanism. It is also known as decoy receptor and is a non signalling molecule which functions by capturing IL-1 and preventing it from interacting with the signalling IL-1RI. The decoy IL-1RII can after binding to IL-1 also recruit the IL-1 receptor accessory protein and thus inhibit by coreceptor competition. Further a soluble form of IL-1RII exists which is shed, a process in which matrix metalloproteases have been found to play a role, by various cells including monocytes, polymorphonuclear cells, B cells and fibroblasts.
Antibody Isotype:
Ig
Monosan Range:
MONOSAN
Concentration:
100 ug/ ml
Storage buffer:
PBS with 0.1% BSA and 0.02% sodium azide
Storage:
2-8°C
References 1:
Mantovani; A et al. Ann N Y Acad Sci 1998; 840: 338
The antibody reacts with human Interleukin-10 (IL-10) of both natural and recombinant origin. IL-10 is a pluripotent cytokine with important immunosuppressive actions: it can inhibit cytokines involved in the Th1 response such as IL-2, Interferon gamma and also inhibits the production of pro-inflammatory cytokines such as IL-1, IL-6, IL-8 and TNF-alpha. The antibody inhibits the biological activity of natural and recombinant human IL-10. The antigen specificity was further assessed by ELISA. No cross reactivities with other cytokines have been detected.
The antibody reacts with human gamma IFN (IFN-gamma) of both natural and recombinant origin. IFN-gamma is a pluripotent cytokine with important pro-inflammatory functions. The antibody inhibits the biological activity of natural and recombinant human IFN-gamma. The antigen specificity was further assessed by ELISA and Western blot. No cross reactivities with other cytokines have been detected.
Insulin is produced by the B-cells of the pancreatic islets. The antibody can be used for the diagnosis of pancreatic B-cell tumors. <br />Antigen localization: cyto-plasm, extracellular.<br />Positive control: Pancreas.
The antibody reacts with both intact human ICAM-1, CD54 and with soluble human ICAM-1. The antibody reacts also with ICAM-1 present on chimpanzee, rhesus monkey, cynomolgus monkey and baboon tissues.
Histidine decarboxylase (HDC) is the enzyme catalyzing the conversion of histidine into histamine. HDC can be found in the histamine secreting ECL cells of some species as well as in the mast cells. Absorption with 10-100 ug immunogen per ml diluted antiserum abolishesthe staining. <br>In Western blot the antiserum detects the 54 kDa and 73 kDa forms in addition to a 63 kDa form (rat stomach, see Dartsch et al., 1998).<br>Positive control: Stefanini-fixed frozen sections of rat fundus. <br> Dartsch, C., Chen, D. & Persson, L. Multiple forms of rat stomach histidine decarboxylase may reflect posttranslational activation of the enzyme. Regul. Pept. 77, 33-41 (1998).
Histamine is a neurotransmitter in the central nervous system as well as a mast cell constituent. In addition, histamine is produced by endocrine cells (ECL-cells) in the oxynthic mucosa of the stomach. Absorption with 10-100 ug histamine per ml diluted antiserum abolishes the staining, while noradrenaline, 5-HT, VIP, glucagon and histidine do not. Positive control: cryostat sections of carbodiimide fixed human skin or freeze-dried paraffin-sections (vapor fixed in diethylpyrocarbonate; DEPC) of rat stomach.
The peptide was found in the salivary gland venom of the lizard Gila monster. It belongs to the VIP-secretin family of peptides and has many VIP-like actions. Helospectin-immunoreactivity has been demonstrated in the neurons of the gut.<br> Absorption with 10-100 ug helospectin per ml diluted antiserum abolishes the staining, while secretin, PHI and PACAP do not. <br> Cross-reacts with helodermin. Positive control: Stefanini-fixed frozen sections of rat small intestine (1% carbodiimide added to the fixative).
Glicentin contains the glucagon sequence and is produced in a prominent population of endocrine cells in the distal intestine as well as in pancreatic glucagon cells and in the nerves in the brain. Serum levels of glicentin are elevated after food uptake and in certain clinical conditions, e.g. after resections of the intestine. The functional role of glicentin is largely unknown. Glicentin occurs in endocrine tumors arising in the distal intestine (rectal carcinoids) and in pancreatic islet cell tumors. <br>Absorption with 10-100 ug glucagon and glicentin per ml diluted antiserum abolishes the staining, while secretin, GIP and VIP do not. Positive control: formalin-fixed paraffin sections of pig pancreas.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Sjölund, K. et al. Gastroenterology 1983;85: 112030
Glicentin contains the glucagon sequence and is produced in endocrine cells of the distal intestine, in pancreatic glucagon cells and in the nerves in the brain. <br />This glicentin antibody is reactive with glycentin as well as glucagon. The antibody can be used for the diagnosis of tumors from the distal intestine (rectal carcinoids) as well as pancreatic islet cell tumors.<br />Positive control: Pancreas, small intestine.
GIP occurs in endocrine cells in the small intestine. GIP is released upon feeding, particularly after carbohydrate-rich food, and is known to sensitize the insulin cells to rise in blood sugar and is thus involved in the insular axis. GIP also inhibits gastric acid secretion.<br> Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while CCK-39, VIP and secretin do not.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 50-100 ul dist. water (final solution contains 0.09% sodium azide, 1% BSA in PBS buffer, pH 7.4)
The antibody is directed against the 56 kDa GFAP protein (Glial Fibrillary Acidic Protein, Glial Filament Protein), the main subunit of intermediate filaments of glial cells and astrocytes. The antibody can be used to discriminate glial tumors (astrocytomas, ependy-monas) from other tumors, as meningiomas, neuro-blastomas, chordomas, chondrosarcomas, lym-phomas and carcinomas. Positive control: Brain tissue.
Gastrin-secreting cells are numerous in the antrum and a few are found in the proximal duodenum. The antibody can be used for the diagnosis of gastrin-producing tumors which are mainly found in the pancreas and occasionally in the stomach and the duodenum.<br />Positive control: Antrum (antigen localization: cytoplasmic, extracellular)
GAP-43, also called neuromodulin, B-50, pp46 and F1, is a neuron-specific, membrane-associated phosphoprotein involved in axonal growth and found in neurons undergoing regeneration.<br>The antiserum was raised against a synthetic C-terminal peptide of GAP-43.<br> Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: rat duodenum.
The antibody reacts with the Lectin Domain of E-selectin, CD62-e, formerly designated Endothelial Leucocyte Adhesion Molecule-1 (ELAM-1). The antibody reacts with human endothelial cells activated with TNF, IL-1 or endotoxin. The antibody was found to react also with cells transfected with the ELAM-1 gene. The antibody inhibits the adhesion of granulocytes both neutrophilic and eosinophilic.
Enkephalins are small peptides derived from large precursers (pro-enkephalin A and B) containing multiple enkephalin copies. They are the most abundant opioid peptides in the body and are widely distributed in the brain and the peripheral nervous system and occur also in the adrenal medulla. Several types of neuroendocrine tumors, incl. pheochromocytomas, neuroblastomas and bronchial and gastrointestinal endocrine tumors, produce enkephalin. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while beta-endorphin does not. Cross-reacts with leu-enkephalin. Positive control:<strong> </strong>Frozen sections of cat or pig small intestine.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Kirchgessner, A. L. et al. Neurol.1989; 285, 3853
Desmin is a 53 kDa intermediate filament protein and exhibits a high degree of tissue specificity, its expression being predominantly confined to all types of muscle cells (cardiac, skeletal and smooth muscle). Regulation of desmin expression is stage and tissue-specific, since it is induced during terminal development and muscle cell differentiation. In skeletal en cardiac muscle cells desmin is localized in the Z-disk region and at the intercalated disk. The expression pattern of desmin in smooth muscle is much more heterogenous. Coexpression of desmin and vimentin has been observed in tumors derived from muscle tissue, i.e. rhabdomyosarcomas and leiomyosarcomas. Furthermore, during myocard dysfunction dramatic changes in the distribution of desmin have been observed. RCK106 reacts exclusively with Cytokeratin 18 in glandular epithelial cells of the digestive, respiRatory, and urogenital tracts, endocrine and exocrine cells and mesothelial cells, as well as adenocarcinomas originating from them.
PAG (phosphoprotein associated with GEMs), also known as Cbp (Csk-binding protein), is a ubiquitously expressed 46 kDa transmembrane adaptor protein present in membrane rafts (glycosphingolipid-enriched microdomains), which however migrates on SDS PAGE gels anomalously as an 80 kDa molecule. Following tyrosine phosphorylation by Src family kinases, PAG binds and thereby activates the protein tyrosine kinase Csk, the major negative regulator of the Src family kinases. Signaling via the B-cell receptor in B cells or high affinity IgE receptor (FcepsilonRI) in mast cells leads to PAG increased tyrosine phosphorylation and Csk binding, while T cell receptor signaling causes PAG dephosphorylation, loss of Csk binding and increased activation of the protein tyrosine kinase Lck.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
The antibody is reactive with collagen type IV of basement membranes, and shows a homogeneous staining pattern in all tissues. As neoplastic cells of invasive carcinomas often lack a continuous basement membrane, the antiserum is useful to distinguish between non-invasive and invasive lesions. Additionally, it can be used for the differentiation of bullous lesions in dermatopathology. In immunohistochemistry no cross-reactivity with other collagens at optimal dilutions. In immunoblotting, a slight cross-reactivity with collagen type V is observed. Positive control: Skin, kidney.
The CGRP-sequence was predicted from the corresponding mRNA. CGRP is present in the C-cells of the thyroid and in nerves, in both brain and periphery, particularly within the sensory system. CGRP is a potent vasodilator, probably involved in neurogenic inflammation. Medullary carcinomas of the thyroid contain large amounts of CGRP. Absorption with 10-100 ug CGRP per ml diluted antiserum abolishes the staining while calcitonin, substance P and Neurokinin A do not. The antiserum cross-reacts with amylin. Positive control: frozen sections of rat colon.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Suzuki, N. et al. Neuroscience 1989;30: 595604
References 2:
Grunditz, T. et al. Endocrinology 1986;119:2313-2324
The antibody reacts with a large variety of tumors with oncofetal characteristics; the antigen may also be detected in normal epithelia and tissue of non-neoplastic state. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: Bouin-fixed paraffin sections of human colon carcinoma.
The antibody reacts with the extra-cellular part of the TNF-RI and with the soluble receptor. TNF-RI is present on most cell types and is considered to play a prominent role in cell stimulation by TNF-alpha. Induction of cytotoxicity and other functions are mediated largely via TNF-RI.
Rabbit anti Human caspase-7 antibody recognizes an epitope within the C-terminal region (CT) of Caspase-7, a ~35 kDa cysteine protease, otherwise known as ICE-like Apoptotic Protease 3 (ICE-LAP3).
Caspase-7, a member of the ICE/Ced-3 subfamily, is an executioner caspase which undergoes proteolytic cleavage of its precursor to form active p12 and p20 subunits. Evidence that activation of Caspase-7 occurs during cell death induced by the cytokine death receptors Fas/APO-1 and the receptor of tumour necrosis factor (TNFR-1), coupled with the fact that granzyme-B activated Caspase-7 cleaves the nuclear enzyme poly (ADP-ribose) polymerase (PARP), suggests an important role for Caspase-7 in both cytokine-mediated and granzyme-B mediated apoptosis pathways.
Rabbit anti caspase-4 (N-terminal) antibody recognizes an epitope within the N-terminal region (NT) of Caspase-4, otherwise known as ICH-2. Caspase-4, a member of the Caspase-1 subfamily of cysteine proteases, exists as an inactive pro-enzyme which undergoes proteolytic cleavage of its p30 precursor form, into smaller p20 and p10 subunits.The cellular localization of Caspase-4 on the endoplasmic reticulum (ER) membrane, has resulted in this protein becoming a focus of studies in which dysfunction or stress to the ER membrane is implicated, such as Alzheimers disease and Ischemia and confirms the involvement of Caspase-4 as an instigator of cellular apoptosis.
Rabbit anti Human Caspase-1 antibody recognizes an epitope within the C-terminal region (CT) of human Caspase-1, otherwise known as IL-1Beta converting enzyme. Caspase-1 is an intracellular cysteine protease, identified as a mammalian homologue to C. elegans cell death gene (ced-3).Caspase-1 has been classified as an inflammatory, rather than apoptotic caspase, due to its essential role in the cleavage of the inactive precursors of the cytokines IL-1beta and IL-18, into their mature activated and secretable forms. Regulation of pro-inflammatory cytokines by Caspase-1 has made inhibitors of Caspase-1 a possible target for use as therapeutic drugs for the treatment of inflammatory diseases (Ghayur et al. 1997).Rabbit anti Human Caspase-1 antibody detects a cleaved subunit band of approximately 21 kDa in human heart cell lysates (predicted precursor MWT 45.2kDa).
Useful for studying sensory afferent neurons. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of rat spinal cord.
Lactoferrin is an approximately 80 kDa glycoprotein which was first isolated from milk and found in epithelia and most body fluids and secretions. Lactoferrin is secreted in plasma by neutrophils. Its plasma concentration represents a positive relation to the total pool of neutrophils and the rate of neutrophil turnover. In inflammation lactoferrin is released from secondary granules of neutrophilic leukocytes into the extracellular medium. Therefore the extracellular lactoferrin concentration can be used as an index for neutrophil activation. <br /> Lactoferrin is able to strongly bind to iron and considered to have antibacterial properties. Human lactoferrin binds to bacterial products through its highly positively charged N terminus and kills various bacteria most probably by inducing intracellular changes in these bacteria without affecting the membrane permeability. Lactoferrin also plays a role in signal transduction, immunomodulation and has antiadhesive, anticancer, antiviral activity.
Bombesin is an amphibian peptide and the mammalian counterpart is referred to as Gastrin Releasing Peptide (GRP). Bombesin/GRP is widely distributed in the brain, in peripheral nerves (particularly numerous in the gut) and in endocrine cells of some sub-mammalian species, e.g. in the oxyntic mucosa of birds. The peptide stimulates secretion from endocrine and exocrine cells and intestinal smooth muscle activity. Bombesin/GRP occurs frequently in the bronchial carcinoids.<br><br> Absorption with 10-100 ug bombesin and GRP per ml diluted antiserum abolishes the staining. Positive control: formalin-fixed paraffin and frozen sections of rat or chicken stomach.
This polyclonal antibody can be used for the study of endocrine differentiation in tumors of the respiratory tract.<br />Positive control: Gut (peripheral nerves), fetal lung
Amylin or islet amyloid polypeptide (IAPP) is produced in the pancreas beta cells and co-released with insulin. The amino acid sequence shows great homology with CGRP. Amylin has been shown to reverse insulin inhibition of hepatic gluconeogenesis and to inhibit muscle uptake of glucose. Positive control: Formalin-fixed paraffin and frozen sections of human or rat pancreas.
Specific for alpha-melanocyte stimulating hormone. Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining.<br>In man,<strong> </strong>alpha-MSH is found in corticotrophs of the anterior pituitary and may also occur in brain neurons.<br>Positive control: Bouin-fixed paraffin sections of pig pituitary.
The vesicular monoamine transporter is responsible for the vesicular uptake of monoamines, like dopamine, norepinephrine, epinephrine, serotonin and histamine. The antiserum recognizes monoaminergic neurons of the CNS, the ECL-cells of the stomach, as well as enteric nerve fibers. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. In Western blot experiments using a crude synaptic vesicle fraction of rat brain, the 70 kDa of anti-VMaT2 is recognized (suggested dilution 1:500). Positive control: frozen sections of rat small intestine.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Carballo-Carbajal, I. et al. Nat.Commun. 2019;10: 973
VIP is localized in nerve fibers of the central and peripheral nervous system, and is probably acting as a neurotransmitter. Smooth muscle relaxation, vasodilation and secretion from exocrine glands are some of the effects of VIP. The Verner-Morrison or Watery Diarrhea Hypokaliemia and Achlorhydria (WDHA) syndrome is a characteristic clinical syndrome associated with overproduction of VIP from endocrine tumors. These VIP-producing tumors are usually neuroblastomas of endocrine tumors in the pancreas.<br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while PHI does not.<br>Positive control: Stefanini-fixed frozen sections of rat intestine.
Substance P occurs in nerve fibers of the central and peripheral nervous system and in endocrine cells of the gut. It stimulates smooth muscle contraction, gives rise to vasodilation and is involved in sensory functions. Substance P-containing tumors arising in the ileum are often associated with the carcinoid syndrome, characterized by flushing of the skin, diarrhea, broncho-constriction and sudden drops in blood pressure. Substance P is commonly found in the midgut carcinoids and some of the symptoms may be related to this peptide. Absorption with 10-100 ug SP and NKA per ml diluted antiserum abolishes the staining while GRP and NKB do not. Positive control:<strong> </strong>frozen sections of rat colon.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Kressel, M.et al. J. Comp. Neurol. 1999;412: 161172
The intestinal peptide YY is related to the PP-family of peptides and occurs in the glicentin cells in the gut. They are numerous in the rectum, colon, and ileum and few in the duodenum and jejunum. PYY has hormone-like action, inhibits gut motility and pancreatic exocrine secretion and cause vasoconstriction. <br>PYY may occur in endorine tumors of the pancreas and of the rectum. Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining.<br>Positive control: frozen sections of rat intestine.
Phenylethanolamine-N-methyltransferase (PNMT) is an enzyme converting noradrenaline to adrenaline. <br>The enzyme is present in adrenomedullary cells and in the brain neurons. <br> Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining.<br>Positive control: DEPC-fixed paraffin sections of rat adrenal gland.
Ornithine decarboxylase is the rate-limiting enzyme in polyamine biosynthesis converting ornithine into putrescine. In normal tissue ornithine decarboxylase activity is low but increases in proliferating tissue. Positive control: Stefanini-fixed frozen sections of renal cortex from testosterone-treated mice.
Nitric oxide synthase is an enzyme catalizing the synthesis of NO from L-arginine. The antiserum was raised against a synthetic peptide of rat cerebellar NOS, that shows no homology with other related proteins. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: frozen sections of rat colon.
Insulin is produced by the B-cells of the pancreatic islets and by insulin-producing islet cell tumors. <br>Absorption with 10-100 ug proinsulin per ml diluted antiserum inactivates the antiserum, while C-peptide and insulin only partly reduce staining.<br>Positive control: formalin-fixed paraffin sections of human pancreas.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Kohnert, K. D. et al. Regul. Pept.1999; 82: 719
References 2:
Ahrén, B. et al. Pancreas 1999; 18: 7583
References 3:
Al-Amily, I. et al. Pflugers.Arch.2019; 471:633-645
Glucagon is a common constituent of endocrine pancreatic tumors and of rectal carcinoids. The antibody is specific to pancreatic glucagon. Absorption with 10-100 ug glucagon per ml diluted antiserum abolishes the staining. Positive control: Bouin-fixed paraffin sections of cat pancreas.
Gastrin-secreting cells are numerous in the antrum and a few are found in the proximal duodenum. The antibody can be used for the diagnosis of gastrin-producing tumors which are mainly found in the pancreas and occasionally in the stomach and the duodenum. <br>Absorption with 10-100 ug gastrin 1-34 and CCK 8 per ml antiserum abolishes the staining. Positive control: formalin-fixed paraffin sections of rat antrum.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Portela-Gomes, G. M.et al. Histochem. Cell Biol. 1999;111: 4954
References 2:
Portela-Gomes, G. M.et al. J. Histochem. Cytochem.1997;45: 81522
References 3:
Mulder, H. et al. Gastroenterology 1994;107: 7129
The CGRP-sequence was predicted from the corresponding mRNA. CGRP is present in the C-cells of the thyroid and in nerves, in both brain and periphery, particularly within the sensory system. CGRP is a potent vasodilator, probably involved in neurogenic inflammation. Medullary carcinomas of the thyroid contain large amounts of CGRP. Absorption with 10-100 ug CGRP per ml diluted antiserum abolishes the staining while calcitonin does not. Does not cross-react with amylin (IAPP).<br>Positive control: frozen sections of rat colon.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Schulze, E. et al. Acta Histochem.1997; 99: 301309
References 2:
Bechakra, M. et al. Mol.Pain.2018; 14, 1744806918797040
The CGRP-sequence was predicted from the corresponding mRNA. CGRP is present in the C-cells of the thyroid and in nerves, in both brain and periphery, particularly within the sensory system. CGRP is a potent vasodilator, probably involved in neurogenic inflammation. Medullary carcinomas of the thyroid contain large amounts of CGRP. Absorption with 10-100 ug CGRP per ml diluted antiserum abolishes the staining while calcitonin, does not. Cross-reacts with amylin (IAPP).<br>Positive control: Stefanini-fixed frozen sections of rat colon.
Adrenomedullin is a potent vasorelaxing and hypotensive peptide, originally isolated from human pheochromocytoma. Adrenomedullin shares some homology with CGRP (calcitonin gene-related peptide). The antiserum was raised using synthetic peptides as immunogens. The antibody does not cross-react with CGRP. Positive control: Stefanini-fixed frozen sections of rat fundus.
Human lactoferrin (LF) is an 80 kDa glycoprotein which was first isolated from human milk. It plays an important part in the immune system and helps to fight infections. Lactoferrin promotes the health of the gastro-intestinal system by improving the intestinal microbial balance. In addition, LF can be found in epithelia and most body fluids and secretions. Lactoferrin is secreted in plasma by neutrophils. Its plasma concentration also represents a positive relation to the total pool of neutrophils and the rate of neutrophil turnover. In inflammation lactoferrin is released from secondary granules of neutrophilic leukocytes into the extracellular medium. Therefore the extracellular lactoferrin concentration can be used as an index for neutrophil activation. Lactoferrin strongly binds to iron and this iron binding property is considered to be an important antimicrobial. Human lactoferrin binds to bacterial products through its highly positively charged N-terminus, it kills various bacteria, most probably by inducing intracellular changes in these bacteria without affecting the membrane permeability. Cleavage by pepsin of lactoferrin leads to the release of lactoferricin H. This 47 amino acid peptide has more antimicrobial activity than its precursor and it can inhibit the classical but not the alternative complement pathway. Lactoferrin also plays a role in signal transduction, immunomodulation and has antiadhesive, anticancer, antiviral activity.
PAX-8 is a transcription factor expressed during embryonic development of Müllerian organs, kidney, and thyroid, with continued expression in some epithelial cell types of these mature tissues.1 It can be useful for marking several types of carcinoma including ovarian serous carcinoma, clear cell renal cell carcinoma, and papillary thyroid carcinoma.1-5 Additionally, PAX-8 is not found in the epithelial cells of the breast, lung, mesothelium, stomach, colon, pancreas and other sites.1-4
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Ozcan A, et al. Mod Pathol. 2011; 24:751-64
References 2:
Laury AR, et al. Am J Surg Pathol. 2011; 35:816-26
References 3:
Nonaka, D et al. Am J Surg Pathol. 2008; 32:1566-71
Napsin is a pepsin-like aspartic proteinase in the A1 clan of the AA clade of proteinases. There are two closely related napsins, napsin A (NAPSA) and napsin B (NAPSB). Napsin A is involved in processing propeptide pulmonary surfactant protein B (proSP-B) in the lung.4 In normal tissue, Napsin A is expressed in type II pneumocytes of the lung and proximal tubules of the kidney. Napsin A is a useful marker for lung adenocarcinoma
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Brasch F, et al. J Biol Chem. 2003; 278: 49006-14
References 2:
Jagirdar J et al. Arch Pathol Lab Med. 2008; 132:384-96
References 3:
Bishop JA, et al. Hum Pathol. 2010; 41:20-5
References 4:
Ye J, et al. Appl Immunohistochem Mol Morphol. 2011; 19:313-17
References 5:
Mukhopadhyay S, et al. Am J Surg Pathol. 2011; 35:15-25
Herpes simplex virus is quite ubiquitous and is quite variable in its presentation in human disease. Type I usually infects the non-genital mucosal surfaces. It may affect the skin or internal organs (typically brain, lung, liver, adrenal gland, or GI tract) of immunocompromised individuals. This polyclonal antibody reacts with Type I Herpes viruses. There may be cross-reactivity with varicella zoster virus at higher concentrations. Cross-reactivity with CMV or Epstein-Barr virus is not seen with this antibody.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Granzymes are serine proteases which are stored in specialized lytic granules of cytotoxic T lymphocytes and in natural killer cells. Anti-Granzyme B has been useful in diagnosing Natural killer/T cell lymphoma, as well as anaplastic large cell lymphoma. High percentages of cytotoxic T cells have been shown to be an unfavorable prognostic indicator in Hodgkins disease.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Kummer JA, et al. Clin Exp Immunol. 1995; 100:164-72
Glucose transporter type I (GLUT1), a prototype member of GLUT super family, reacts with a 55 kD protein, is a membrane-associated erythrocyte glucose transport protein. It is a major glucose transporter in the mammalian blood-brain barrier, and also mediates glucose transport in endothelial cells of the vasculature, adipose tissue and cardiac muscle. GLUT1 is detectable in many human tissues including those of colon, lung, stomach, esophagus, and breast. GLUT1 is overexpressed in malignant cells and in a variety of tumors that include the breast, pancreas, cervix, endometrium, lung, mesothelium, colon, bladder, thyroid, bone, soft tissues, and oral cavity. Immuohistochemical detection of GLUT1 can discriminate between reactive mesothelium and malignant mesothelioma. Anti-GLUT1 with anti-Claudin1, and anti-EMA are perineurial markers in diagnosis of perineuriomas. Anti-GLUT1 is also useful in distinguishing benign endometrial hyperplasia from atypical endometrial hyperplasia and adenocarcinoma. GLUT1 expression has been associated with increased malignant potential, invasiveness, and a poor prognosis in general. Expression of GLUT1 is a late event in colorectal cancer and expression in a high proportion of cancer cells is associated with a high incidence of lymph node metastases.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Kato Y, et al. Mod Pathol. 2006; 20:215-20
References 2:
Afify A, et al. Acta Cytol. 2005; 49:621-6
References 3:
Parente P, et al. J Exp Clin Cancer Res. 2008; 27:34
Claudins are a family of over twenty proteins which are components of tight junctions. Tight junctions are specialized regions of cell-to-cell contact made up of a network of strands to act as a molecular gasket for preventing the leakage of ions, water, etc., between cells.1 Claudin 1 has been shown to distinguish epithelial neoplasms from lymphomas, making it a useful marker for nearly all carcinomas.2
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Folpe AL, et al. Am J Surg Pathol. 2002; 26:1620-6
Thyroid-stimulating hormone (also known as TSH or thyrotropin) is a peptide hormone synthesized and secreted by thyrotrops in the anterior pituitary gland which regulate the endocrine function of the thyroid gland. TSH is a glycoprotein and consists of two subunits which are non-covalently bound to one another. Anti-TSH reacts with TSH-producing cells (thyrotrophs), and is a useful marker in classification of pituitary tumors.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Batanero E, et al. Brain Behav Immun. 1992; 6:249-64
References 2:
Sanno N, et al. J Clin Endocrinol Metab. 1995; 80:2518-22
References 3:
La Rosa S, et al. Virchows Arch. 2000; 437:264-9
References 4:
Kuzuya N, et al. J Clin Endocrinol Metab. 1990; 71:1103-11
Thyroid-stimulating hormone (also known as TSH or thyrotropin) is a peptide hormone synthesized and secreted by thyrotrops in the anterior pituitary gland which regulate the endocrine function of the thyroid gland. TSH is a glycoprotein and consists of two subunits which are non-covalently bound to one another. Anti-TSH reacts with TSH-producing cells (thyrotrophs), and is a useful marker in classification of pituitary tumors.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Batanero E, et al. Brain Behav Immun. 1992; 6:249-64
References 2:
Sanno N, et al. J Clin Endocrinol Metab. 1995; 80:2518-22
References 3:
La Rosa S, et al. Virchows Arch. 2000; 437:264-9
References 4:
Kuzuya N, et al. J Clin Endocrinol Metab. 1990; 71:1103-11
Toxoplasma gondii is a spindle-to-oval-shaped protozoan which presents as an infection in humans of various sorts. The cyst (30 um) and trophozoite (7 um) stages can be identified in humans is such cases. This intracellular parasite is transmitted via raw/undercooked meat, contaminated soil, or by direct contact with an infected host. Infection in humans is usually associated with a variable degree of immunosuppression such as in pregnancy or immunosuppression due to various drugs.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Toxoplasma gondii is a spindle-to-oval-shaped protozoan which presents as an infection in humans of various sorts. The cyst (30 um) and trophozoite (7 um) stages can be identified in humans is such cases. This intracellular parasite is transmitted via raw/undercooked meat, contaminated soil, or by direct contact with an infected host. Infection in humans is usually associated with a variable degree of immunosuppression such as in pregnancy or immunosuppression due to various drugs.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Anti-TdT antibody labels normal cortical thymocytes and primitive lymphocytes. Anti-TdT antibody detects an enzyme found in the nucleus of normal hematopoietic cells, normal cortical thymocytes and in the cytoplasm of megakaryocytes of the bone marrow. TdT expression is seen in over 90% of acute lymphoblastic lymphoma/ leukemia cases with the exception of pre-B-Cell ALL. TdT expression is not seen in normal mature T-or B-lymphocytes. Anti-TdT is positive for approximately one third of all cases of chronic myeloid leukemia, making it a good indicator of better response to chemotherapy.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Motea EA, et al. Biochimica et Biophysica Acta. 2010; 1804:1151-66
References 2:
Stauchen JA, et al. Int J Surg Pathol. 2003; 11:21-4
References 3:
Suzumiya J, et al. J Pathol. 1997; 182:86-91
References 4:
Arber DA, et al. Am J Clin Pathol. 1996; 106:462-8
Anti-TdT antibody labels normal cortical thymocytes and primitive lymphocytes. Anti-TdT antibody detects an enzyme found in the nucleus of normal hematopoietic cells, normal cortical thymocytes and in the cytoplasm of megakaryocytes of the bone marrow. TdT expression is seen in over 90% of acute lymphoblastic lymphoma/ leukemia cases with the exception of pre-B-Cell ALL. TdT expression is not seen in normal mature T-or B-lymphocytes. Anti-TdT is positive for approximately one third of all cases of chronic myeloid leukemia, making it a good indicator of better response to chemotherapy.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Motea EA, et al. Biochimica et Biophysica Acta. 2010; 1804:1151-66
References 2:
Stauchen JA, et al. Int J Surg Pathol. 2003; 11:21-4
References 3:
Suzumiya J, et al. J Pathol. 1997; 182:86-91
References 4:
Arber DA, et al. Am J Clin Pathol. 1996; 106:462-8
Anti-Synaptophysin reacts with neuroendocrine cells of human adrenal medulla, carotid body, skin, pituitary, thyroid, lung, pancreas and gastrointestinal mucosa. Positive staining is seen in neurons of the brain, spinal cord, retina, and Paneths cells in the gastrointestinal tract and gastric parietal cells. This antibody identifies normal neuroendocrine cells and neuroendocrine neoplasms. Diffuse, finely granular cytoplasmic staining is observed, which probably correlates with the distribution of the antigen within neurosecretory vesicles. The expression of synaptophysin is independent of the presence of NSE or other neuroendocrine markers. Anti-Synaptophysin is an independent broadrange marker of neural and neuroendocrine differentiation.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Navone F, et al. J Cell Biol. 1986; 103:2511-27
References 2:
Wiedenmann B, et al. Cell. 1985; 41:1017-28
References 3:
Kayser K, et al. Pathol Res Pract. 1988; 183:412-7
Anti-Synaptophysin reacts with neuroendocrine cells of human adrenal medulla, carotid body, skin, pituitary, thyroid, lung, pancreas and gastrointestinal mucosa. Positive staining is seen in neurons of the brain, spinal cord, retina, and Paneths cells in the gastrointestinal tract and gastric parietal cells. This antibody identifies normal neuroendocrine cells and neuroendocrine neoplasms. Diffuse, finely granular cytoplasmic staining is observed, which probably correlates with the distribution of the antigen within neurosecretory vesicles. The expression of synaptophysin is independent of the presence of NSE or other neuroendocrine markers. Anti-Synaptophysin is an independent broadrange marker of neural and neuroendocrine differentiation.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Navone F, et al. J Cell Biol. 1986; 103:2511-27
References 2:
Wiedenmann B, et al. Cell. 1985; 41:1017-28
References 3:
Kayser K, et al. Pathol Res Pract. 1988; 183:412-7
Prolactin (PRL) is a single-chain polypeptide of 226 amino acids and plays a role in multiple processes including cell growth, reproduction, and immune function. Anti-Prolactin reacts with prolactin-producing cells and is a useful marker in classification of pituitary tumors and the study of pituitary disease.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Asa SL, et al. Arch Pathol Lab Med. 1982; 106:360-3
References 2:
Duello TM, et al. Am J Anat. 1980; 158:463-9
References 3:
Minniti G, et al. Surg Neurol. 2002; 57:99-103
References 4:
Popadic A, et al. Surg Neurol. 1999; 51:47-54
References 5:
Nevalainen MT, et al. J Clin Invest. 1997; 99:618-27
Prolactin (PRL) is a single-chain polypeptide of 226 amino acids and plays a role in multiple processes including cell growth, reproduction, and immune function. Anti-Prolactin reacts with prolactin-producing cells and is a useful marker in classification of pituitary tumors and the study of pituitary disease.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Asa SL, et al. Arch Pathol Lab Med. 1982; 106:360-3
References 2:
Duello TM, et al. Am J Anat. 1980; 158:463-9
References 3:
Minniti G, et al. Surg Neurol. 2002; 57:99-103
References 4:
Popadic A, et al. Surg Neurol. 1999; 51:47-54
References 5:
Nevalainen MT, et al. J Clin Invest. 1997; 99:618-27
Phosphohistone H3 (PHH3) is a core histone protein, which together with other histones, forms the major protein constituents of the chromatin in eukaryotic cells. In mammalian cells, phosphohistone H3 is negligible during interphase but reaches a maximum for chromatin condensation during mitosis. Immunohistochemical studies showed anti-PHH3 specifically detected the core protein histone H3 only when phosphorylated at serine 10 or serine 28. Studies have also revealed no phosphorylation on the histone H3 during apoptosis. PHH3 can serve as a mitotic marker to separate mitotic figures from apoptotic bodies and karyorrhectic debris, which may be a very useful tool in diagnosis of tumor grades, especially in CNS, skin, gyn., soft tissue, and GIST.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Gurley LR, et al. Eur J Biochem 1978; 84:1-15
References 2:
Hendzel MJ, et al. J Biol Chem 1998; 273:24470-8
References 3:
Colman H, et al. Am J Surg Pathol. 2006; 30:657-64
References 4:
Nasr MR, et al. Am J Dermatopathol. 2008; 30:117-22
Phosphohistone H3 (PHH3) is a core histone protein, which together with other histones, forms the major protein constituents of the chromatin in eukaryotic cells. In mammalian cells, phosphohistone H3 is negligible during interphase but reaches a maximum for chromatin condensation during mitosis. Immunohistochemical studies showed anti-PHH3 specifically detected the core protein histone H3 only when phosphorylated at serine 10 or serine 28. Studies have also revealed no phosphorylation on the histone H3 during apoptosis. PHH3 can serve as a mitotic marker to separate mitotic figures from apoptotic bodies and karyorrhectic debris, which may be a very useful tool in diagnosis of tumor grades, especially in CNS, skin, gyn., soft tissue, and GIST.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Gurley LR, et al. Eur J Biochem 1978; 84:1-15
References 2:
Hendzel MJ, et al. J Biol Chem 1998; 273:24470-8
References 3:
Colman H, et al. Am J Surg Pathol. 2006; 30:657-64
References 4:
Nasr MR, et al. Am J Dermatopathol. 2008; 30:117-22
Protein gene product 9.5 (PGP 9.5), also known as ubiquitin carboxyl-terminal hydrolase-1 (UCH-L1), is a 27-kDa protein originally isolated from whole brain extracts (1). Although PGP9.5 expression in normal tissues was originally felt to be strictly confined to neurons and neuroendocrine cells (2), it has been subsequently documented in distal renal tubular epithelium, spermatogonia, Leydig cells, oocytes, melanocytes, prostatic secretory epithelium, ejaculatory duct cells, epididymis, mammary epithelial cells, Merkel cells, and dermal fibroblasts. LK Campbell et al demonstrated immunostaining of a plethora of different mesenchymal neoplasms with this antibody.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Campbell LK, et al. Mod Pathol. 2003; 16:963-9
References 2:
Bassotti G, et al. J Clin Pathol. 2005; 58:973-7
References 3:
Mahalingam M, et al. J Cutan Pathol. 2001; 28:282-6.
References 4:
Mahalingam M, et al. J Cutan Pathol. 2006; 33:51-6.
Protein gene product 9.5 (PGP 9.5), also known as ubiquitin carboxyl-terminal hydrolase-1 (UCH-L1), is a 27-kDa protein originally isolated from whole brain extracts (1). Although PGP9.5 expression in normal tissues was originally felt to be strictly confined to neurons and neuroendocrine cells (2), it has been subsequently documented in distal renal tubular epithelium, spermatogonia, Leydig cells, oocytes, melanocytes, prostatic secretory epithelium, ejaculatory duct cells, epididymis, mammary epithelial cells, Merkel cells, and dermal fibroblasts. LK Campbell et al demonstrated immunostaining of a plethora of different mesenchymal neoplasms with this antibody.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Campbell LK, et al. Mod Pathol. 2003; 16:963-9
References 2:
Bassotti G, et al. J Clin Pathol. 2005; 58:973-7
References 3:
Mahalingam M, et al. J Cutan Pathol. 2001; 28:282-6.
References 4:
Mahalingam M, et al. J Cutan Pathol. 2006; 33:51-6.
Napsin is a pepsin-like aspartic proteinase in the A1 clan of the AA clade of proteinases. There are two closely related napsins, napsin A (NAPSA) and napsin B (NAPSB). Napsin A is involved in processing propeptide pulmonary surfactant protein B (proSP-B) in the lung.4 In normal tissue, Napsin A is expressed in type II pneumocytes of the lung and proximal tubules of the kidney. Napsin A is a useful marker for lung adenocarcinoma
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Brasch F, et al. J Biol Chem. 2003; 278: 49006-14
References 2:
Jagirdar J et al. Arch Pathol Lab Med. 2008; 132:384-96
References 3:
Bishop JA, et al. Hum Pathol. 2010; 41:20-5
References 4:
Ye J, et al. Appl Immunohistochem Mol Morphol. 2011; 19:313-17
References 5:
Mukhopadhyay S, et al. Am J Surg Pathol. 2011; 35:15-25
Immunostaining with anti-myoglobin provides a specific, sensitive, and practical procedure for the identification of tumors of muscle origin. Since myoglobin is found exclusively in skeletal and cardiac muscle and is not present in any other cells of the human body, it may be used to distinguish rhabdomyosarcoma from other soft tissue tumors.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Mukai K, et al. Am J Surg Pathol. 1979; 3:373-6
References 2:
Corson JM, et al.Am J Pathol. 1981; 103:384-9
References 3:
Brooks JJ. Cancer. 1982; 50:1757-63
References 4:
Furlong MA, et al. Ann Diagn Pathol. 2001; 5:199-206
Immunostaining with anti-myoglobin provides a specific, sensitive, and practical procedure for the identification of tumors of muscle origin. Since myoglobin is found exclusively in skeletal and cardiac muscle and is not present in any other cells of the human body, it may be used to distinguish rhabdomyosarcoma from other soft tissue tumors.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Mukai K, et al. Am J Surg Pathol. 1979; 3:373-6
References 2:
Corson JM, et al.Am J Pathol. 1981; 103:384-9
References 3:
Brooks JJ. Cancer. 1982; 50:1757-63
References 4:
Furlong MA, et al. Ann Diagn Pathol. 2001; 5:199-206
Anti-Myeloperoxidase detects granulocytes and monocytes in blood and precursors of granulocytes in the bone marrow. This antibody can detect myeloid cell populations of the bone marrow as well as in other sites.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Pinkus GS, et al. Mod Pathol. 1991; 4:733-41
References 2:
Markoc F, et al. Tumori. 2010; 96:149-53
References 3:
Alexiev BA, et al. Diagn Pathol. 2007; 31;2:42
References 4:
Saravanan L, et al. Int J Lab Hematol. 2010; 32:132-6
References 5:
Manaloor EJ, et al. Am J Clin Pathol. 2000; 113:814-22
Anti-Myeloperoxidase detects granulocytes and monocytes in blood and precursors of granulocytes in the bone marrow. This antibody can detect myeloid cell populations of the bone marrow as well as in other sites.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Pinkus GS, et al. Mod Pathol. 1991; 4:733-41
References 2:
Markoc F, et al. Tumori. 2010; 96:149-53
References 3:
Alexiev BA, et al. Diagn Pathol. 2007; 31;2:42
References 4:
Saravanan L, et al. Int J Lab Hematol. 2010; 32:132-6
References 5:
Manaloor EJ, et al. Am J Clin Pathol. 2000; 113:814-22
Anti-Lysozyme stains myeloid cells, histiocytes, granulocytes, macrophages, and monocytes in human tonsil, colon and skin. It is an important marker that may demonstrate the myeloid or monocytic nature of acute leukemia. The restrictive nature of anti-lysozyme antibody staining suggests that lysozyme may be synthesized predominantly in reactive histiocytes rather than in resting, unstimulated phagocytes. Anti-lysozyme may aid in the identification of histiocytic neoplasias, large lymphocytes and classifying lymphoproliferative disorders.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Rehg J, et al. Toxicol Pathol. 2012; 40: 345-74
References 2:
Seifert RP, et al. Annals Diag Pathol. 2014; 18:253-60.
Anti-Lysozyme stains myeloid cells, histiocytes, granulocytes, macrophages, and monocytes in human tonsil, colon and skin. It is an important marker that may demonstrate the myeloid or monocytic nature of acute leukemia. The restrictive nature of anti-lysozyme antibody staining suggests that lysozyme may be synthesized predominantly in reactive histiocytes rather than in resting, unstimulated phagocytes. Anti-lysozyme may aid in the identification of histiocytic neoplasias, large lymphocytes and classifying lymphoproliferative disorders.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Rehg J, et al. Toxicol Pathol. 2012; 40: 345-74
References 2:
Seifert RP, et al. Annals Diag Pathol. 2014; 18:253-60.
Luteinizing hormone (LH) is a heterodimeric glycoprotein produced by gonadotropic cells of the pituitary gland. Anti-LH is a useful marker to aid in the classification of pituitary tumors and the study of pituitary disease.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Sano T, et al. Virchows Arch A Pathol Anat Histopathol. 1990; 417:361-7
References 2:
Felix I, et al. Hum Pathol. 1991; 22:719-21
References 3:
Saccomanno K, et al. J Clin Endocrinol Metab. 1994; 78:1103-7
Luteinizing hormone (LH) is a heterodimeric glycoprotein produced by gonadotropic cells of the pituitary gland. Anti-LH is a useful marker to aid in the classification of pituitary tumors and the study of pituitary disease.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Sano T, et al. Virchows Arch A Pathol Anat Histopathol. 1990; 417:361-7
References 2:
Felix I, et al. Hum Pathol. 1991; 22:719-21
References 3:
Saccomanno K, et al. J Clin Endocrinol Metab. 1994; 78:1103-7
Anti-IgM reacts with immunoglobulin mu (IgM) chains. IgM is one of the predominant surface immunoglobulins on B-lymphocytes. This antibody is useful when differentiating and sub-classifying hematolymphoid neoplasms.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Arnold A, et al. New Eng J Med. 1983; 309:1593-1599
References 2:
Leong AS, et al. Geenwich Medical Media Ltd. 1999; 217-219
References 3:
Taylor CR. Arch Path Lab Med. 1978; 102:113-121
References 4:
Kojima M, et al. APMIS. 2002; 110:875-80
References 5:
Pambuccian SE, et al. Am J Surg Pathol. 1997; 21:179-86
Anti-IgM reacts with immunoglobulin mu (IgM) chains. IgM is one of the predominant surface immunoglobulins on B-lymphocytes. This antibody is useful when differentiating and sub-classifying hematolymphoid neoplasms.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Arnold A, et al. New Eng J Med. 1983; 309:1593-1599
References 2:
Leong AS, et al. Geenwich Medical Media Ltd. 1999; 217-219
References 3:
Taylor CR. Arch Path Lab Med. 1978; 102:113-121
References 4:
Kojima M, et al. APMIS. 2002; 110:875-80
References 5:
Pambuccian SE, et al. Am J Surg Pathol. 1997; 21:179-86
Immunoglobulin A (IgA) plays a critical role in mucosal immunity. It is present in the mucosal secretions such as tears, saliva, colostrum, intestinal juice, vaginal fluid, and secretions from the prostate and respiratory epithelium, and represents a key first line of defense against invasion by inhaled and ingested pathogens at the vulnerable mucosal surfaces. It is also found in small amounts in blood. Because it is resistant to degradation by enzymes, secretory IgA can survive in harsh environments such as the digestive and respiratory tracts, to provide protection against microbes that multiply in body secretions. It is useful when identifying multiple myeloma.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Ansari NA, et al. Asian Pac J Cancer Prev. 2007; 8:593-6
Immunoglobulin A (IgA) plays a critical role in mucosal immunity. It is present in the mucosal secretions such as tears, saliva, colostrum, intestinal juice, vaginal fluid, and secretions from the prostate and respiratory epithelium, and represents a key first line of defense against invasion by inhaled and ingested pathogens at the vulnerable mucosal surfaces. It is also found in small amounts in blood. Because it is resistant to degradation by enzymes, secretory IgA can survive in harsh environments such as the digestive and respiratory tracts, to provide protection against microbes that multiply in body secretions. It is useful when identifying multiple myeloma.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Ansari NA, et al. Asian Pac J Cancer Prev. 2007; 8:593-6
Human placental lactogen (hPL), also previously known as human chorionic somatomammotropin, is a 22-kD protein with partial homology to growth hormone. hPL is first detectable in the maternal serum in the fifth week of gestation and is involved in maintaining nutritient supply to the fetus. Anti-hPL reactivity is seen in syncytiotrophoblastic cells of placenta and choriocarcinoma
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Shih IM, et al. Am J Surg Pathol. 2004; 28:1177-83
References 2:
Ulbright TM, et al. Am J Surg Pathol. 1997; 21:282-8
Human placental lactogen (hPL), also previously known as human chorionic somatomammotropin, is a 22 kD protein with partial homology to growth hormone. hPL is first detectable in the maternal serum in the fifth week of gestation and reaches a plateau by the thirty-fourth week. hPL has been demonstrated by immunochemistry in the syncytiotrophoblastic cells of choriocarcinoma. A rare variant of trophoblastic tumor has been reported in the testis with resemblance to uterine placental site trophoblastic tumor. It consisted purely of intermediate trophoblasts, which was diffusely positive for hPL and focally for ?-hCG.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Shih IM, et al. Am J Surg Pathol. 2004; 28:1177-83
References 2:
Ulbright TM, et al. Am J Surg Pathol. 1997; 21:282-8
Herpes simplex virus is quite ubiquitous and is quite variable in its presentation in human disease. Type I usually infects the non-genital mucosal surfaces. It may affect the skin or internal organs (typically brain, lung, liver, adrenal gland, or GI tract) of immunocompromised individuals. This polyclonal antibody reacts with Type I Herpes viruses. There may be cross-reactivity with varicella zoster virus at higher concentrations. Cross-reactivity with CMV or Epstein-Barr virus is not seen with this antibody.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Helicobacter pylori is strongly associated with inflammation of the stomach and is also implicated in the development of gastric malignancy, peptic ulcers, and gastric lymphomas in humans. Helicobacter pylori can exist in a number of locations: in the mucus, attached to epithelial cells, or inside of vacuoles in epithelial cells, where it produces adhesions that bind to membrane-associated lipids and carbohydrates in or on epithelial cells. The most reliable method for detecting H. pylori infection is a biopsy during endoscopy histologic examination and detection by immunohistochemistry. Immunohistochemical staining of H. pylori on the surface of gastric mucosa is a valuable tool for identification of H. pylori infections.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Helicobacter pylori is strongly associated with inflammation of the stomach and is also implicated in the development of gastric malignancy, peptic ulcers, and gastric lymphomas in humans. Helicobacter pylori can exist in a number of locations: in the mucus, attached to epithelial cells, or inside of vacuoles in epithelial cells, where it produces adhesions that bind to membrane-associated lipids and carbohydrates in or on epithelial cells. The most reliable method for detecting H. pylori infection is a biopsy during endoscopy histologic examination and detection by immunohistochemistry. Immunohistochemical staining of H. pylori on the surface of gastric mucosa is a valuable tool for identification of H. pylori infections.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
hCG is a protein secreted in large quantities by normal trophoblasts; the antibody detects cells and tumors of trophoblastic origin such as Choriocarcinoma. Large Cell Carcinoma and Adenocarcinoma of Lung demonstrate hCG positivity in 90% and 60% of cases respectively. 20% of Squamous Cell Lung Carcinomas are positive for hCG. hCG expression by nontrophoblastic tumors may indicate aggressive behavior since it has been observed that hCG may play a role in the host response to a given tumor.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
hCG is a protein secreted in large quantities by normal trophoblasts; the antibody detects cells and tumors of trophoblastic origin such as Choriocarcinoma. Large Cell Carcinoma and Adenocarcinoma of Lung demonstrate hCG positivity in 90% and 60% of cases respectively. 20% of Squamous Cell Lung Carcinomas are positive for hCG. hCG expression by nontrophoblastic tumors may indicate aggressive behavior since it has been observed that hCG may play a role in the host response to a given tumor.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Granzymes are serine proteases which are stored in specialized lytic granules of cytotoxic T lymphocytes and in natural killer cells. Anti-Granzyme B has been useful in diagnosing Natural killer/T cell lymphoma, as well as anaplastic large cell lymphoma. High percentages of cytotoxic T cells have been shown to be an unfavorable prognostic indicator in Hodgkins disease.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Kummer JA, et al. Clin Exp Immunol. 1995; 100:164-72
Glucose transporter type I (GLUT1), a prototype member of GLUT super family, reacts with a 55 kD protein, is a membrane-associated erythrocyte glucose transport protein. It is a major glucose transporter in the mammalian blood-brain barrier, and also mediates glucose transport in endothelial cells of the vasculature, adipose tissue and cardiac muscle. GLUT1 is detectable in many human tissues including those of colon, lung, stomach, esophagus, and breast. GLUT1 is overexpressed in malignant cells and in a variety of tumors that include the breast, pancreas, cervix, endometrium, lung, mesothelium, colon, bladder, thyroid, bone, soft tissues, and oral cavity. Immuohistochemical detection of GLUT1 can discriminate between reactive mesothelium and malignant mesothelioma. Anti-GLUT1 with anti-Claudin1, and anti-EMA are perineurial markers in diagnosis of perineuriomas. Anti-GLUT1 is also useful in distinguishing benign endometrial hyperplasia from atypical endometrial hyperplasia and adenocarcinoma. GLUT1 expression has been associated with increased malignant potential, invasiveness, and a poor prognosis in general. Expression of GLUT1 is a late event in colorectal cancer and expression in a high proportion of cancer cells is associated with a high incidence of lymph node metastases.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Kato Y, et al. Mod Pathol. 2006; 20:215-20
References 2:
Afify A, et al. Acta Cytol. 2005; 49:621-6
References 3:
Parente P, et al. J Exp Clin Cancer Res. 2008; 27:34
Anti-Glucagon antibody detects glucagon-secreting cells and tumors such as glucagonomas. Studies show that approximately 80% of glucagonomas are malignant and these patients have a syndrome often initially recognized by dermatologists. Symptoms include necrolytic migratory erythema as well as diabetes, anemia, stomatitis, weight loss, frequent venous thromboses, and in some instances, diarrhea and psychiatric disturbances. The diagnosis may be readily confirmed by the demonstration of elevated plasma glucagon concentration.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Quesada I, et al. J Endocrinol. 2008; 199:5-19
References 2:
Gurlo T, et al. J Histotechnol. 2016; 39:8-16
References 3:
Wewer Albrechtsen NJ, et al. Biomark Med. 2016; 10:1141-51
Anti-Glucagon antibody detects glucagon-secreting cells and tumors such as glucagonomas. Studies show that approximately 80% of glucagonomas are malignant and these patients have a syndrome often initially recognized by dermatologists. Symptoms include necrolytic migratory erythema as well as diabetes, anemia, stomatitis, weight loss, frequent venous thromboses, and in some instances, diarrhea and psychiatric disturbances. The diagnosis may be readily confirmed by the demonstration of elevated plasma glucagon concentration.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Quesada I, et al. J Endocrinol. 2008; 199:5-19
References 2:
Gurlo T, et al. J Histotechnol. 2016; 39:8-16
References 3:
Wewer Albrechtsen NJ, et al. Biomark Med. 2016; 10:1141-51
Anti-GH is a useful marker in classification of pituitary tumors and the study of pituitary disease (acromegaly). It reacts with GH-producing cells. Growth hormone receptors have been found in various non-pituitary cells, including that from hepatocellular carcinoma and various benign and malignant cutaneous lesions.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Rezaei M, et al. J Res Med Sci. 2012; 17:681-5
References 2:
Al-Brahim NY, et al. J Clin Pathol. 2006; 59:1245-53
References 3:
Fukaya T, et al. Cancer. 1980; 45:1598-1603
References 4:
Kovacs K, et al. Virch Arch Pathol Anat. 1982; 395:59-68
Anti-GH is a useful marker in classification of pituitary tumors and the study of pituitary disease (acromegaly). It reacts with GH-producing cells. Growth hormone receptors have been found in various non-pituitary cells, including that from hepatocellular carcinoma and various benign and malignant cutaneous lesions.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Rezaei M, et al. J Res Med Sci. 2012; 17:681-5
References 2:
Al-Brahim NY, et al. J Clin Pathol. 2006; 59:1245-53
References 3:
Fukaya T, et al. Cancer. 1980; 45:1598-1603
References 4:
Kovacs K, et al. Virch Arch Pathol Anat. 1982; 395:59-68
Anti-Gastrin antibody gives positive staining of G-cells of human antral/pyloric mucosa and cells producing gastrin or a structural gastrin analogue as is seen in stomach; no staining of other cells or tissue types has been observed. This antibody may react with sulfated and non-sulfated forms of gastrin. The antibody cross-reacts with more than 50% of the present choleocystokinin octapeptide.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Kasacka W, et al. Folia Morphol. 2012; 71:39-44.
References 2:
Hur K, et al. J Cancer Res Clin Oncol. 2006; 132:85-91
References 3:
Waldum et al. Frontiers in Endocrinology. 2017; 8:1-7
Anti-Gastrin antibody gives positive staining of G-cells of human antral/pyloric mucosa and cells producing gastrin or a structural gastrin analogue as is seen in stomach; no staining of other cells or tissue types has been observed. This antibody may react with sulfated and non-sulfated forms of gastrin. The antibody cross-reacts with more than 50% of the present choleocystokinin octapeptide.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Kasacka W, et al. Folia Morphol. 2012; 71:39-44.
References 2:
Hur K, et al. J Cancer Res Clin Oncol. 2006; 132:85-91
References 3:
Waldum et al. Frontiers in Endocrinology. 2017; 8:1-7
Anti-FSH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with FSH-producing cells (gonadotrophs).
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Baenziger JU, et al. Biochim Biophys Acta. 1988; 947:287-306
References 2:
Nussey SS, et al. BIOS Scientific Publishers Ltd; 2001 p. 217-79
References 3:
Uccella S, et al. Pituitary. 2000; 3:131-9
References 4:
Schmid M, et al. Pathol Res Pract. 2001; 197:663-9
Anti-FSH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with FSH-producing cells (gonadotrophs).
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Baenziger JU, et al. Biochim Biophys Acta. 1988; 947:287-306
References 2:
Nussey SS, et al. BIOS Scientific Publishers Ltd; 2001 p. 217-79
References 3:
Uccella S, et al. Pituitary. 2000; 3:131-9
References 4:
Schmid M, et al. Pathol Res Pract. 2001; 197:663-9
Anti-Factor VIII-Related Antigen antibody reacts with endothelial cells and neoplastic blood cells. This antibody has helped to establish the endothelial nature of some lesions of disputed histogenesis, e.g. Kaposis sarcoma and cardiac myxoma. Not all endothelial cells synthesize (or store) this molecule; therefore, it should not be surprising that not all tumors of endothelial differentiation (benign or malignant) react with this antigen.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Nichols GE, et al. Am J Clin Pathol. 1992; 97:770-5
References 2:
Falk S, et al. Am J Surg Pathol. 1993; 17:959-70
References 3:
Meis-Kindblom JM, et al. Am J Surg Pathol. 1998; 22:683-97
References 4:
Allison KH, et al. Am J Surg Pathol. 2004; 28:298-307
References 5:
Peyvandi F, et al. Blood Transfus. 2011; 9 Suppl 2:s3-8
Anti-CEA specifies a group of proteins in the Carcinoembryonic Antigen (CEA) family of proteins which are present in the epithelia of various types and tumors (both benign and malignant) derived from such epithelia. Such tissues are represented by the epithelia of colon, bronchus, alveoli, breast, pancreas, biliary tract, superficial layer and parietal layers of the stomach. Predominately biliary canaliculi are labelled in the liver and this factor is useful in the diagnosis of hepatocelluar carcinoma. Anti-CEA has been quite useful in differentiating adenocarcinoma of the lung vs. mesothelioma. Associated products: CK 5/6, Calretinin, WT-1, E-Cadherin, TTF-1, TAG-72, EMA, CK 20
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Shield PW, et al. Am J Clin Pathol. 1996; 105:157-62
References 2:
Sheahan K, et al. Am J Clin Pathol. 1990; 94:157-64
Anti-CD3 antibody has been considered the best all around T-cell marker. This antibody reacts with an antigen present in early thymocytes. The positive staining of this marker may represent a sign of early commitment to the T-cell lineage.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Beverley PC, et al. Eur J Immunol. 1981; 11:329-34
References 2:
Clevers H, et al. Eur J Immunol. 1988; 18:705-10
References 3:
Hedvat CV, et al. Hum Pathol. 2002; 33:968-74
References 4:
Karube K, et al. Am J Surg Pathol. 2003; 27:1366-74
Immunohistochemical staining with anti-calcitonin antibody has proven to be an effective way of demonstrating calcitonin-producing cells in the thyroid. C-cell hyperplasia and medullary thyroid carcinomas stain positive for calcitonin. Studies of calcitonin have resulted in the identification of a wide spectrum of C-cell proliferative abnormalities.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Matias-Guiu X, et al. Endocr Pathol. 2014; 25:21-9
References 2:
Fisher S, et al. Arch Pathol Lab Med. 2008;132:359-72
C4d is a stable split product remnant of classical complement activation which becomes covalently bound to endothelium and basement membrane, after induction of the classical antibody-induced pathway. As an established marker of antibody-mediated acute renal allograft rejection and its proclivity for endothelium, this component can be detected in peritubular capillaries in both chronic renal allograft rejection as well as hyperacute rejection, acute vascular rejection, acute cellular rejection, and borderline rejection. It has been shown to be a significant predictor of transplant kidney graft survival and is an aid in treating acute rejection.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Jianghua C, et al. Clin Transplant. 2005; 19:785-91
References 2:
Kayler LK, et al. Transplantation. 2008; 85:813-20
References 3:
Ranjan P, et al. Nephrol Dial Transplant .2008; 23:1735-41
References 4:
Seemayer CA, et al. Nephrol Dial Transplant. 2007; 22:568-76
References 5:
Bouron-Dal Soglio D, et al. Hum Pathol. 2008; 39:1103-10
Complement component C3 plays a central role in the activation of complement system. Its activation is required for both classical and alternative complement activation pathways. C3d deposition in the renal transplant PTCs (peritubular capillaries) is indicative of AR (acute rejection) with subsequent high probability of graft loss. Anti-C3d, combined with anti-C4d, can be utilized as a tool for diagnosis of AR and warrant prompt and aggressive anti-rejection treatment. In another study, Pfaltz et al. have shown that anti-C3d labeled the epidermal basement membrane in 97% (31/32) cases of bullous pemphigoid (BP), with none of the normal controls demonstrating such findings. In the same study 27% (3/11) cases of pemphigus vulgaris (PV) demonstrated intercellular C3d deposition. Therefore, C3d immunohistochemistry is a helpful adjunct in the diagnosis of BP (and perhaps PV), especially in the cases in which only formalin-fixed, paraffin embedded tissue is available for analysis.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Bickerstaff A, et al. Am J Pathol. 2008; 173:347-57
References 2:
Kuypers DR, et al. Transplantation. 2003; 76:102-8
Alpha-fetoprotein (AFP) is a fetal tumor-associated polypeptide of the albuminoid gene family that binds and transports molecules in addition to many other proposed functions. This secretory protein is synthesized primarily in the fetal liver whereas expression is repressed in adult liver.Anti-AFP has been immunohistochemically demonstrated in hepatocellular carcinoma (HCC) and shows no immunoreactivity in normal liver.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Mizejewski GJ et al. Exp Biol Med. 2001; 226:377-408
References 2:
Lazarevich NL et al.Biochemistry (Mosc). 2000; 65:117-33
References 3:
Yusof YA, et al. Anal Quant Cytol Histol. 2003; 25:332-8
ACTH or Adrenocorticotropic hormone is synthesized from pre-pro-opiomelanocortin (pre-POMC). ACTH is produced and secreted from corticotrophs in the anterior lobe (or adenohypophysis) of the pituitary gland. The anti-ACTH immunohistochemical reagent could be useful in the study of neoplastic and non-neoplastic pituitary diseases
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Pizarro CB, et al. Braz J Med Biol Res. 2004; 37:235-43
References 2:
Kageyama K, et al. Am J Med Sci. 2002; 324:326-30
References 3:
Fan X, et al. J Histochem Cytochem. 2002; 50:1509- 16
References 4:
Japon MA, et al. J Clin Endocrinol Metab. 2002; 87:1879-84
The immunohistochemical staining of Alpha-1-Antitrypsin is considered to be very useful in the study of inherited AAT deficiency, benign and malignant hepatic tumors and yolk sac carcinomas. Positive staining for A-1-Antitrypsin may also be used in detection of benign and malignant lesions of an histiocytic nature. Sensitivity and specificity of the results have made this antibody a useful tool in the screening of patients with cryptogenic cirrhosis or other forms of liver disease with portal fibrosis of uncertain etiology.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Callea F, et al. J Hepatol. 1986; 2:389-401
References 2:
Palmer PE, et al.Am J Clin Pathol. 1974; 62:350-4
References 3:
Palmer PE, et al. Cancer. 1980; 45:1424-31
References 4:
Raintoft I, et al. Hum Pathol. 1979; 10:419-24
References 5:
Ramsay AD, et al. Appl Immunohistochem Mol Morphol. 2008; 16:140-7
Alpha-fetoprotein (AFP) is a fetal tumor-associated polypeptide of the albuminoid gene family that binds and transports molecules in addition to many other proposed functions. This secretory protein is synthesized primarily in the fetal liver whereas expression is repressed in adult liver.Anti-AFP has been immunohistochemically demonstrated in hepatocellular carcinoma (HCC) and shows no immunoreactivity in normal liver.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Mizejewski GJ et al. Exp Biol Med. 2001; 226:377-408
References 2:
Lazarevich NL et al.Biochemistry (Mosc). 2000; 65:117-33
References 3:
Yusof YA, et al. Anal Quant Cytol Histol. 2003; 25:332-8
E. coli DNA polymerase 1 (928 aa; 103 kDa) is encoded by polA gene and involved in DNA replication and repair. In addition to polymerase activity, this DNA polymerase exhibits 3' to 5' and 5' to 3' exonuclease activity. It is able to utilize nicked circular duplex DNA as a template and can unwind the parental DNA strand from its template.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at -20 °C; make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Escherichia coli
Expected Species:
Species of your interest not listed? Contact us
Immunogen:
Purified, full length, recombinant POL I protein from E.coli, UniProt: P00582
Podoplanin is a transmembrane mucoprotein specifically expressed in the endothelium of lymphatic capillaries, while remaining absent from the blood vasculature. The protein is co-localized with VEGFR3/FLT4 in normal skin and kidney. Anti-Podoplanin is useful in the identification of lymphangiomas, Kaposi's sarcomas, epithelioid mesotheliomas, hemangioblastomas, seminomas, and some angiosarcomas that likely have lymphatic differentiation.
Podoplanin is a transmembrane mucoprotein specifically expressed in the endothelium of lymphatic capillaries, while remaining absent from the blood vasculature. The protein is co-localized with VEGFR3/FLT4 in normal skin and kidney. Anti-Podoplanin is useful in the identification of lymphangiomas, Kaposi's sarcomas, epithelioid mesotheliomas, hemangioblastomas, seminomas, and some angiosarcomas that likely have lymphatic differentiation.
Podoplanin is a transmembrane mucoprotein specifically expressed in the endothelium of lymphatic capillaries, while remaining absent from the blood vasculature. The protein is co-localized with VEGFR3/FLT4 in normal skin and kidney. Anti-Podoplanin is useful in the identification of lymphangiomas, Kaposi's sarcomas, epithelioid mesotheliomas, hemangioblastomas, seminomas, and some angiosarcomas that likely have lymphatic differentiation.
PntA (Slr1239) (Pyridine nucleotide transhydrogenase alpha-subunit) is an integral mambrane protein complex which participates in the regulation of ion of NAD(P)+:NAD(P)H redox homeostasis. Functional enzyme is a dimer of PntA and PntB.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Synechocystis sp. PCC6803
Expected Species:
Bacillus subtilis, Cyanothece sp. PCC 7822, Desulfobulbaceae bacterium BRH_c16a, Elusimicrobia bacterium, Fischerella sp. JSC-11, Hapalosiphon sp. MRB220, Magnetococcus marinus, Moorea producens JHB , Pleurocapsa sp. PCC 7327, Stanieria cyanosphaera Species of your interest not listed? Contact us
K m r inen et al. (2017). Pyridine nucleotide transhydrogenase PntAB is essential for optimal growth and photosynthetic integrity under low-light mixotrophic conditions in Synechocystis sp. PCC 6803. New Phytol. 2017 Apr;214(1):194-204. doi: 10.1111/nph.14353.
Postmeiotic Segregation Increased 2 (PMS2) is a DNA repair protein involved in mismatch repair. Mutations and deficiencies in the PMS2 gene have been linked to microsatellite instability and malignancies such as hereditary nonpolyposis colorectal cancer and endometrial cancer. Expression levels of the PMS2 protein may be useful as a screening tool for Lynch syndrome after a colorectal cancer diagnosis. Anti-PMS2 is recommended to be used as part of a panel along with antibodies against MSH2, MSH6, and MLH1.
Postmeiotic Segregation Increased 2 (PMS2) is a DNA repair protein involved in mismatch repair. Mutations and deficiencies in the PMS2 gene have been linked to microsatellite instability and malignancies such as hereditary nonpolyposis colorectal cancer and endometrial cancer. Expression levels of the PMS2 protein may be useful as a screening tool for Lynch syndrome after a colorectal cancer diagnosis. Anti-PMS2 is recommended to be used as part of a panel along with antibodies against MSH2, MSH6, and MLH1.
Postmeiotic Segregation Increased 2 (PMS2) is a DNA repair protein involved in mismatch repair. Mutations and deficiencies in the PMS2 gene have been linked to microsatellite instability and malignancies such as hereditary nonpolyposis colorectal cancer and endometrial cancer. Expression levels of the PMS2 protein may be useful as a screening tool for Lynch syndrome after a colorectal cancer diagnosis. Anti-PMS2 is recommended to be used as part of a panel along with antibodies against MSH2, MSH6, and MLH1.
Plus RIPA Lysis Buffer reagent is a complete cell lysis reagent popularly used for cultured mammalian cells. Plus RIPA lysis buffer is highly compatible with immunoassays, protein purification procedures, immunoprecipitation, and western blotting.
PLGG1 (Plastidal glycolate/glycerate translocator) is a glycolate/glycerate transporter protein required for photorespiration Alternative names of protein: AtLrgB, LrgB, PLGG
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Nicotiana tabacum
Expected Species:
Arabidopsis thaliana, Noccaea caerulescensSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana UniProt: Q9FVQ4
Experimental contitions: 5 g of total protein extracted freshly from 3-4 weeks old plant leaves with a blender at 4 C in 300 mM Sorbitol, 50 mM HEPES, 5mM MgCl2. Separated on 10 % SDS-PAGE and blotted 1h to PVDF, semi-dry. Blot was blocked with 6 % milk for 1h 4 C with agitation. Blot was incubated in the primary antibody at a dilution of 1: 1 000 ON at 4 C with agitation. According to South et. al (2019).
PLDA1/2 (phospholipase D alpha 1/2) is an enzyme which hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond and plays an important tole in processes as phytochormone action and response to stress. This protein is highly expressed in roots, stems and flowers, moderately in leaves, seedlings and siliques. Not detected in seeds. Induced by ABA, ethylene, heavy metal, cold, salt and osmotic stresses. Alternative names:PLDalpha1,PLD alpha 1,Choline phosphatase 1 PLDalpha, Phosphatidylcholine-hydrolyzing phospholipase D 1, Choline phosphatase 2, Phosphatidylcholine-hydrolyzing phospholipase D 2, PLDalpha2, PLD alpha 2.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Brassica oleracea
Expected Species:
Brassica napus, Brassica rapa, Capsella rubella, Carica papaya, Gossypium hirsutum, Glycine max, Ricinus communisSpecies of your interest not listed? Contact us
Kocourkova et al. (2020). Phospholipase Da1 mediates the high-Mg2+ stress response partially through regulation of K+ homeostasis. Plant Cell Environ. 2020 Jun 25.doi: 10.1111/pce.13831.
Plastid acyl-ACP desaturase, coded by FAB2 gene is involved in fatty acid metabolism in Chlamydomonas reinhardtii. It displays acyl-[acyl-carrier-protein] desaturase activity.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Expected Species:
Volvox carteri Species of your interest not listed? Contact us
Immunogen:
putative mature form of Chlamydomonas reinhardtii plastid acyl-ACP desaturase expressed in E.coli, UniProt: A8IQB8
Affinity purified using solid phase human plasminogen. Antibody concentration is > 4.5 mg/ml (E 1% at 280 nm = 13.0).Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2. Contains 0.05% (w/v) sodium azide as preservative. Antibody purity is > 95% based on SDS-PAGE.
Application Details:
The optimal working dilution should be determined by the investigator
Purity:
Immunogen Affinity purified using solid phase human Plasminogen.
Molecular Weight:
95 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
The PLAP [IHC088] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Applications:
IHC
Clone number:
IHC088
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Placenta
Buffer:
Tris Buffer, pH 7.3 - 7.7, with 1% BSA and <0.1% Sodium Azide
The PLAP [IHC088] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Applications:
IHC
Clone number:
IHC088
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Placenta
Buffer:
Tris Buffer, pH 7.3 - 7.7, with 1% BSA and <0.1% Sodium Azide
The PLAP [IHC088] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Applications:
IHC
Clone number:
IHC088
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Placenta
Buffer:
Tris Buffer, pH 7.3 - 7.7, with 1% BSA and <0.1% Sodium Azide
PIPs proteins are aquaporins which facilitate the transport of water and small neutral molecules across cell membrane. Alternative names: PIP1-1, PIP1-2, PIP1-3, plasma membrane intrinistic protein 1a, 1b, 1c, PIP1a, PIP1b, PIP1c, plasma membrane aquaporin-1, transmembrane protein A, TMP-A, AthH2, transmembrane protein B, TMP-B,
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Brassica sp., Jatropha curcas L. cv. Biji Jarak , Mesembryantheum crystallinum, Populus nigra, Populus trichocarpa, Raphanus sativus, Thellungiella salsuginea
Expected Species:
Brassica sp., Hordeum vulgare, Juglans regia, Oryza sativa, Populus tremula, Triticum aestivum, Vicia faba Species of your interest not listed? Contact us
Protein or membrane sample should be treated at 70 C for 10 min before loading on the gel.
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to HRP.
Molecular Weight:
30,68 | 28 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Antibodies will detect target protein in a few µg of a crude preparation loaded per well. If purified preparations of vacuolar and plasma membranes are used, one µg load per well should be sufficient
PIPs proteins are aquaporins which facilitate the transport of water and small neutral molecules across the cell membrane. Alternative names: PIP1-1, PIP1-2, PIP1-3, plasma membrane intrinsic protein 1a, 1b, 1c, PIP1a, PIP1b, PIP1c, plasma membrane aquaporin-1, transmembrane protein A, TMP-A, AthH2, transmembrane protein B, TMP-B.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Brassica sp,, Jatropha curcas L, cv, Biji Jarak , Mesembryantheum crystallinum, Populus nigra, Populus trichocarpa, Raphanus sativus, Thellungiella salsuginea
Expected Species:
Brassica sp., Hordeum vulgare, Juglans regia, Nicotiana tabacum, Oryza sativa, Populus tremula, Triticum aestivum, Vicia fabaSpecies of your interest not listed? Contact us
Protein or membrane sample should be treated at 70 C for 10 min before loading on the gel.
Application Details:
To be determined by end user.
Purity:
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 650.
Molecular Weight:
30,68 | 28 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known.
Selected references:
To be added when available. Antibody released in May 2023.
Special application note:
Antibodies will detect target protein in a few µg of a crude preparation loaded per well. If purified preparations of vacuolar and plasma membranes are used, one g load per well should be sufficient.DyLight 650 has Amax = 652 nm, Emax = 672 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
PIPs proteins are aquaporins which facilitate the transport of water and small neutral molecules across the cell membrane, Alternative names: PIP1-1, PIP1-2, PIP1-3, plasma membrane intrinsic protein 1a, 1b, 1c, PIP1a, PIP1b, PIP1c, plasma membrane aquaporin-1, transmembrane protein A, TMP-A, AthH2, transmembrane protein B, TMP-B.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Brassica sp,, Jatropha curcas L, cv, Biji Jarak , Mesembryantheum crystallinum, Populus nigra, Populus trichocarpa, Raphanus sativus, Thellungiella salsuginea
Expected Species:
Brassica sp., Hordeum vulgare, Juglans regia, Nicotiana tabacum, Oryza sativa, Populus tremula, Triticum aestivum, Vicia fabaSpecies of your interest not listed? Contact us
Protein or membrane sample should be treated at 70 C for 10 min before loading on the gel,
Application Details:
To be determined by end user.
Purity:
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 594.
Molecular Weight:
30,68 | 28 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known,
Selected references:
To be added when available. Antibody released in May 2023.
Special application note:
Antibodies will detect target protein in a few µg of a crude preparation loaded per well. If purified preparations of vacuolar and plasma membranes are used, one g load per well should be sufficient.DyLight 594 has Amax = 593 nm, Emax = 618 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
PIPs proteins are aquaporins which facilitate the transport of water and small neutral molecules across the cell membrane. Alternative names: PIP1-1, PIP1-2, PIP1-3, plasma membrane intrinsic protein 1a, 1b, 1c, PIP1a, PIP1b, PIP1c, plasma membrane aquaporin-1, transmembrane protein A, TMP-A, AthH2, transmembrane protein B, TMP-B.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Brassica sp,, Jatropha curcas L, cv, Biji Jarak , Mesembryantheum crystallinum, Populus nigra, Populus trichocarpa, Raphanus sativus, Thellungiella salsuginea
Expected Species:
Brassica sp., Hordeum vulgare, Juglans regia, Nicotiana tabacum, Oryza sativa, Populus tremula, Triticum aestivum, Vicia fabaSpecies of your interest not listed? Contact us
Protein or membrane sample should be treated at 70 C for 10 min before loading on the gel.
Application Details:
To be determined by end user.
Purity:
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 488.
Molecular Weight:
30,68 | 28 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known.
Selected references:
To be added when available. Antibody released in May 2023.
Special application note:
Antibodies will detect target protein in a few µg of a crude preparation loaded per well. If purified preparations of vacuolar and plasma membranes are used, one µg load per well should be sufficient.DyLight 488 Amax = 493 nm, Emax = 519 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
PIPs proteins are aquaporins which facilitate the transport of water and small neutral molecules across cell membrane. Alternative names: PIP1-1, PIP1-2, PIP1-3, plasma membrane intrinistic protein 1a, 1b, 1c, PIP1a, PIP1b, PIP1c, plasma membrane aquaporin-1, transmembrane protein A, TMP-A, AthH2, transmembrane protein B, TMP-B,
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Brassica sp., Jatropha curcas L. cv. Biji Jarak , Mesembryantheum crystallinum, Populus nigra, Populus trichocarpa, Raphanus sativus, Thellungiella salsuginea
Expected Species:
Brassica sp., Hordeum vulgare, Juglans regia, Oryza sativa, Populus tremula, Triticum aestivum, Vicia fabaSpecies of your interest not listed? Contact us
Protein or membrane sample should be treated at 70 C for 10 min before loading on the gel.
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to biotin.
Molecular Weight:
30,68 | 28 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Antibodies will detect target protein in a few µg of a crude preparation loaded per well. If purified preparations of vacuolar and plasma membranes are used, one µg load per well should be sufficient
PIPs proteins are aquaporins which facilitate the transport of water and small neutral molecules across cell membrane. Alternative names: PIP1-1, PIP1-2, PIP1-3, plasma membrane intrinistic protein 1a, 1b, 1c, PIP1a, PIP1b, PIP1c, plasma membrane aquaporin-1, transmembrane protein A, TMP-A, AthH2, transmembrane protein B, TMP-B,
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Brassica sp., Jatropha curcas L. cv. Biji Jarak , Mesembryantheum crystallinum, Populus nigra, Populus trichocarpa, Raphanus sativus, Thellungiella salsuginea
Expected Species:
Brassica sp., Hordeum vulgare, Juglans regia, Oryza sativa, Populus tremula, Triticum aestivum, Vicia faba Species of your interest not listed? Contact us
Protein or membrane sample should be treated at 70 C for 10 min before loading on the gel.
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to ALP.
Molecular Weight:
30,68 | 28 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Antibodies will detect target protein in a few µg of a crude preparation loaded per well. If purified preparations of vacuolar and plasma membranes are used, one µg load per well should be sufficient
PIPs proteins are aquaporins which facilitate the transport of water and small neutral molecules across the cell membrane. Alternative names: PIP1-1, PIP1-2, PIP1-3, plasma membrane intrinsic protein 1a, 1b, 1c, PIP1a, PIP1b, PIP1c, plasma membrane aquaporin-1, transmembrane protein A, TMP-A, AthH2, transmembrane protein B, TMP-B,
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Brassica sp., Jatropha curcas L. cv. Biji Jarak , Mesembryantheum crystallinum, Populus nigra, Populus trichocarpa, Raphanus sativus, Setaria viridis, Thellungiella salsuginea
Expected Species:
Brassica sp., Hordeum vulgare, Juglans regia, Nicotiana tabacum, Oryza sativa, Populus tremula, Triticum aestivum, Vicia fabaSpecies of your interest not listed? Contact us
Protein or membrane sample should be treated at 70 C for 10 min before loading on the gel.
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
30,68 | 28 kDa
Not reactive in:
Fragaria sp., Spinacia oleracea
Selected references:
Chen et al. (2022) Elucidating the role of SWEET13 in phloem loading of the C4 grass Setaria viridis. Plant J. 2022 Feb;109(3):615-632. doi: 10.1111/tpj.15581. Epub 2021 Dec 12. PMID: 34780111.Jang et al. (2013). Twoaquaporins of Jatropha are regulated differentially during drought stress and subsequent recovery. J Plant Physiol. March 25.Lopez et al. (2013). Aquaporins And Leaf Hydraulics, Poplar Sheds New Light. Plant Cell Physiol. Sep 20.
Special application note:
Antibodies will detect target protein in a few µg of a crude preparation loaded per well. If purified preparations of vacuolar and plasma membranes are used, one µg load per well should be sufficient
Plasma membrane aquaporin, PIP2;7 is water channel protein required for water transport across cell membrane. Alternative names: plasma membrane intrinsic protein 2-7, AtPIP2;7, plasma membrane intrinsic protein 3, salt stress-induced major intrinsic protein, PIP3a
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Detection pattern consists of di and monomer of PIP2-7.This antibody has a potential to work in immunolocalization studies, as it is recognizing C-terminal part of the sequence.This product can be sold containing ProClin if requested.
Application Details:
1 : 600 (IP), 1: 3000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
30.7 | 30 kDa (Zea mays)
Not reactive in:
Hordeum vulgare
Selected references:
Kumar et al. (2022). Proteomic dissection of rice cytoskeleton reveals the dominance of microtubule and microfilament proteins, and novel components in the cytoskeleton-bound polysome, Plant Physiology and Biochemistry, Volume 170,2022,Pages 75-86,ISSN 0981-9428, https://doi.org/10.1016/j.plaphy.2021.11.037.
Arabidopsis thaliana auxin efflux carrier component AtPIN2 encoded by the AtPIN2 gene (also known as EIR1 and AGR1). AtPIN proteins are asymmetrically localized within plant plasma membranes and mediate polar auxin transport. AtPIN2 is a key regulator of the response of Arabidopsis roots to gravity. Alternative names: Auxin efflux carrier AGR, Ethylene-insensitive root 1, AtEIR1, Polar-auxin-transport efflux component AGR1, Protein AGRAVITROPIC 1, AtAGR1, Protein WAVY 6.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Beta vulgaris, Brassica napus, Camelina sativa, Cannabis sativa, Capsella rubella, Cucumis melo, Eucalyptus grandis, Eutrema salsugineum, Glycine max, Malus domestica, Morus notabilis, Prunus dulcis, Raphanus sativus, Spinacia oleracea, Vitis vinifera Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated mixture of two synthetic peptides derived from AtPIN2 sequence, UniProt:Q9LU77, TAIR:At5g57090
Normal pig (swine) serum lipid extracted and dialyzed against 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2. This product is used as a blocking reagent or control for most immunoassay applications.
Product Type:
Antibody
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C. For storage at 2-8 C, add a preservative to prevent growth of bacteria. Rehydrate with 10,0 ml of deionized water. Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Protein concentration is 60,0 mg/ml (Bradford, IgG standards), Antibody is supplied in 10 mM sodium phosphate, 0,15 M sodium chloride, pH 7,2, No preservative is added
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C. For storage at 2-8 C, add a preservative to prevent growth of bacteria.This product is used as a blocking reagent or control for
After opening the vial, the lyophilized content is reconstituted by adding 1 ml of sterile distilled water, mixed gently by inversion until complete dissolution is obtained, Allow to stand at ambient temperature for 5-10 minutes to reach equilibrium, Reconstituted serum may be stored frozen
Special application note:
This normal serum can be used as an internal relative standard for quantitative protein assays such as double radial immunodiffusion (Mancini, Fahey), ELISA, Western blot and electroimmunodiffusion (Laurell). The product can be also applied as a blocking or negative control in non-precipitating antibody binding assays as immunofluorescence.Normal pig serum was obtained from healthy animals of European origin.
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C. For storage at 2-8 C, add a preservative to prevent growth of bacteria.This product is used as a blocking reagent or control for
Purified serum, lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2.
Special application note:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 C. Centrifuge reconstituted serum to remove any precipitates.This product is used as a blocking reagent or control for most immunoassay applications.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Pig Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Pig Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Pig purified IgG contains Protein A purified pig IgG from normal serum, e.g. serum of non immunized animals and is excellent for use as blocking reagent in immunoassays.
PIF5 (Phytochrome interacting factor 5) is a transcription factor which acts negatively in the phytochrome B signaling pathway and regulates PHYB at post-transcriptional level. Alternative protein names: AtbHLH65, bHLH65, bHLH065, Basic helix-loop-helix protein 65, PHYTOCHROME INTERACTING FACTORAS12 2112 3-LIKE 6, PIL6, Phytochrome interacting factor-like 6, Transcription factor EN 103.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
For detection of PIF5 please use the most sensitive detection reagent
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
49.3 | 62 kDa
Not reactive in:
Physcomitrella patens, Solanum lycopersicum
Selected references:
Pham et al. (2018). Dynamic regulation of PIF5 by COP1-SPA complex to optimize photomorphogenesis in Arabidopsis. Plant J. 2018 Aug 25. doi: 10.1111/tpj.14074.
Special application note:
PIF proteins are not that stable, therefore special precautions should be taken during extraction and whole procedure should be performed in as little light as possible (light green light). Extraction of PIF proteins is described in Shen et al. (2007).
PIF4 (PHYTOCHROME INTERACTING FACTOR 4) is a transcription factor involved in the phytochrome B signaling pathway. Interacts with APRR1/TOC1 and PIF3 and binds to EGL2 and RGA. Alternative names: AtPIF4, Basic helix-loop-helix protein 9, AtbHLH9, bHLH 9, SRL2, Short under red-light 2, EN102, Transcription factor EN 102, bHLH transcription factor bHLH009.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana PIF4, UniProt: Q8W2F3, TAIR:AT2G43010
Applications:
Chromatin Immunoprecipitation (ChIP), Western blot (WB)
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Gras et al. (2020). Arabidopsis Thaliana SURFEIT1-like Genes Link Mitochondrial Function to Early Plant Development and Hormonal Growth Responses. Plant J . 2020 Apr 5. doi: 10.1111/tpj.14762.Ferrero et al. (2019). Class I TCP transcription factors target the gibberellin biosynthesis gene GA20ox1 and the growth promoting genes HBI1 and PRE6 during thermomorphogenic growth in Arabidopsis. Plant Cell Physiol. 2019 Jul 11. pii: pcz137. doi: 10.1093/pcp/pcz137.Hwang et al. (2019). Trehalose-6-phosphate signaling regulates thermoresponsive hypocotyl growth in Arabidopsis thaliana. EMBO Rep. 2019 Aug 8:e47828. doi: 10.15252/embr.201947828.
Special application note:
PIF proteins are very unstable, therefore special precautions should be taken during extraction and whole procedure should be performed in the dark and with as little light as possible (green light only). Extraction of PIF proteins is described in Shen et al. (2007).This product can be sold containing ProClin if requested.
PIF4 (PHYTOCHROME INTERACTING FACTOR 4) is a transcription factor involved in the phytochrome B signaling pathway. Interacts with APRR1/TOC1 and PIF3 and binds to EGL2 and RGA. Alternative names: AtPIF4, Basic helix-loop-helix protein 9, AtbHLH9, bHLH 9, SRL2, Short under red-light 2, EN102, Transcription factor EN 102, bHLH transcription factor bHLH009.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles,Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Goat
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica napus, Brassica rapa, Camelina sativa, Eutrema salsugineumSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana PIF4, UniProt:Q8W2F3, TAIR:AT2G43010
Material used need to be up to 8 days old as detection in older rosette leaf may fail
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
48,3 | 60 kDa
Not reactive in:
Solanum lycopersicum
Selected references:
Fang et al. (2022) TANDEM ZINC-FINGER/PLUS3 regulates phytochrome B abundance and signaling to fine-tune hypocotyl growth. Plant Cell. 2022;34(11):4213-4231. doi:10.1093/plcell/koac236Bajracharya, Xi, Grace, et al. (2022) PHYTOCHROME-INTERACTING FACTOR 4/HEMERA-mediated thermosensory growth requires the Mediator subunit MED14. Plant Physiol. 2022;190(4):2706-2721. doi:10.1093/plphys/kiac412Agrawal et al. (2022) MEDIATOR SUBUNIT17 integrates jasmonate and auxin signaling pathways to regulate thermomorphogenesis. Plant Physiol. 2022 Aug 1;189(4):2259-2280. doi: 10.1093/plphys/kiac220. PMID: 35567489.Lee at al. (2021) Spatial regulation of thermomorphogenesis by HY5 and PIF4 in Arabidopsis. Nat Commun. 2021 Jun 16;12(1):3656. doi: 10.1038/s41467-021-24018-7. PMID: 34135347; PMCID: PMC8209091.Lee, Paik & Huq. (2020). SPAs promote thermomorphogenesis by regulating the phyB-PIF4 module in Arabidopsis. Development. 2020 Oct 8;147(19):dev189233. doi: 10.1242/dev.189233. PMID: 32994167; PMCID: PMC7561471.
Special application note:
PIF proteins are not that stable, therefore special precautions should be taken during extraction and whole procedure should be performed in as little light as possible (light green light). Extraction of PIF proteins is described in Shen et al. (2007).
PIF3 (Phytochrome interacting factor 3) is a transcription factor which acts positively in the phytochrome signaling pathway. It activates transcription by binding to the G box. Subcellular localization is nucleus. Alternative names:Basic helix-loop-helix protein 8, AtbHLH8, bHLH8, Phytochrome-associated protein 3, Phytochrome-interacting factor 3, Transcription factor EN 100, EN100, bHLH transcription factor bHLH008, PAP3, PHYTOCHROME-ASSOCIATED PROTEIN 3, POC1, PHOTOCURRENT 1,ABI1, ABA INSENSITIVE 1, AtABI1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles,Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Goat
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Cardamine hirsuta Species of your interest not listed? Contact us
PIF3 protein runs at higher MW than expected, as observed previously (Al-Sady et al. 2006). PIF proteins are not that stable, therefore special precautions should be taken during extraction and whole procedure should be performed in as little light as possible (light green light).
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
57 | ca, 65 kDa
Not reactive in:
Nicotiana attenuata
Selected references:
Sinclair et al. (2017) Etiolated Seedling Development Requires Repression of Photomorphogenesis by a Small Cell-Wall-Derived Dark Signal. Curr Biol. 2017 Nov 20;27(22):3403-3418.e7. doi: 10.1016/j.cub.2017.09.063.
Special application note:
Please, do not re-use PIF3 antibody solution after first incubation with your membrane as most of antibody will bind in this step and next result will not be reproducable
Phytochrome is a photomorphogenically active pigment that modulates plant growth and development with respect to incident light intensity and wavelength distribution. It exists in two forms: an inactive, red-absorbing form (Pr),4 and an active far-red-absorbing form (Pfr). When either absorbs light, it is photoconverted to the other. Phytochrome is a dimeric, water-soluble, relatively labile chromoprotein with similar, if not identical, monomers of about 124 kDa each. It is also a relatively low abundance protein, even under the best of conditions. Genetic manipulation of phytochrome expression in plants leads to plants requiring less light and able to divert more energy to the production of fruits and seeds. For its physicochemical characterization, it has therefore been difficult to utilize techniques that require large quantitites of highly purified protein. Consequently, indirect methods for elucidating its structure/function relationships are especially important. These could also be applicable to fabaceae and closely related families.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at -80 C; Avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Mouse
Species Reactivity:
Avena sativa, Pisum sativum
Expected Species:
graminae, fabaceaeSpecies of your interest not listed? Contact us
Immunogen:
Phytochrome
Applications:
ELISA (ELISA), Competitive ELISA, Immunoflourescence (IF), Immunoprecipiation (IP), Western blot (WB)
Epitope for this antibody is located at 36 kDa from N-terminus and very near the site of chromophore attachment
Application Details:
assay dependent
Purity:
Cell culture supernatant
Molecular Weight:
124 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Pratt et al. (1988). Mapping of antigenic domains on phytochrome from etiolated Avena sativa L. by immunoblot analysis of proteolytically derived peptides. Arch Biochem Biophys. 267(2):723-35. doi: 10.1016/0003-9861(88)90081-1.Cordonnier et al. (1983). Production and purification of monoclonal antibodies to Pisum and Avena phytochrome. Planta. 158(4):369-76. doi: 10.1007/BF00397340.
PhyB (Phytochrome B) is a Red/far-red photoreceptor involved in the regulation of de-etiolation. Protein exists in two inter-convertible forms: Pr and Pfr (active). Involved in the light-promotion of seed germination and in the shade avoidance response. Alternative names: Protein LONG HYPOCOTYL 3, Protein OUT OF PHASE 1, OOP1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabis alpina, Camelina sativa, Capsella rubella, Brassica napus, Brassica oleracea, Eutrema salsugineum, Raphanus sativusSpecies of your interest not listed? Contact us
Phytochrome A (PhyA) is the primary photoreceptor mediating various responses to far-red (FR) light in plants. Alternative protein names: FAR RED ELONGATED HYPOCOTYL 2, FAR RED ELONGATED 1, ELONGATED HYPOCOTYL 8.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Brassica rapa, Cardamine hirsuta, Dacucus carota, Lathyrus sativus, Fragaria ananassa, Glycine max, Gossyoium hirsutum, Hordeum vulgare, Lotus corniculatus, Medicago truncatula, Nicotiana benthamiana (PhyA1), Nicotiana tabacum, Pisum sativum, Populus balsamifera, Ricinus communis, Solanum lycopersicumSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from conserved plant PhyA protein sequences including Arabidopsis thaliana UniProt:P14712, TAIR:At1g59070; peptide sequence is not present in other plant phytochrome forms (B-E)
Careful sample collection is adviced to assure the best results with this antibody
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
124 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Schwenk et al. (2021) Uncovering a novel function of the CCR4-NOT complex in phytochrome A-mediated light signalling in plants. Elife. 2021 Mar 30;10:e63697. doi: 10.7554/eLife.63697. PMID: 33783355; PMCID: PMC8009681.Schenk et al. (2021) Light-induced degradation of SPA2 via its N-terminal kinase domain is required for photomorphogenesis, Plant Physiology, 2021;, kiab156, https://doi.org/10.1093/plphys/kiab156Menon et al. (2019). Arabidopsis FAR-RED ELONGATED HYPOCOTYL 1 and FHY1-LIKE are not required for phytochrome A signal transduction in the nucleus. Plant Communications. Available online 9 November 2019, 100007.Agliassa et al. (2018). Geomagnetic field impacts on cryptochrome and phytochrome signaling. J Photochem Photobiol B. 2018 Aug;185:32-40. doi: 10.1016/j.jphotobiol.2018.05.027.Zhang et al. (2018). Characterization of peanut phytochromes and their possible regulating roles in early peanut pod development. PLoS One. 2018 May 25;13(5):e0198041. doi: 10.1371/journal.pone.0198041.
Special application note:
In vivo pull down assay for PhyA and western blot analysis of eluted proteins is described in Paik et al. (2012). Phytochrome regulates translation of mRNA in the cytosol. PNAS 109 (4): 1335-1340.
Hordeum vulgare Pht1-6 is a putative low-affinity barley phosphate transporter that is likely to function in phosporus remobilisation around the plant (expressed in plant vascular tissues).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Hordeum vulgare
Immunogen:
two synthetic peptides from the loop region of Pht1-6 (Q8H6D9), conjugated to KLH
Hordeum vulgare Pht1-1 and 1-2 are putative high-affinity barley phosphate transporters that are likely to function in phosphate uptake from the soil (expressed in root epidermal cells).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Hordeum vulgare
Expected Species:
Triticum aestivumSpecies of your interest not listed? Contact us
Immunogen:
two synthetic peptides from the loop region of Pht1-1 (Q8H6E0) and 1-2, conjugated to KLH
Applications:
ELISA (ELISA), Immunolocalization (IL), Western blot (WB)
Antibody cannot discriminate between Pht1-1 or Pht1-2 due to the high level of sequence conservation
Application Details:
1 : 10 000 (ELISA), 1: 100 (IL), 1 : 2000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 100 µl of sterile water
Molecular Weight:
56.9 kDa
Not reactive in:
Arabidopsis thaliana
Selected references:
Namyslov et al. (2020). Exodermis and Endodermis Respond to Nutrient Deficiency in Nutrient-Specific and Localized Manner. Plants (Basel). 2020 Feb 6;9(2). pii: E201. doi: 10.3390/plants9020201. (immunolocalization)
pHRed is a red fluorescent sensor of pH. Fluorescence emission of pHRed peaks at 610 nm while exhibiting dual excitation peaks at 440 nm and 585 nm.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
pHRed
Immunogen:
Recombinat part of pHRed of Chlamydomonas reinhardtii.
PHR1 (Phosphate starvation response 1) is nuclear localized and involved in transcription regulation.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Lyophilized antibody can be stored at -20 °C for up to 3 years. Re-constituted antibody can be stored at 4°Cfor several days to weeks. Once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Hordeum vulgare (recombinant PHR1)
Expected Species:
Aegilops tauschii, Brachypodium distachyon, Dichanthelium oligosanthes, Panicum hallii Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from Hordeum vulgare PHR1, UniProt: F4Y5E9
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit, Secondary antibody: Goat,
Species Reactivity:
Algae, Cyanobacteria, Higher plants
Immunogen:
KLH-conjugated syntetic peptides for respective antibodies, see product info sheets
50 µl of respective antibody, 100 µl of each protein standard, 2 x 10 µl of secondary antibody, 10 ml of ECL reagent,
Estimation of PSI to PSII ratio can be done using quantitative western blot technique using anti-PsaC (PSI) and PsbA (PSII) antibodies. References: Brown et al. (2007). Resource dynamics during infection of Micromonas pusilla by virus MpV-SP1. Environmental Microbiology 9(11): 2720-2727. Brown et al. (2008). Flux capacities and acclimation costs in Trichodesmium from the Gulf of Mexico. Marine Biology 154 (3): 413-422.
Selected references:
Abramson (2018). CARBON PARTITIONING IN ENGINEERED CYANOBACTERI UM FOR THE STUDY OF FEEDBACK INHIBITION OF PHOTOSYNTHESIS. Michigan State University, ProQuest Dissertations Publishing, 2018. 10826228.Morash et al. (2007) Macromolecular dynamics of the photosynthetic system over a seasonal developmental progression in Spartina alterniflora. Can J. of Bot. 85: 476-483(8)Bouchard et al. (2006) UVB effects on the photosystem II-D1 protein of phytoplankton and natural phytoplankton communities. Photochem and Photobiol 82: 936-951.MacKenzie et al (2005). Large reallocations of carbon, nitrogen and photosynthetic reductant among phycobilisomes, photosystems and Rubisco during light acclimation in Synechococcus elongatus are constrained in cells under low environmental inorganic carbon. Arch of Microbiol. 183: 190 - 202.
Special application note:
Product information - Primary antibodies:Product number:Product name:Reconstitution: Recommended dilution:AS03 037Rabbit Anti-RbcL Global antibodyFor reconstitution see lable on respective tube.1:5000-10 000 with ECLAS10 939Rabbit Anti-PsaC Global antibodyFor reconstitution see lable on respective tube.1:1000 with ECLAS05 084Rabbit Anti-PsbAGlobal antibodyFor reconstitution see lable on respective tube.1:10 000 with ECL* All primary antibodies in this kit are raised in rabbits.Product information - Protein standards:Product number:Product name:Concentration:Size:Western Blot – Positive Control:AS01 016SPsbA *0.25 pmol/ μl41.5 kDa#To generate a standard curve, 3 loads are suggested (0.5, 2 and 4 ul). For most applications a sample load of 0.2 ug of chlorophyll will give a PsbA signal in this range.A 2 ul load is optimal for most chemiluminescent detection systems to use as a positive control.AS01 017SRbcL *0.15 pmol/ μl52.7 kDaTo generate a standard curve, 3 loads are suggested (0.5, 2 and 4 ul). For most applications a sample load of 0.2 ug of chlorophyll will give a RbcL signal in this range.A 2 ul load is optimal for most chemiluminescent detection systems to use as a positive control.AS04 042SPsaC *0.15 pmol/μl11.5 kDa#To generate a standard curve, 3 loads are suggested (0.5, 2 and 4 l). For most applications a sample load of 0.2 g of chlorophyll will give a PsaC signal in this range.A 2 ul load is optimal for most chemiluminescent detection systems as a positive control.*These proteins are larger than a respective native protein due to the addition of His-tag* For reconstitution of standards see lable on respective tube.Product information - Secondary antibody:AS09 602-trial Goat anti-Rabbit IgG (H&L), HRP conjugated, 20 l (2x10 l)Product information - ECLreagent:AS16 ECL-N-10 AgriseraECL Bright (10 ml trial pack)Educational information about Quantitative western blot can be found here: detailed method description, video tutorial
PHOT2 | phototropin-2 is a membrane-bound serine/threonine kinase that functions as blue light photoreceptor in redundancy with PHOT1. Involved in processed like stomatal opening, chloroplast movement and phototropism. Alternative names: NPL1, K21L19.6, AtKin7, Defective in chloroplast avoidance protein 1Non-phototropic hypocotyl 1-like protein 1, NPH1-like protein 1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabidopsis thaliana
Immunogen:
KLH-conjugated synthetic peptide derived from known Arabidopsis thaliana PHOT2 P93025, At5g58140
Labuz et al. (2021) Phototropin interactions with SUMO proteins. Plant Cell Physiol. 2021 Feb 17:pcab027. doi: 10.1093/pcp/pcab027. Epub ahead of print. PMID: 33594440.Krzeszowiec et al. (2020). Chloroplasts in C3 grasses move in response to blue-light. Plant Cell Rep . 2020 Oct;39(10):1331-1343.doi: 10.1007/s00299-020-02567-3. Epub 2020 Jul 13.Labuz et al. (2015). The impact of temperature on blue light induced chloroplast movements in Arabidopsis thaliana. Plant Science, doi:10.1016/j.plantsci.2015.07.013.Aggarwal et al. (2014). Blue-light-activated phototropin2 trafficking from the cytoplasm to Golgi/post-Golgi vesicles. J Exp Bot. 2014 May 12.
Special application note:
This product can be sold containing ProClin if requested
PHOT1 | phototropin-1 is a blue-light photoreceptor which containst light activated serine-threonine kinase domain. Is required for stomatal opening, chloroplast movements, leaf flattening and phototropism. Undergoes blue-light-dependent autophosphorylation. Alternative names: NPH1, RPT1, JK224, Non-phototropic hypocotyl protein 1, Root phototropism protein 1
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabidopsis thaliana
Immunogen:
KLH-conjugated synthetic peptide derived from known Arabidopsis thaliana PHOT1 O48963, At3g45780
Information about phot1 mutant, first named nph1: Liscum &. Briggs (1995). Mutations in the NPH1 Locus of Arabidopsis Disrupt the Perception of Phototropic Stimuli. The Plant Cell, Vol. 7, 473-485.Huala et al. (1997). Arabidopsis NPH1: A Protein Kinase with a Putative Redox-Sensing Domain. Science 19: Vol. 278 no. 5346 pp. 2120-2123.Lehmann et al. (2011). Transitions of gene expression induced by short-term blue light. Plant Biology Volume 13, Issue 2, pages 349–361. Seeds of this mutant are available at uNASC.
Application Details:
1 : 5000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
111 | 132 kDa
Not reactive in:
Cuscuta campestris, Oryza sativa
Selected references:
Labuz et al. (2021) Phototropin interactions with SUMO proteins. Plant Cell Physiol. 2021 Feb 17:pcab027. doi: 10.1093/pcp/pcab027. Epub ahead of print. PMID: 33594440.Krzeszowiec et al. (2020). Chloroplasts in C3 grasses move in response to blue-light. Plant Cell Rep . 2020 Oct;39(10):1331-1343.doi: 10.1007/s00299-020-02567-3. Epub 2020 Jul 13.Labuz et al. (2015). The impact of temperature on blue light induced chloroplast movements in Arabidopsis thaliana. Plant Science, doi:10.1016/j.plantsci.2015.07.013.Eckstein et al. (2015). Auxin and chloroplast movements. Physiol Plant. 2015 Oct 15. doi: 10.1111/ppl.12396.
Special application note:
This product can be sold containing ProClin if requested
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on the label. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Mouse
Species Reactivity:
Species independent
Immunogen:
BSA-conjugated phosphotyrosine
Applications:
Immunocyto chemistry (ICC), Flowcyt (FC), Western blot (WB)
Phosphorylation of specific tyrosine residues has been shown to be a primary mechanism of signal transduction during normal mitogenesis, cell cycle progression and oncogenic transformation. Antibodies that specifically recognize phosphorylated tyrosine residues have proved to be invaluable to the study of tyrosine -phosphorylated proteins and the biochemical pathways in which they function.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at -20 °C; make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Mouse
Species Reactivity:
Phosphotyrosine - not species dependent
Immunogen:
balbC mice immunized with phosphotyrosine coupled to carrier protein
Applications:
ELISA (ELISA), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western blot (WB)
Phosphothreonine is a phosphoamino acid and phosphorylated ester of threonine.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at -20 °C for one year in storage buffer: PBS, 50 % glycerol and 0,01 % sodium azide, Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Antibody detects proteins phosphorylated on threonine residues. Does not cross-react with phosphotyrosine.5 % BSA is recommened to use for blocking as milk contains casein which is a phospho protein.
Immunogen:
KLH-conjugated phosphothreonine
Applications:
ELISA (ELISA), Immunoprecipitation (IP), Immunofluorescence (IF), Immunocytochemistry (ICC), Western blot (WB)
2 g/ml of this antibody is sufficient for detection of phosphorylation signal in western blot using mouse spleen extract treated with Vanadium.Use freshly extracted samples. Precipitate target protein to purify it and avoid cross-reactions.
Application Details:
ELISA (1:2000), ICC/IF (1:60), IP (1:100), WB (1:500)
Purity:
Immunogen affinity purified in PBS, 50% glycerol, 0.01% sodium azide.
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Affinity purified in PBS, pH 7.4 with 0.09 % sodium azide and 50 % glycerol at concentration 0.25 mg/ml. This antibody is recognizing proteins and peptides phosphorylated on threonine residues. There are no cross reactions with phosphotyrosine.
Detergents typically present in cell lysis buffers are thought to disrupt organelles and compartments and increase the exposure of soluble phospho-proteins to phosphatases and proteases thereby resulting in uncontrolled dephosphorylation and proteolysis. Phospho-Sure RTD Neuronal extraction buffer is optimized for the extraction of phosphorylated proteins from neuronal and other soft tissues types. The buffer extracts the phosphoproteins in a native state without the use of harsh detergents or oxidizers, and it is specially formulated to help maintain phosphoproteins and protect them from degradation better than traditional detergent based extraction buffers.
Product Type:
Buffer & Reagent
Format:
Powder
Applications:
IP,WB
Application Details:
Please download the protocol below for detailed instructions on how to use Phospho-Sure in neuronal and other soft tissues.
Alternative Names:
Phospho-sure
Biosensis Brand:
Phospho-Sure RTD
Shelf Life:
Powdered format can be stored up to 12 months after purchase under cool, dry conditions.
Use:
For research use only.
Product references:
1. Suneja SK, Mo Z, Potashner SJ. (2006) Phospho-CREB and other phospho-proteins: improved recovery from brain tissue. J Neurosci Methods. 2006 Jan 30;150(2):238-41. 2. Elvira Mass, Dagmar Wachten, Anna C. Aschenbrenner, Andre Voelzmann, Michael Hochemail (2014) Murine Creld1 Controls Cardiac Development through Activation of Calcineurin/NFATc1 Signaling, Developmental Cell Volume 28, Issue 6, p711-726
Storage:
The dry, unopened container should be stored at room temperature in a dry or desiccated location protected from light. Do not store in the refrigerator unless material is in a dry, moisture free environment. Material is hydroscopic so once the seal is broken it should be hydrated and not resealed while dry. Once hydrated, the buffer can be stored at 2-8°C for up to 3 months. Solution can be frozen but clumping may occur upon thawing and is not recommended.
Detergents typically present in cell lysis buffers are thought to disrupt organelles and compartments and increase the exposure of soluble phospho-proteins to phosphatases and proteases thereby resulting in uncontrolled dephosphorylation and proteolysis. Phospho-Sure RTD Neuronal extraction buffer is optimized for the extraction of phosphorylated proteins from neuronal and other soft tissues types. The buffer extracts the phosphoproteins in a native state without the use of harsh detergents or oxidizers, and it is specially formulated to help maintain phosphoproteins and protect them from degradation better than traditional detergent based extraction buffers.
Product Type:
Buffer & Reagent
Format:
Powder
Applications:
IP,WB
Application Details:
Please download the protocol below for detailed instructions on how to use Phospho-Sure in neuronal and other soft tissues.
Alternative Names:
Phospho-sure
Biosensis Brand:
Phospho-Sure RTD
Shelf Life:
Powdered format can be stored up to 12 months after purchase under cool, dry conditions.
Use:
For research use only.
Product references:
1. Suneja SK, Mo Z, Potashner SJ. (2006) Phospho-CREB and other phospho-proteins: improved recovery from brain tissue. J Neurosci Methods. 2006 Jan 30;150(2):238-41. 2. Elvira Mass, Dagmar Wachten, Anna C. Aschenbrenner, Andre Voelzmann, Michael Hochemail (2014) Murine Creld1 Controls Cardiac Development through Activation of Calcineurin/NFATc1 Signaling, Developmental Cell Volume 28, Issue 6, p711-726
Storage:
The dry, unopened container should be stored at room temperature in a dry or desiccated location protected from light. Do not store in the refrigerator unless material is in a dry, moisture free environment. Material is hydroscopic so once the seal is broken it should be hydrated and not resealed while dry. Once hydrated, the buffer can be stored at 2-8°C for up to 3 months. Solution can be frozen but clumping may occur upon thawing and is not recommended.
Phosphoglucose isomerase, is a cytoplasmic enzyme, which catalyses the conversion of glucose-6-phosphate to fructose-6-phosphate, the second step in glycolysis, and the reverse reaction during gluconeogenesis. Alternative names: GPI , Phosphoglucose isomerase, PGI Phosphohexose isomerase, PHI
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Saccharomyces cerevisiae
Expected Species:
Species of your interest not listed? Contact us
Immunogen:
Phosphoglucose isomerase isolated and purified from Saccharomyces cerevisiae, UniProt: P12709
Applications:
Dot blot (Dot), ELISA (ELISA), Indirect immunofluorescence (indirect IF), Western blot (WB)
Phosphoglucose isomerase, is a cytoplasmic enzyme, which catalyses the conversion of glucose-6-phosphate to fructose-6-phosphate, the second step in glycolysis, and the reverse reaction during gluconeogenesis. Alternative names: GPI , Phosphoglucose isomerase, PGI Phosphohexose isomerase, PHI
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Saccharomyces cerevisiae
Expected Species:
Species of your interest not listed? Contact us
Immunogen:
Phosphoglucose isomerase isolated and purified from Saccharomyces cerevisiae, UniProt: P12709
Applications:
Dot blot (Dot), ELISA (ELISA), Indirect immunofluorescence (indirect IF), Western blot (WB)
Rabbit anti-Phospho-calcium/calmodulin-dependent protein kinase type II subunit alpha, Thr253 (alpha-CaMKII, Thr253) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Calcium/calmodulin-stimulated protein kinase II (CaMKII) is composed of four different chains (alpha, beta, gamma, and delta) and is abundantly expressed in neurons. CaMKII is involved in regulating many aspects of neuronal function, including neurotransmitter synthesis and release, modulation of ion channel activity and cellular transport. The enzymatic function of CaMKII is regulated by its multiple phosphorylation sites and targeting to sub-cellular locations through interactions with protein binding partners. Phosphorylation of Thr253 has been identified in vivo and found to alter the interaction of CaMKII with binding partners, but not change its enzymatic activity. Thus, phosphorylation of Thr253 is suggested to modulate functional responses based on its binding partner and subsequently its sub-cellular localization.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Rat
Immunogen:
A synthetic peptide (NKmLpTINPSC) corresponding to the sequence around Thr253 (AA 249-257) in alpha-CaMKII was synthesized, purified to 95% purity by HPLC, analyzed by mass spectroscopy and coupled to diphtheria toxoid.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (1:200 - 1:1000). Other applications have not been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Skelding KA et al (2012) J J Cereb Blood Flow Metab 32 (12), 2181-2192. Skelding KA et al (2010) Cell Signal 22 (5), 759-769. Gurd JW et al (2008) Brain Res 1218, 158-165. Migues PV et al (2006) J Neurochem 98 (1), 289-299.
Specificity:
Rat Predicted from gene analysis to react with human and mouse alpha-CaMKII.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
Phospho-calcium/calmodulin-dependent protein kinase type II subunit alpha, Thr253 (alpha-CaMKII, Thr253)
Protein belongs to DNA photolyases and functions in DNA repair.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana DNA photolyase, UniProt: F4JSJ6, TAIR: AT4G25290, loacted in the N-terminal part of the protein
Protein belongs to DNA photolyases and functions in DNA repair.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Lyophilized antibody can be stored at -20 °C for up to 3 years. Re-constituted antibody can be stored at 4°Cfor several days to weeks. Once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Mucuna pruriens (A0A371HBY0), Noccaea caerulescens (A0A1J3JTQ8) Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana DNA photolyase, UniProt: F4JSJ6, TAIR: AT4G25290, located towards C-terminal part of this protein
PGRL1 is a transmembrane protein present in thylakoids of higher plants and algae. Arabidopsis plants lacking PGRL1 show perturbation of cyclic electron transport (CEF) around photosystem I (PSI), similar to PGR5-deficient plants. PGRL1 has been shown to interact physically with PGR5 and associate with PSI (DalCorso et al., 2008). In Chlamydomonas reinhardtii, PGRL1 is part of a protein supercomplex, composed of PSI with its own light-harvesting complex (LHCI), the photosystem II light-harvesting complex (LHCII), the cytochrome b6/f complex (Cyt b6f), ferredoxin (Fd)-NADPH oxidoreductase (FNR), responsible of the energy balance of the two photosystems and of the switch between thylakoid linear and cyclic electron transport (Iwai et al., 2010). Synonymes: Ferredoxin-plastoquinone reductase 1
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Dichanthelium oligosanthes, Glycine soja, Gossypium arboreum, Klebsormidium nitens, Nelumbo nucifera, Noccaea caerulescens, Physcomitrium patens, Prunus dulcis, Prunus yedoensis, Rhizophora mucronatamm, Solanum chacoense, Trifolium medium, Zea mays, Vitis viniferaSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana PGRL1A UniProt: Q8H112, TAIR: At4g22890Peptide used to elicit this antibody is conserved in both isoforms PGRL1A and 1B of Zea mays
McKinnon et al. (2020). Membrane Chaperoning of a Thylakoid Protease Whose Structural Stability Is Modified by the Protonmotive Force. Plant Cell DOI: 10.1105/tpc.19.00797
PGR5 (Protn gradient regulation 5) is involved in the regulation of the cyclic electron flow (CEF) around Photosystem I and cellular response to light intensity and photoprotection. Essential for the reduction of PGRL1A by ferredoxin and for photoprotection.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
This product can be sold containing proclin if requested
Application Details:
1: 1000 - 1: 5000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
14,29 kDa
Not reactive in:
diatoms, Chlorella sp., cyanobacteria
Selected references:
Cao et al. (2022) Autophagic pathway contributes to low-nitrogen tolerance by optimizing nitrogen uptake and utilization in tomato. Hortic Res. 2022 Mar 23;9:uhac068. doi: 10.1093/hr/uhac068. PMID: 35669705; PMCID: PMC9164271.Ermakova et al. (2022) Enhanced abundance and activity of the chloroplast ATP synthase in rice through the overexpression of the AtpD subunit. J Exp Bot. 2022 Jul 29:erac320. doi: 10.1093/jxb/erac320. Epub ahead of print. PMID: 35904136.Urban, Rogowski & Romanowska (2022), Crucial role of the PTOX and CET pathways in optimizing ATP synthesis in mesophyll chloroplasts of C3 and C4 plants, Environmental and Experimental Botany, Volume 202, October 2022, 105024, https://doi.org/10.1016/j.envexpbot.2022.105026Yang et al. (2020). Two dominant boreal conifers use contrasting mechanisms to reactivate photosynthesis in the spring. Nat Commun. 2020 Jan 8;11(1):128. doi: 10.1038/s41467-019-13954-0.Rantala et al. (2020). PGR5 and NDH-1 systems do not function as protective electron acceptors but mitigate the consequences of PSI inhibition. Biochim Biophys Acta Bioenerg. 2020 Jan 11;1861(3):148154. doi: 10.1016/j.bbabio.2020.148154.
Phosphoglucomutase is an enzyme which participates in both the breakdown and synthesis of glucose.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Zea mays
Expected Species:
Arabidopsis thaliana, Glycine max, Triticum aestivum Species of your interest not listed? Contact us
Immunogen:
Recombinant phosphoglucomutase of Zea mays, UniProt: P93804
Immunoprecipitation was performed by using Dynabeads Protein A: briefly 100 l suspension was washed with 200 l TTBS (Tris Buffered saline, 50 mM Tris-HCl pH 7.6 and 165 mM NaCl with 0.1% Tween 80) using the magnetic stands for concentrating the magnetic beads. After wash the beads were preincubated with 20 l primary antibodies in 180 l TTBS at room temperature for 30 minutes (minimum 15 minues). A first wash was followed afterwards with 200 l TTBS and hence a real incubation with 200 l plant extract (supernatant 20,000 x g for 3 min.), 200 l of TTBS and further 50 l YeastBuster reagent (Novagen) containing a mixture of detergents to break and solubilize the mitochondria membrane. This incubation at room temperature was allowed to be under mild shaking to allow the beads to be in suspension. Hence supernatant was aspirated away by the use of the magnetic stand and two further washesing steps with 200 l TTBS were performed prior mixing with 100 l SDS-Sample buffer.Antibody is recognizing recombinant PGM1, overexpressed in E.coli.
Plastoglobules are lipoprotein particles which can be found in chloroplasts. They are generally believed to have a function of lipid storage. Recent data suggest that plastoglobules can be also metabolically active, taking part in tocopherol synthesis and likely other pathways. Immunogen: Alternative name AtPap1, fibrillin-1, probable plastid-lipid-associated protein 1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
(2021). Autophagy is required for lipid homeostasis during dark-induced senescence.Plant Physiology, 2021;, kiaa120Luo et al. (2015). Distinct carotenoid and flavonoid accumulation in a spontaneous mutant of Ponkan (Citrus reticulata Blanco) results in yellowish fruit and enhanced postharvest resistance. J Agric Food Chem. 2015 Sep 2.G mez-Arjona et al. (2014). Starch synthase 4 is located in the thylakoid membrane and interacts with plastoglobule-associated proteins in Arabidopsis. Plant J. 2014 Oct;80(2):305-16. doi: 10.1111/tpj.12633.
Special application note:
Cellular [compartment marker] of chloroplast plastoglobules.For IC samples were embedded in Lowicryl HM20 and sectioned into 100-nm-thick sections and placed on Formvar-coated gold slot grids. The sections were blocked for 20 min with a 5% (w/v) solution of nonfat milk in TBS plus 0.1%Tween 20 (TBST). Anti-PGL antibodies were diluted 1:20 in a solution of 2.5% nonfat milk in TBST at room temperature for 1 h. The sections were rinsed in a stream of TBS plus 0.5% Tween 20 and then transferred to the secondary antibody (anti-rabbit IgG 1:20 in TBST) conjugated to 10-nm gold particles for 1 h. images of localization can be found in Austin et al. (2006).
PGDH3 | Phosphoglycerate dehydrogenase 3 (chloroplastic) is an enzyme ((EC:1.1.1.95) involved in the plastidial phosphorylated pathway of serine biosynthesis (PPSB), step 1 of the subpathway that synthesizes L-serine from 3-phospho-D-glycerate. Expressed in aerial parts. Not detected in roots and meristematic tissue. Expressed in cotyledons, adult leaves, stigma and anther filaments.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Beside PGDH3 the antibody is recognizing in Arabidopsis thaliana PGDH1, UniProt: O49485-1 and PGDH2, UniProt: O04130-2
Application Details:
1 : 3000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l, of sterile water
Molecular Weight:
62,1 | 55-60 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
H hner et al. (2021) Stromal NADH supplied by PHOSPHOGLYCERATE DEHYDROGENASE3 is crucial for photosynthetic performance. Plant Physiology. 2021. kiaa117, https://doi.org/10.1093/plphys/kiaa117
UniProt number:
Q9LT69
TAIR number:
At3g19480
Research area:
Arabidopsis thaliana antibodies
Cookies:
X
We use cookies to help personalise and improve your web experience.
By using our website you consent to our use of cookies, some of which may have already been set on your device.
View our Cookie Policy to learn more.
