Chicken anti-Adiponectin Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Adiponectin is synthesized by adipocytes and is involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities (ref: SWISSPROT).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide from human Adiponectin (230-244 aa).
Applications:
WB
Antibody Isotype:
IgY
Application Details:
WB. Suggested dilution of 1:2,000-1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Adiponectin Receptors 1 and 2 are membrane receptors for adiponectin, a hormone secreted by adipocytes which regulates energy homeostatis and insulin sensitivity.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. 15% glycerol
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
The intracellular portion of mouse Adiponectin Receptor 1 protein (amino acids: 4-142) conjugated to GST.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting. A dilution of 1:2000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Adipor1; AdipoR1; Progestin and adipoQ receptor family member I; ADIPOR1; PAQR1;TESBP1A; CGI-45;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
References:
Mao X. et al (2006) APPL1 binds to adiponectin receptors and mediates adiponectin signalling and function http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=16622416'>Nat Cell Biol. 2006 May;8(5):516-23. Wang C. et al (2009) Yin-Yang regulation of adiponectin signaling by APPL isoforms in muscle cells http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=19661063'>J Biol Chem. 2009 Nov 13;284(46):31608-15.
Specificity:
This antiserum is known to recognise both mouse and human Adiponectin Receptor 1.
Adiponectin Receptors 1 and 2 are membrane receptors for adiponectin, a hormone secreted by adipocytes which regulates energy homeostatis and insulin sensitivity.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. 15% glycerol
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
Human Adiponectin Receptor 2 protein (amino acids: 78-219) conjugated to GST.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting. A dilution of 1:2000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Progestin and adipoQ receptor family member II; ADIPOR2; PAQR2;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
References:
Wang C. et al (2009) Yin-Yang regulation of adiponectin signaling by APPL isoforms in muscle cells http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=19661063'>J Biol Chem. 2009 Nov 13;284(46):31608-15.
Specificity:
This antiserum is known to recognise both mouse and human Adiponectin Receptor 2.
Rabbit anti-Adrenocorticotropic hormone (ACTH) Polyclonal Antibody (Unconjugated), suitable for IHC-Paraffin-embedded.
Background Info:
Adrenocorticotropic hormone (ACTH) is cleaved from the precursor pro-opiomelanocortin (POMC). The hormone is produced and secreted by the pituitary gland and stimulates release of cortisol by adrenal glands.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Pig,Rat
Immunogen:
Porcine Adrenocorticotropic hormone (ACTH) conjugated to BSA
Applications:
IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Corticotropin; ACTH; Pro-opiomelanocortin; POMC;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; rat; ACTH is highly conserved so cross-reactivity with other species is expected.
Rabbit anti-Apolipoprotein A-I (ApoA-I) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Apolipoprotein A-I is a major protein of high density lipoprotein (HDL). It is synthesized in the liver and small intestine and is found in plasma and chylomicrons.
A synthetic peptide (YVDVLKDSGRDYVSQFE) corresponding to a region (42-58 aa) from human Apolipoprotein A-I (APOA1).
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human APOA1 protein has a predicted length of 267 amino acids and MW of 31 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A synthetic peptide (ADDLNAQYERRRQEE) corresponding to a region (145-159 aa) from the C-terminus of human Bcl-2-binding component 3 (PUMA).
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human Bcl-2-binding component 3 (isoform 1) has a predicted length of 193 amino acids and MW of 21 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
p53 up-regulated modulator of apoptosis; BBC3; PUMA; FY-1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB against the antigen. Human; rat; predicted to react with mouse due to sequence homology;
Purification:
Affinity purified
Target:
Bcl-2-binding component 3
Accession Number:
Q9BXH1
Research Areas:
Antibodies & Conjugates/Signalling & Transcription,Antibodies & Conjugates/Apoptosis,Antibodies & Conjugates/Biosensis Cancer
Human beta-endorphin is a 31 amino acid peptide cleaved from the precursor pro-opiomelanocortin (POMC). It is an endogenous opioid peptide neurotransmitter that interacts with opioid receptors.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic human beta-endorphin peptide (1-31 aa) conjugated to BSA.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. For radioimmunoassay (RIA), a working dilution of 1:10,000 is recommended. Sensitivity - 120 pg/sample; IC50-1 ng/ sample. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
-endorphin; Pro-opiomelanocortin; POMC;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by RIA against the synthetic peptide. Human; mouse; rat. Beta-endorphin is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Met-enkephalin 0.03%; with Leu-enkephalin 0.02%; with beta-lipotropin 0.34%.
Human beta-Lipotropin is a 93 amino acid polypeptide that is cleaved from carboxy-terminal fragment of the precursor pro-opiomelanocortin (POMC). It stimulates melanocytes to produce melanin, and can also be cleaved into smaller peptides including opioid peptides: gamma-lipotropin, alpha-MSH, beta-MSH, gamma-MSH, alpha-endorphin, beta-endorphin, gamma-endorphin and met-enkephalin
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic peptide (179-267 aa) of human beta-Lipotropin conjugated to thyroglobulin was used as the immunogen.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human; mouse; rat. Beta-Lipotropin is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Leu-enkephalin 0.01%; with Met-Enkephalin 0.01%; with beta-endorphin 0.01%
Rabbit anti-Breast epithelial mucin Recombinant Antibody (Unconjugated), suitable for ELISA.
Background Info:
This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2 format, for improved compatibility with existing reagents, assays and techniques. This antibody binds to human BEM, a gel-forming extracellular protein that is frequently overexpressed in human breast cancer.
Product Type:
Antibody
Antibody Type:
Recombinant
Format:
Liquid. PBS with 0.02% Proclin 300.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Human breast epithelial mucin.
Applications:
ELISA
Clone number:
Mc5
Antibody Isotype:
IgG, kappa
Application Details:
This antibody binds to human BEM, a gel-forming extracellular protein that is frequently overexpressed in human breast cancer.
Alternative Names:
BEM
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
Store at 2-8?C for up to 3 months. For longer storage, aliquot and store at -20?C for up to 12 months.
Mouse anti-Cadherin-2 Monoclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
<div align="left"><div>Cadherin-2 or Neural Cadherin is a member of the cadherin family of proteins that mediate calcium ion-dependent cell adhesion. Other members include E-cadherin and P-cadherin. Cadherin-2 is expressed in the brain and skeletal and cardiac muscle. Cadherin-2 has been identified as a potential prognostic marker for a number of tumours.
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 2.0 µg/mL is recommended for WB. Human Cadherin-2 (precursor) has a predicted length of 906 residues and MW of 100 kDa. A concentration of 4.0 µg/mL is recommended for IHC to detect the protein in formalin/acetone fixed tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Cadherins are transmembrane glycoproteins that mediate calcium ion-dependent cell adhesion. The cadherin family includes N-, P-, R-, B- and E-cadherins which are found in adherens junctions.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized. Mouse ascites fluid, 1.2% sodium acetate, 2 mg BSA, with 0.01 mg NaN3 as preservative.
Host Animal:
Mouse
Species Reactivity:
Chicken,Human,Mouse,Rabbit,Rat,Snake
Immunogen:
A synthetic peptide corresponding to the C-terminal amino acids of chicken N-Cadherin with an extra N-terminal lysine residue (24 amino acids) coupled to KLH.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Clone number:
CH-19
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0-2.0 µg/mL is recommended for WB. Human N-Cadherin has a predicted length of 906 residues and MW of 100 kDa. A concentration of 2.0-4.0 µg/mL is recommended for IHC to detect the protein in paraffin embedded tissues. Antigen retrieval by heat is required. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rabbit anti-Cadherin-2 Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Cadherins are transmembrane glycoproteins that mediate calcium ion-dependent cell adhesion. The cadherin family includes N-, P-, R-, B- and E-cadherins which are found in adherens junctions.
A synthetic peptide (CQCDSNGDCTDVDR) corresponding to a region (701-714 aa) from human Cadherin-2.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Rat Cadherin-2 has a predicted length of 906 amino acids and MW of 100 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5) is a cell surface glycoprotein belonging to the immunoglobulin superfamily. CEACAM5 is found in adenocarcinomas of endodermally derived digestive system epithelia and in fetal colon.
Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5) isolated from human colon adenocarcinoma cell line
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Clone number:
CEA-9
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 0.5-1.0 µg/mL is recommended for WB. Human CEACAM (precursor) has a predicted length of 702 residues and MW of 77 kDa. A concentration of 0.5-2.0 µg/mL is recommended for IHC to detect the protein in formalin fixed and paraffin embedded tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rabbit anti-Caspase 6 (CASP-6) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Caspases play several key roles in cellular growth and development, extracellular matrix remodeling, wound healing, homeostasis, and are implicated in a wide range of diseases from auto immune dysfunction to cancer metastases as well. Caspases are Cysteine Aspartate Proteases which form a family of metalloproteinases of which there are more than a dozen members. Caspases are all normally expressed in cells as inactive precursor zymogens that then get activated via proteolytic cleavage to form active enzyme complexes. Activation can occur by several means and programmed cell death, or apoptosis, is among the most studied, but there are several others since caspases are involved in so many critical and disease states. Among the 14 or so members, Caspase-6 is particularly interesting because it has been implicated in playing a role in some neurodegenerative diseases including Alzheimer's and Huntington's disease. Caspase-6 has been shown to cut amyloid precursor protein (APP), at position 720 leading to the toxic fragment Jcasp, which is one of the fragments found in amyloid plaques which are believed to be an indicator of the disease, and in Huntington's disease, the specific amino acid sequence (IVLD586G) is recognized by Caspase-6 on the Huntington protein (htt) in mice with Huntington's disease. The proteolytic cleavage of htt liberates toxic fragments containing the expanded polyglutamine tract that are neurotoxic and that stimulates additional proteolytic activity leading to apoptosis and neurodegeneration. Mutation of the Caspase-6 site in mice model with Alzheimer's and Huntington's disease provides protection from the neural dysfunction, suggesting a causal relationship between Caspase-6 cleavage and neurodegeneration. Biosensis is pleased to offer a rabbit polyclonal antibody to human Caspase 6 that reacts in paraffin embedded immunohistochemistry and western blotting for your continued research into Caspase 6 and its potential roles in both normal and pathological conditions.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Freeze-dried powder from liquid containing PBS, 5 mg BSA, 0.05 mg Thimerosal and 0.05 mg sodium azide.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide corresponding to an amino acid sequence at the N-terminal of human Caspase 6 comprising amino acids 24-44 of human Caspase 6
Human Caspase 6 protein, no reactivity to other human caspases Potential reactivity to mouse Caspase 6 based upon sequence homology but as yet untested.
Rabbit anti-CD34 Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
CD34 is a possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells (Ref: SWISSPROT).
A synthetic peptide corresponding to a region (366-382 aa) from human CD34.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunohistochemistry (IHC). A concentration of 1.0 µg/mL is recommended for WB. Human CD34 (Isoform CD34-F) has a predicted length of 385 amino acids and MW of 40 kDa. A concentration of 1.0 µg/mL is recommended for IHC to detect the protein in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is required. A concentration of 1.0 µg/mL is also recommended for IHC in frozen tissue. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Hematopoietic progenitor cell antigen CD34;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human; rat; mouse;
Rabbit anti-CD82 Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
CD82 is a multi-pass membrane protein belonging to the tetraspanin (TM4SF) family. Expression of CD82 has been shown to be downregulated in tumor progression of human cancers and can be activated by p53 through a consensus binding sequence in the promoter (Ref: Entrez Gene).
A synthetic peptide (CRHVHSEDYSKVPKY) corresponding to a region (253-267) at the C-terminus of human CD82.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human CD82 has a predicted length of 267 amino acids and MW of 30 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
p53 is a DNA-binding protein containing transcription activation, DNA-binding and oligomerization domains. p53 is ubiquitously expressed and responds to a variety of cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair or changes in metabolism. Multiple p53 variants are produced from alternative promoters and alternative splicing.
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 0.5-1.0 µg/mL is recommended for WB. Human p53 (isoform 1) has a predicted length of 393 residues and MW of 44 kDa. A concentration of 0.5-2.0 µg/mL is recommended to detect p53 in formalin fixed and paraffin embedded tissues as well as formalin/acetone fixed frozen tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rabbit anti-Checkpoint homolog CHK2 Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Checkpoint homolog CHK2 is an important cell cycle checkpoint regulator. The protein is rapidly activated by phosphorylation in response to DNA damage and to replication block. When activated, CHK2 is known to prevent entry into mitosis and has been shown to regulate the tumor suppressor protein p53, leading to cell cycle arrest in G1. At least 12 isoforms are produced by alternative splicing.
A synthetic peptide (FSEHRTQVSLKDQIT) corresponding to a region (427-441) from human Checkpoint homolog CHK2. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 0.75 µg/mL is recommended for WB. Human Checkpoint homolog CHK2 (isoform 1) has a predicted length of 543 residues and MW of 61 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Collagen IV is a major constituent of the glomerular basement membranes. It is a heterotrimeric protein composed of 3 alpha subunits encoded by 6 different genes; alpha 1(IV) through alpha 6(IV).
Immunohistochemistry (IHC). A concentration of 0.5-1.0 µg/mL is recommended to detect Collagen IV in formalin fixed and paraffin embedded tissues as well as formalin/acetone fixed frozen tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Mouse anti-Cyclin-A2 Monoclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Cyclin-A2 (CCNA2) is a member of the Cyclin family which act as regulators of CDK kinases. CCNA2 is essential for the control of the cell cycle at the G1/S (start) and the G2/M (mitosis) transitions.
Western Blotting (WB). A concentration of 0.5-1.0 µg/mL is recommended for WB. Human Cyclin-A2 has a predicted length of 432 residues and MW of 49 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
CCNA2; CCN1; CCNA; Cyclin A;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB against the antigen. Human; mouse;
Cyclin-dependent kinase 1, also known as cell division control protein 2 homolog ( CDC2), belongs to the Ser/Thr protein kinase family. CDC2 is required for entry into S phase of the cell cycle and mitosis. Multiple alternatively spliced variants have been reported for this gene.
A C-terminal fragment of Xenopus Cyclin-dependent kinase 1 expressed in E. coli
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Clone number:
IMD-34
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 0.5-1.0 µg/mL is recommended for WB. Human CDC2 (isoform 1) has a predicted length of 297 residues and MW of 34 kDa. A concentration of 1.0-2.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues as well as formalin/acetone fixed frozen tissues.
Alternative Names:
Cell division control protein 2 homolog; p34 protein kinase; p34cdc2; CDK1; CDC2;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human; mouse; chicken;
Cyclin dependent kinases (CDK) contain an evolutionary conserved PSTAIR sequence (EGVPSTAIREISLLKE) which distinguishes them from other protein kinases.
Synthetic 16 amino acid oligopeptide containing the PSTAIR sequence (EGVPSTAIREISLLKE) conjugated to BSA
Applications:
WB
Clone number:
IL-16
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 0.25-0.50 µg/mL is recommended.
Alternative Names:
EGVPSTAIREISLLKE antibody; PSTAIRE;Cdkn2
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; The specificity of this antibody has been confirmed by WB against the antigen. The peptide used as the immunogen shows 100% sequence identity to CDC2 proteins across a wide variety of species including plants though most are untested directly.
Cyclin-dependent kinase 4 (CDK4) belongs to the Ser/Thr protein kinase family. CDK4 is a subunit of the protein kinase complex that is important for cell cycle G1 phase progression. Mutations in CDK4 have been implicated in tumor formation. Multiple alternatively spliced variants and polyadenylation sites have been reported for this gene.
Recombinant human Cyclin-dependent kinase 4 (CDK4)
Applications:
WB
Clone number:
IML-4
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 0.5-1.0 µg/mL is recommended for WB. Human CDK4 has a predicted length of 303 residues and MW of 34 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Cell division protein kinase 4; PSK-J3; CDK4;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB against the antigen. Human; mouse; rat;
Mouse anti-Cyclin-dependent kinase 4 inhibitor D (CDKN2D) Monoclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
Cyclin-dependent kinase 4 inhibitor D (CDKN2D) is a specific inhibitor of cyclin-dependent kinases CDK4 and CDK6. CDK4 is a subunit of the protein kinase complex that is important for cell cycle G1 phase progression.
Recombinant human Cyclin-dependent kinase 4 inhibitor D
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Clone number:
IMD-19
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 0.5-1.0 µg/mL is recommended for WB. Human CDKN2D has a predicted length of 166 residues and MW of 18 kDa. A concentration of 1.0-2.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
p19-INK4d; CDKN2D; p19INK4d;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human;
The Cyclin-dependent kinase inhibitor 2A (CDK2NA) gene encodes several transcripts which differ from each other in their first exons. In spite of the structural and functional differences of these transcripts, they are all involved in cell cycle G1 control. Isoform 1, also known as p16INK4A, acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6 kinases. This antibody reacts specifically with this isoform (p16INK4A).
Recombinant human Cyclin-dependent kinase inhibitor 2A
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Clone number:
IMD-16
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 0.5-1.0 µg/mL is recommended for WB. Human CDK2NA (isoform 1, p16INK4A) has a predicted length of 156 residues and MW of 17 kDa. A concentration of 1.0-2.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rabbit anti-Cytochrome c oxidase subunit 1 Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. CO1 is one of 3 subunits that form the core of this complex and is the catalytic subunit (Ref: SWISSPROT).
A synthetic peptide (FADRWLFSTNHKD) corresponding to a region (2-14 aa) from the N-terminus of human Cytochrome c oxidase subunit 1 (CO1).
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human CO1 has a predicted length of 513 amino acids and MW of 57 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Cytochrome c oxidase polypeptide I; MT-CO1; COI; COXI; MTCO1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB against the antigen. Human;
Purification:
Affinity purified
Target:
Cytochrome c oxidase subunit 1
Accession Number:
P00395
Research Areas:
Antibodies & Conjugates/Antioxidant Enzymes,Antibodies & Conjugates/Biosensis Cancer
Cytokeratin 18 is an acidic type I keratin and a member of intermediate filament family of proteins. Cytokeratin 18 typically forms a heterotetramer with Cytokeratin 8 to form an intermediate filament in simple single-layered epithelial cells. Cytokeratin 18 is expressed primarily in non squamous epithelia and is present in a majority of adenocarcinomas and ductal carcinomas.
Human epidermal carcinoma A431 and MCF7 human breast cancer cell lines
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Clone number:
CK-18
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 0.5-1.0 µg/mL is recommended for WB. Human Cytokeratin 18 has a predicted length of 430 amino acids and MW of 48 kDa. A concentration of 1.0-2.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues. A concentration of 0.5-2.0 µg/mL is recommended to detect the protein in formalin/acetone fixed tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Keratin; type I cytoskeletal 18; Cytokeratin-18; CK-18; Keratin-18; K18; Cell proliferation-inducing gene 46 protein; KRT18; CYK18; PIG46;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human; rat;
Purification:
IgG
Target:
Cytokeratin 18 (CK-18)
Accession Number:
P05783
Research Areas:
Antibodies & Conjugates/Signalling & Transcription,Antibodies & Conjugates/Biosensis Cancer
Cytokeratins belong to the intermediate filament family of proteins and are classified according to their type. Type I Cytokeratins are low molecular weight and acidic whereas Type II Cytokeratins are higher weight and basic to neutral. This antibody specifically detects type II Cytokeratins 1, 5, 6, and 8. Expression of these Cytokeratins is frequently tissue specific.
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 0.5-1.0 µg/mL is recommended for WB. Human Cytokeratin 1 has a predicted length of 644 amino acids and MW of 66 kDa. A concentration of 1.0-2.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues as well as formalin/acetone fixed tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Cytokeratins belong to the intermediate filament family of proteins and are classified according to their type. Type I Cytokeratins are low molecular weight and acidic whereas Type II Cytokeratins are higher weight and basic to neutral. This antibody broadly detects Cytokeratins 1, 4, 5, 6, 8, 10, 13, 18 and 19. Expression of these Cytokeratins is frequently tissue specific.
The antigen is a mixture of clones C-11, PCK-26, CY-90, KS-1A3, M20 and A53-B/A2. This antibody detects human Cytokeratins 1, 4, 5, 6, 8, 10, 13, 18 and 19.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Clone number:
IML-91
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0-2.0 µg/mL is recommended for WB. Human Cytokeratin 1 has a predicted length of 644 amino acids and MW of 66 kDa. A concentration of 2.0-5.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues as well as formalin/acetone fixed tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Cytokeratin 7 is a type II keratin and a member of intermediate filament family of proteins. Cytokeratin 7 is expressed in cultured epidermal, bronchial and mesothelial cells.
Cytoskeletal preparation of the RT4 human bladder carcinoma cell line
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Clone number:
CK-7
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0-2.0 µg/mL is recommended for WB. Human Cytokeratin 7 has a predicted length of 469 amino acids and MW of 51 kDa. A concentration of 2.0-4.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues as well as formalin/acetone fixed tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Keratin; type II cytoskeletal 7; Cytokeratin-7; CK-7; Keratin-7; K7; Sarcolectin; KRT7; SCL; CK7; K2C7; MGC3625; MGC129731;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human;
Purification:
IgG
Target:
Cytokeratin 7 (CK-7)
Accession Number:
P08729
Research Areas:
Antibodies & Conjugates/Signalling & Transcription,Antibodies & Conjugates/Biosensis Cancer
Mouse anti-Desmin Monoclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
Desmin are class-III intermediate filaments expressed in smooth, cardiac and heart muscles. Desmin homopolymers form a stable fibrous network connecting myofibrils to each other and to the plasma membrane.
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 2.0 µg/mL is recommended for WB. Human Desmin has a predicted length of 470 residues and MW of 54 kDa. A concentration of 2.0-4.0 µg/mL is recommended to detect Desmin in formalin fixed and paraffin embedded tissues. Heat retrieval is necessary. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
DES; Desmin; CSM1; CSM2; CMD1I;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human; mouse; rat;
DNA replication licensing factor MCM7 belongs to the MCM family of proteins. MCM7 is required for G1/S phase transition. It ensures the correct assembly of replication forks on chromosomal DNA and that the genome is replicated only once at each cell cycle. Overexpression of MCM7 has been found in human gastric tumors. At least 2 isoforms are produced by alternative splicing.
Recombinant human DNA replication licensing factor MCM7
Applications:
WB
Clone number:
M3
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 0.5-1.0 µg/mL is recommended for WB. Human MCM7 (isoform 1 precursor) has a predicted length of 719 residues and MW of 81 kDa.
Alternative Names:
CDC47 homolog; MCM7; CDC47; MCM2;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB against the antigen. Human;
Rabbit anti-DNA topoisomerase 2-alpha Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
DNA topoisomerase 2 catalyzes the transient breaking and rejoining of double stranded DNA during events such as DNA synthesis and transcription. Two forms of this enzyme exist, alpha and beta. DNA topoisomerase 2 alpha (TOP2A) is localized to chromosome 17 and the beta gene is localized to chromosome 3. At least 4 isoforms of TOP2A are produced by alternate splicing.
A synthetic peptide (RKPSTSDDSDSNFEK) corresponding to a region (1466-1480) from human DNA topoisomerase 2-alpha. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0-2.0 µg/mL is recommended for WB. Human TOP2A (isoform 1) has a predicted length of 1,531 residues and MW of 174 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
EC 5.99.1.3; DNA topoisomerase II; alpha isozyme; TOP2A; TOP2;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB against the antigen. Human; rat;
Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin type-B receptor 2 is a receptor for members of the ephrin-B family and it acts as a tumor suppressor. It is a single-pass type I membrane protein that is expressed in brain, heart, lung, kidney, placenta, pancreas, liver and skeletal muscle. It is preferentially expressedd in fetal brain. Defects in this protein are involved in the development of prostate cancer metastasis to the brain.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS pH 7.2
Host Animal:
Mouse
Species Reactivity:
Human,Mouse
Immunogen:
Partial recombinant protein of human Ephrin type-B receptor 2 (aa 226 to 325) with a GST tag.
Applications:
ELISA,WB
Clone number:
4D1
Antibody Isotype:
IgG
Application Details:
This antibody is recommended for WB, and ELISA. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Epidermal Growth Factor (EGF) Receptor binds to EGF and other members of the EGF family such as TGF-alpha, amphiregulin, betacellulin, heparin-binding EGF-like growth factor, GP30 and vaccinia virus growth factor. At least 4 isoforms are produced by alternative splicing (reference SWISSPROT). The EGF receptor is a single-pass type I membrane protein containing an extracellular receptor domain, a transmembrane region and an intracellular domain with tyrosine kinase function
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
E.coli-derived human EGFR recombinant protein (Position: L25-K346). Human EGFR shares 89% amino acid (aa) sequence identity with mouse EGFR.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blot (0.1-0.5 µg/mL): tested on human and rat cell lines. Other applications not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Fatty acid-binding protein, adipocyte (ALBP) is a lipid transport protein which binds long chain fatty acids and other hydrophobic ligands and delivers them to their receptors in the nucleus. ALBP is found in the cytoplasm and nucleus of adipocytes.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human
Immunogen:
Human Fatty acid-binding protein, adipocyte peptide (97-111 aa).
Applications:
WB
Antibody Isotype:
IgY
Application Details:
WB. Suggested dilution of 1:2,000-1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Fatty acid-binding protein, adipocyte (ALBP) is a lipid transport protein which binds long chain fatty acids and other hydrophobic ligands and delivers them to their receptors in the nucleus. ALBP is found in the cytoplasm and nucleus of adipocytes.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Mixture of two human Fatty acid-binding protein, adipocyte peptide peptides (71-82 aa, 97-111 aa).
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
WB and ELISA. Suggested dilution of 1:1,000-1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
G1/S-specific cyclin-D1 (CCND1) is a member of the Cyclin family which act as regulators of CDK kinases. CCND1 is essential for the control of the cell cycle at the G1/S (start) transition.
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 4.0 µg/mL is recommended for WB. Human G1/S-specific cyclin-D1 has a predicted length of 295 residues and MW of 34 kDa. A concentration of 8.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues as well as formalin/acetone fixed frozen tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
PRAD1; BCL-1 oncogene; CCND1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human; mouse; rat;
Mouse anti-G1/S-specific cyclin-D2 Monoclonal Antibody (Unconjugated), suitable for WB.
Background Info:
G1/S-specific cyclin-D2 (CCND2) is a member of the Cyclin family which act as regulators of CDK kinases. CCND2 is essential for the control of the cell cycle at the G1/S transition.
Western Blotting (WB). A concentration of 2.0-4.0 µg/mL is recommended for WB. Human G1/S-specific cyclin-D2 has a predicted length of 289 residues and MW of 33 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
CCND2;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB against the antigen. Human; mouse;
Rabbit anti-Gastrin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded, ICC.
Background Info:
Human Gastrin is a 101 amino acid hormone produced by G cells of the duodenum, stomach and pancreas. It stimulates secretion of hydrochloric acid by parietal cells of the stomach. Gastrin is also secreted into bloodstream.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic human Gastrin peptide (76-85 aa) conjugated to BSA.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Glutathione peroxidase 1 has a role in detoxification of hydrogen peroxide and is one of the most important antioxidant enzymes in humans. It exists as a homotetramer which localises to the cytoplasm. It belongs to the glutathione peroxidase family. Glutathione peroxidase 1 is one of few proteins in higher vertebrates to contain selenocysteine, which occurs at the active site of glutathione peroxidase and is coded by UGA, that normally functions as a translation termination codon. This protein has a polyalanine sequence polymorphism in the N-terminal region, which includes three alleles with five, six or seven alanine repeats. The allele with five alanine repeats is significantly associated with breast cancer risk. At least two alternatively spliced isoforms have been identified.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (RRYSRRFQTIDIEPDIEALL) corresponding to the amino acids 175-194 of human glutathione peroxidase 1 ( GPx-1) conjugated to diphtheria toxin has been used as the immunogen.
Applications:
ELISA,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB and ELISA. This antibody works superbly in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine IHC are 1: 200 to 1: 1,000 depending on tissue and detection method. For WB a dilution range of 1: 1,000 to 1: 4,000 is recommended. For ELISA, a dilution of 1: 1,000 to 1: 4,000 is recommended. This antiserum has extremely high titre, it stains human and rat glial cells intensely and to some extent also stains neurons. Other tissues have not yet been tested. On WB under reducing conditions recognises a 22kD protein in human brain tissue and Sigma glutathione peroxidase (G-4013) isolated from human erythrocytes. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Glutathione peroxidase 4 (GPx-4) is involved in protecting cells against membrane lipid peroxidation and cell death.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (VNYTQLVDLHARYAEC) corresponding to the amino acids 78-93 of human glutathione peroxidase 4 (Isoform Mitochondrial) conjugated to KLH has been used as the immunogen. Human, rat and mouse sequences are identical.
Applications:
IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
WB, IHC. Typical working dilution for IHC is 1:200 to 1:1,000 depending on tissue and detection method. For WB, a dilution range of 1:1,000 to 1:2,000 is recommended. GPx-4 exists as a tetramer and can reform into multimeric complexes even under reduced conditions. The reported molecular weight of the GPx-4 monomer is 22 kDa but is reported to rapidly form oligomers, thus higher molecular weight bands greater than 22 kDa are expected. Mitochondrial preparations are also recommended to enhance signal. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rabbit anti-Glutathione S-transferase pi (GST class-pi) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Glutathione S transferases (GSTs) are a large family of enzymes which catalyse the conjugation of reduced glutathione to electrophilic substrates. Glutathione S-transferase pi is one of four major types of mammalian GSTs.
A synthetic peptide corresponding to a region (197-210) from the C-terminus of human glutathione S-transferase pi. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 0.1-0.5 µg/mL is recommended for WB. Human glutathione S-transferase pi has a predicted length of 210 residues and MW of 23 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
GSTP1; FAEES3; GST3; GST class-pi; GSTP1-1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB (Human, mouse) against the antigen. Human; mouse;
Purification:
Affinity purified on antigen column
Target:
Glutathione S-transferase pi (GST class-pi)
Accession Number:
P09211
Research Areas:
Antibodies & Conjugates/Antioxidant Enzymes,Antibodies & Conjugates/Biosensis Cancer
Glyceraldehyde 3-Phosphate Dehydrogenase (GAPDH) is a metabolic enzyme responsible for catalyzing one step in the glycolytic pathway, the reversible oxidative phosphorylation of glyceraldehyde 3-phosphate. GAPDH may have other roles in the activation of transcription and in the regulation of apoptosis as well as Alzheimer's disease and Huntington's disease. The immunogen used to raise this particular antibody was extensively purified pig GAPDH. This antibody can be used as a loading control for western blotting experiments, allowing comparison between the level of this protein and others in a cell or tissue.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized with 5% trehalose
Host Animal:
Mouse
Species Reactivity:
Bovine,Chicken,Human,Mouse,Pig,Rat
Immunogen:
Purified pig GAPDH
Applications:
ICC,IHC-Frozen,WB
Clone number:
1D4
Antibody Isotype:
IgM
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:1,000 is recommended for WB. Human GAPDH has a predicted length of 335 residues and a MW of 36 kDa. A dilution of 1:100 is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Chicken anti-G-Protein B3 (Rho) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
G-Protein b3 (GNB3) is a guanine nucleotide-binding protein (G protein). G-proteins are involved as a modulator or transducer in various transmembrane signaling systems (Ref: SWISSPROT).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Human GNB3 peptide (216-230 aa)
Applications:
WB
Antibody Isotype:
IgY
Application Details:
WB. Suggested dilution at 1:1,000 to 1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Rabbit anti-Heat Shock 70 kDa Protein 1 (HSP70-1) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
Heat Shock 70 kDa protein 1 belongs to the Heat Shock protein 70 family. This chaperone protein is expressed in response to heat shock and stabilizes existing proteins against aggregation as well as mediating the folding of newly translated proteins.
A synthetic peptide (RGVPQIEVTFDIDANGILN) corresponding to a region (469-487) from human Heat Shock 70 kDa Protein 1. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human Heat Shock 70 kDa Protein 1 has a predicted length of 641 residues and MW of 70 kDa. A concentration of 1.0-2.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is required. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Mouse anti-Heat shock 70 kDa protein 1 (HSP70.1) Monoclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
Heat Shock protein 70 is a chaperone protein expressed in response to heat shock. The protein stabilizes existing proteins against aggregation as well as mediating the folding of newly translated proteins.
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 0.5 µg/mL is recommended for WB. Bovine Heat Shock protein 70 has a predicted length of 641 residues and MW of 70 kDa. A concentration of 0.5-1.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues as well as formalin/acetone fixed tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Partially purified inhibitor of actin polymerization (IAP) protein from Turkey Gizzard smooth muscle
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Clone number:
SJ-25
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 0.5-2.0 µg/mL is recommended for WB. Chicken HSP25 has a predicted length of 172 residues and MW of 19 kDa. A concentration of 1.0-2.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is required. A concentration of 1.0-2.0 µg/mL is recommended to detect HSP25 in formalin/acetone fixed frozen tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Heat shock 25 kDa protein 1; HSP25;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human;
Purification:
IgG
Target:
Heat shock protein 25 (HSP-25)
Accession Number:
Q6BDR9
Research Areas:
Antibodies & Conjugates/Biosensis Stem Cells,Antibodies & Conjugates/Biosensis Cancer
Chicken anti-Hormone-sensitive lipase (HSL) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Hormone Sensitive Lipase (HSL) hydrolyzes stored triglycerides to free fatty acids in adipose tissue and heart. In steroidogenic tissues, HSL principally converts cholesteryl esters to free cholesterol for steroid hormone production (ref: SWISSPROT).
Chicken anti-Hormone-sensitive lipase (HSL) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Hormone Sensitive Lipase (HSL) hydrolyzes stored triglycerides to free fatty acids in adipose tissue and heart. In steroidogenic tissues, HSL principally converts cholesteryl esters to free cholesterol for steroid hormone production (ref: SWISSPROT).
WB. Suggested dilution at 1:1,000 to 1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
HSL; LIPE; Hormone-sensitive lipase; Lipe;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody detects HSL at approx 83 kDa in various fat cell lysates from mouse and rat. Additional weaker band may appear at approx 40 kDa (unknown). Mouse, Rat, Human
Functions as a master transcriptional regulator of the adaptive response to hypoxia. Under hypoxic conditions, activates the transcription of over 40 genes, including erythropoietin, glucose transporters, glycolytic enzymes, vascular endothelial growth factor, HILPDA, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. Plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Heterodimerizes with ARNT; heterodimer binds to core DNA sequence 5'-TACGTG-3' within the hypoxia response element (HRE) of target gene promoters (By similarity). Activation requires recruitment of transcriptional coactivators such as CREBBP and EP300. Activity is enhanced by interaction with both, NCOA1 or NCOA2. Interaction with redox regulatory protein APEX seems to activate CTAD and potentiates activation by NCOA1 and CREBBP. Involved in the axonal distribution and transport of mitochondria in neurons during hypoxia. Uniprot UniProtKB - Q16665 (HIF1A?HUMAN).
A synthetic peptide corresponding to a sequence at the N-terminus of human HIF-1-alpha (8-21aa NDKKKISSERRKEK), different from the related rat and mouse sequences by two amino acids.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB), IHC-P. A concentration of 0.1-0.5 µg/mL is recommended for WB. Human HIF-1 alpha (isoform 1) has a predicted length of 826 residues and a MW of 93 kDa. A concentration of 0.5-1.0 µg/mL is recommended to detect HIF1A in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is required by boiling the formalin/paraffin sections in 10mM citrate buffer, pH6.0 for 20 mins. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
HIF-1 alpha; HIF1 alpha; ARNT-interacting protein; Member of PAS protein 1; Basic-helix-loop-helix-PAS protein MOP1; HIF1A; MOP1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB against the antigen. Human; rat
Transcription factor involved in the induction of oxygen regulated genes. Binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. Regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. May also play a role in the formation of the endothelium that gives rise to the blood brain barrier. Potent activator of the Tie-2 tyrosine kinase expression. Activation seems to require recruitment of transcriptional coactivators such as CREBBP and probably EP300. Interaction with redox regulatory protein APEX seems to activate CTAD (Reference: uniprot.org).
A synthetic peptide (HALDSENMTKSHQNLCTKG) corresponding to a peptide sequence in the middle region (282-301) from human Hypoxia-inducible factor-2 alpha. This sequence is identical to rat and mouse HIF2A.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 0.1-0.5 µg/mL is recommended for WB. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Endothelial PAS domain-containing protein 1; EPAS-1; Hypoxia-inducible factor 2 alpha; HIF-2 alpha; HIF2 alpha; Epas1; Hif2a;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Detects HIF2A by Western Blotting in tissue homogenates. Rat. Expected to react with mouse HIF2A due to immunogen sequence homology.
Hypoxia-inducible factor-2 alpha (HIF-2 alpha) is a transcription factor involved in the induction of oxygen regulated genes. HIF-2 alpha binds to a specific core DNA sequence within the hypoxia response element of target gene promoters.
A synthetic peptide (YNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD) corresponding to a region (202-240) from rat Hypoxia-inducible factor-2 alpha. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Rat HIF-2 alpha has a predicted length of 874 residues and MW of 97 kDa. A concentration of 0.5-1.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues as well as formalin/acetone fixed frozen tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Endothelial PAS domain-containing protein 1; EPAS-1; Hypoxia-inducible factor 2 alpha; HIF-2 alpha; HIF2 alpha; Epas1; Hif2a;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Rat
Rabbit anti-Interferon-induced transmembrane protein 1 Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
Interferon-induced transmembrane protein 1 (IFITM1) is a multi-pass membrane family belonging to the CD225 family. IFITM1 is induced by alpha and gamma interferons.
A synthetic peptide (HKEEHEVAVLGAPPST) corresponding to a region (2-17) from human Interferon-induced transmembrane protein 1. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human IFITM1 has a predicted length of 125 residues and MW of 14 kDa. A concentration of 0.5-1.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues. Antigen retrieval is required. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Interferon-inducible protein 9-27; Interferon-induced protein 17; Leu-13 antigen; CD225 antigen; IFITM1; CD225; IFI17;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human;
Rabbit anti-Interleukin 10 (IL-10) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Interleukin 10 inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells (Ref: SWISSPROT).
A synthetic peptide corresponding to a region (46-60 aa) from human Interleukin 10.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human Interleukin 10 (precursor) has a predicted length of 178 amino acids and MW of 21 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rabbit anti-Interleukin-18 (IL-18) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Interleukin-18 (IL-18) augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells (Ref: SWISSPROT).
A synthetic peptide corresponding to a region (175-193 aa) from human Interleukin-18 (IL-18).
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human IL-18 (precursor) has a predicted length of 193 amino acids and MW of 22 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Interleukin-1 beta (IL-1 beta) belongs to the IL-1 family. IL-1 is produced by activated macrophages and stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity (Ref: SWISSPROT).
A synthetic peptide corresponding to a region (249-269 aa) from human Interleukin-1 beta.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human IL-1 beta (precursor) has a predicted length of 269 amino acids and MW of 31 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Interleukin 6 (IL-6) is a cytokine with many biological functions. Some of its roles include the final differentiation of B-cells into Ig-secreting cells, induction of meloma and plasmacytoma growth, induction of nerve cell differentiation, and in hepatocytes, induction of acute phase reactants. IL-6 is secreted and is N- and O-glycosylated post translationally. Genetic variations in IL-6 can be correlated with bone mineral density and low bone mineral density is a risk factor for osteoporosis. Defects in IL-6 are associated with juvenile rheumatoid arthritis and at least one polymorphism in IL-6 makes HIV-infected men susceptible to Kaposi sarcoma which is a relatively rare malignant tumour.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS pH 7.2
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant human IL-6 protein with GST tag.
Applications:
ELISA,WB
Clone number:
3.00E+04
Antibody Isotype:
IgG
Application Details:
This antibody is recommended for WB and ELISA. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Interleukin 8 (IL-8) is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus (Ref: SWISSPROT).
A synthetic peptide corresponding to a region (77-95 aa) from human Interleukin 8.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunohistochemistry (IHC). A concentration of 1.0 µg/mL is recommended for WB. Human Interleukin 8 (Isoform 1) has a predicted length of 99 amino acids and MW of 11 kDa. A concentration of 1.0 µg/mL is recommended for IHC to detect the protein in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is required. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Mouse anti-Involucrin Monoclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
Involucrin is a major constituent of the crosslinked envelope of the keratinocyte. Involucrin is found in the keratinocytes of epidermis and other stratified squamous epithelia including the cornea.
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 2.0 µg/mL is recommended for WB. Human Involucrin has a predicted length of 585 amino acids and MW of 68 kDa. A concentration of 0.4-1.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues as well as formalin/acetone fixed tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
IVL;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human; dog; pig;
Chicken anti-Ki-67 Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly (PubMed:27362226). Associates with the surface of the mitotic chromosome, the perichromosomal layer, and covers a substantial fraction of the chromosome surface (PubMed:27362226). Prevents chromosomes from collapsing into a single chromatin mass by forming a steric and electrostatic charge barrier: the protein has a high net electrical charge and acts as a surfactant, dispersing chromosomes and enabling independent chromosome motility (PubMed:27362226). Binds DNA, with a preference for supercoiled DNA and AT-rich DNA (PubMed:10878551). Does not contribute to the internal structure of mitotic chromosomes (By similarity). May play a role in chromatin organization (PubMed:24867636). It is however unclear whether it plays a direct role in chromatin organization or whether it is an indirect consequence of its function in maintaining mitotic chromosomes dispersed (Probable). Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from a solution containing PBS buffer pH 7.2-7.6, without preservatives.
Host Animal:
Chicken
Species Reactivity:
Human
Immunogen:
Recombinant human Ki-67 protein (mixture of amino acids 1-300 and 1,111-1,490) expressed in and purified from E. coli.
Applications:
ICC,WB
Antibody Isotype:
IgY
Application Details:
Western blotting (1:2,000-1:5,000) and Immunocytochemistry (1:1,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Proliferation marker protein Ki-67; Antigen identified by monoclonal antibody Ki-67; Antigen KI-67; Antigen Ki67
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human, reacts with human only. Does not react with mouse or rat.
Mouse anti-Ki-67 Monoclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly (PubMed:27362226). Associates with the surface of the mitotic chromosome, the perichromosomal layer, and covers a substantial fraction of the chromosome surface (PubMed:27362226). Prevents chromosomes from collapsing into a single chromatin mass by forming a steric and electrostatic charge barrier: the protein has a high net electrical charge and acts as a surfactant, dispersing chromosomes and enabling independent chromosome motility (PubMed:27362226). Binds DNA, with a preference for supercoiled DNA and AT-rich DNA (PubMed:10878551). Does not contribute to the internal structure of mitotic chromosomes (By similarity). May play a role in chromatin organization (PubMed:24867636). It is however unclear whether it plays a direct role in chromatin organization or whether it is an indirect consequence of its function in maintaining mitotic chromosomes dispersed (Probable). Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a solution containing PBS buffer pH 7.2-7.6 with 3% trehalose, without preservatives.
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant human Ki-67 protein (amino acids 1,111-1,490) expressed in and purified from E. coli.
Applications:
ICC,WB
Clone number:
6B4
Antibody Isotype:
IgG1
Application Details:
Western blotting (1:1,000-1:5,000) and Immunocytochemistry (1:2,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
KI-67
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human only. Does not react with Mouse or Rat.
Rabbit anti-Ki-67 Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly (PubMed:27362226). Associates with the surface of the mitotic chromosome, the perichromosomal layer, and covers a substantial fraction of the chromosome surface (PubMed:27362226). Prevents chromosomes from collapsing into a single chromatin mass by forming a steric and electrostatic charge barrier: the protein has a high net electrical charge and acts as a surfactant, dispersing chromosomes and enabling independent chromosome motility (PubMed:27362226). Binds DNA, with a preference for supercoiled DNA and AT-rich DNA (PubMed:10878551). Does not contribute to the internal structure of mitotic chromosomes (By similarity). May play a role in chromatin organization (PubMed:24867636). It is however unclear whether it plays a direct role in chromatin organization or whether it is an indirect consequence of its function in maintaining mitotic chromosomes dispersed (Probable). Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant human Ki-67 protein (amino acids 1,111-1,490) expressed in and purified from E. coli.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:2,000-1:10,000) and Immunocytochemistry (1:1,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
KI-67
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human only. Does not react with Mouse or Rat.
Rabbit anti-Laminin-111 Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organisation of cells into tissues during embryonic development by interacting with other extracellular matrix components. Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from a solution containing PBS buffer pH 7.2-7.6 with 3% trehalose, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
Laminin-111 isolated from mouse EHS cells
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunohistochemistry (1:1,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Laminin 1, Laminin _1_1_1.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Mouse,reacts with Mouse and Rat, other species not tested. This antibody recognizes laminin isotypes alpha-1 (440 kDa), beta-1 (220 kDa) and gamma-1 (220 kDa). It also binds laminin binding protein at 120 kDa which always co-expresses with laminin.
Rabbit anti-Leu-Enkephalin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded, ICC.
Background Info:
Leu-Enkephalin is cleaved from the precursor Proenkephalin-A. Leu-Enkephalin is an endogenous opioid peptide that interacts with opioid receptors and produces analgesic effects.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic human Leu-Enkephalin peptide (230 - 234) conjugated to BSA.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Proenkephalin-A; PENK;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; rat. Leu-Enkephalin is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Met-enkephalin 0.93%; with beta-lipotropin 0.01%; with beta-endorphin 0.01%
Mouse anti-Lipid phosphate phosphohydrolase 3 (LPP3) Monoclonal Antibody (Unconjugated), suitable for WB, FC.
Background Info:
Lipid phosphate phosphohydrolase 3 (LPP3) is a member of the phosphatidic acid phosphatase (PAP) family. LPP3 catalyzes the conversion of phosphatidic acid to diacylglycerol. In addition it hydrolyzes lysophosphatidic acid, ceramide-1-phosphate and sphingosine-1-phosphate (Ref: SWISSPROT).
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS pH 7.4
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
A synthetic peptide from human LPP3 (179-196 aa) conjugated to KLH.
Applications:
FC,WB
Clone number:
7H7D3
Antibody Isotype:
Mix of IgG1, IgG2a & IgG2b
Application Details:
Western Blotting (WB), Flow cytometry (FACS) and Immunohistochemistry (IHC). For WB, the recommended concentration is 2-3 µg/mL. For IHC, this antibody has been shown to work on formalin-fixed, paraffin-embedded tissue samples with heat-induced antigen retrieval. The recommended concentration is 0.5-2 µg/mL. For FACS, the recommended concentration is 2.0 µg/mL. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Lipid phosphate phosphohydrolase 3; PAP2-beta; Phosphatidate phosphohydrolase type 2b; Phosphatidic acid phosphatase 2b; PAP-2b; PAP2b; Vascular endothelial growth factor and type I collagen-inducible protein; VCIP; PPAP2B;LPP3
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by over-expression of human LPP3 cDNA. Human
Matrix metallopeptidase 9 (MMP-9) cleaves collagen types IV and type V and gelatin types 1 and V. MMP-9 has a possible role in local proteolysis of the extracellular matrix and in leukocyte migration (Ref: SWISSPROT).
A synthetic peptide corresponding to a region (689-705 aa) from human Matrix metallopeptidase 9.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunohistochemistry (IHC). A concentration of 1.0 µg/mL is recommended for WB. Human MMP-9 (precursor) has a predicted length of 707 amino acids and MW of 78 kDa. A concentration of 1.0 µg/mL is recommended for IHC to detect the protein in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is required. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB (Human, Rat) and IHC (Human) against the antigen. Human; rat; predicted to react with mouse due to sequence homology
The matrix metalloproteinases (MMPs) are a large family of zinc endopeptidases. All MMPs are synthesized as inactive proenzymes. The activation of these proenzymes is a critical step that leads to degradation of extracellular matrix components such as fibronectin and collagen type III. At least 2 isoforms of MMP16 are produced by alternate splicing. The Long isoform is a single-pass type 1 membrane protein. The Short isoform is secreted. Both forms of MMP16 activate MMP2 (progelatinase A) by cleavage.
A synthetic peptide (YTVFQFKRKGTPRHILY) corresponding to a region (582-598) from human Matrix metalloproteinase-16. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0-2.0 µg/mL is recommended for WB. Human MMP16 (isoform Long) has a predicted length of 607 residues and MW of 70 kDa. A concentration of 0.5-1.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues as well as formalin or acetone fixed frozen tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues in association with MMP14. PEX, the C-terminal non-catalytic fragment of MMP2, posseses anti-angiogenic and anti-tumor properties and inhibits cell migration and cell adhesion to FGF2 and vitronectin. Ligand for integrinv/beta3 on the surface of blood vessels. MMP2 isoform 2 mediates the proteolysis of CHUK/IKKA and initiates a primary innate immune response by inducing mitochondrial-nuclear stress signaling with activation of the pro-inflammatory NF-kappaB, NFAT and IRF transcriptional pathways. Catalytic activity of MMP2 causes cleavage of gelatin type I and collagen types IV, V, VII, X. Cleaves the collagen-like sequence Pro-Gln-Gly-|-Ile-Ala-Gly-Gln. (Ref: uniprot.org).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS pH 7.4, containing 3% trehalose, without preservatives.
Western Blotting (WB): 1:5,000 - 1:10,000. MMP2 appears as two bands at apparent molecular weights of 66 and 72 kDa. Immunohistochemistry (IHC): 1:500-1:1,000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
72 kDa gelatinase; Gelatinase A; MMP-2; TBE-1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human. Expected to react with horse, cow, pig, chicken, rat and mouse MMP2.
The matrix metalloproteinases (MMPs) are a large family of zinc endopeptidases. All MMPs are synthesized as inactive proenzymes. The activation of these proenzymes is a critical step that leads to degradation of extracellular matrix components such as fibronectin and collagen type III. MMP8 is known to degrade fibrillar type I, II, and III collagens.
A synthetic peptide (PGNPKWERTNLTY) corresponding to a region (103-115) from human Matrix metalloproteinase-8. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 0.75 µg/mL is recommended for WB. Human MMP8 (precursor) has a predicted length of 467 residues and MW of 53 kDa. A concentration of 1.0-2.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human; rat; predicted to react with mouse due to sequence homology;
The matrix metalloproteinases (MMPs) are a large family of zinc endopeptidases. All MMPs are synthesized as inactive proenzymes. The activation of these proenzymes is a critical step that leads to degradation of extracellular matrix components such as fibronectin and collagen type III. MMP2 is activated by other MMPs such as MMP14 and MMP16. MMP2 is known to degrade collagen types IV, V, VII and X as well as gelatin type I.
A synthetic peptide corresponding to a region (138-153) at the N-terminus from human Matrix metalloproteinase-2.
Applications:
ELISA,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and ELISA. A concentration of 0.1-0.5 µg/mL is recommended for WB and ELISA. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
72 kDa type IV collagenase; EC 3.4.24.24; 72 kDa gelatinase; Matrix metalloproteinase-2; MMP-2; Gelatinase A; TBE-1; MMP2; CLG4A;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
paraffin sections), rat (WB, IHC paraffin and frozen sections) and mouse (IHC paraffin and frozen sections).
The Biosensis Human Mature NGF/proNGF Combo RapidTM enzyme-linked immunosorbent assay (ELISA) Kit combines individual, but complementary ELISA kits for the two most important NGF isoforms: Mature NGF (BEK-2212) and full-length proNGF (BEK-2226). Both kits are sandwich ELISAs, useful for the quantification of mature NGF and proNGF in less than 4 hours in cell culture supernatants, serum, and plasma (citrate) only if used as directed, with a simplified protocol and no loss of sensitivity or specificity. Researchers have used both kits for NGF/proNGF measurement in human urine, however, Biosensis has not yet internally validated the use of urine in both ELISA kits. End-users are strongly advised to perform essential validation experiments to assure accurate NGF/proNGF quantification in human urine. Please refer to the most current kit protocols for BEK-2212 (Mature BDNF RapidTM ELISA) and BEK-2226 (proNGF RapidTM ELISA), for specific use instructions for each substrate application, in particular blood samples. The Mature NGF ELISA kit consists of a pre-coated mouse monoclonal anti-NGF capture antibody, a biotinylated anti-NGF detection antibody and horseradish peroxidase (HRP)-conjugated streptavidin. The proNGF ELISA kit consists of a pre-coated anti-proNGF capture antibody, a biotinylated anti-proNGF detection antibody and horseradish peroxidase (HRP)-conjugated streptavidin. The addition of a substrate (3,3',5,5'-tetramethylbenzidine, TMB) yields a coloured reaction product which is directly proportional to the concentration of mature NGF or proNGF present in samples and protein standards. A NGF and proNGF positive control (QC sample) is provided to assure consistent assay performance. The Mature NGF ELISA kit employs a high-quality recombinant human NGF standard approved by the World Health Organization (WHO). The proNGF ELISA kit contains a recombinant human proNGF standard expressed in E.coli. Note that this Mature NGF/proNGF Combo kit is designed to measure the human protein forms, although due to sequence homology the Mature NGF ELISA kit will detect mouse and rat mature NGF. The proNGF ELISA kit does not cross-react with rodent forms of proNGF. This Combo kit is capable of distinguishing and independently quantifying the mature NGF and full-length NGF isoforms. Internal validation data demonstrates <0.1% cross-reactivity (determined at 25 ng/mL, diluted in assay buffer) of human proNGF protein in the mature NGF ELISA, demonstrating the preferential quantification of mature NGF over full-length human proNGF. The absence of proNGF cross-reactivity in the mature NGF ELISA kit has been independently confirmed by <a class="newA" target="_blank" href="https://pubmed.ncbi.nlm.nih.gov/32870355/">Mossa AH et al. (2020) . The antibodies used in the proNGF ELISA kit bind epitopes within the pro-domain of the protein and therefore recognize proNGF and the pro-domain peptide, but do not cross-react with mature NGF! Important: Accurate NGF quantification in human citrate-plasma requires the addition of Heterophilic Antibody Blocker <a href="https://www.biosensis.com/heterophilic-antibody-blocker-for-bek-2212-and-similar-elisa-assays.html" target="_blank">BL-005-500 . Accurate proNGF quantification in human serum requires the addition of Heterophilic Antibody Blocker <a href="https://www.biosensis.com/heterophilic-antibody-blocker-for-bek-2226-bek-2218-and-similar-elisa-assays.html" target="_blank">BL-003-1000 . Both Heterophilic Antibody Blockers are provided in the kit. This ELISA kit has not been tested for other applications. It has been configured for research use only and is not to be used for diagnostic or clinical procedures.
Background Info:
Nerve growth factor (NGF) is synthesized as a precursor (proNGF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proNGF is synthesized in target tissues and glia, transported retrogradely and may be released.
Product Type:
ELISA Assay
Species Reactivity:
Human
Immunogen:
See BEK-2212 & BEK-2226 for specific details
Applications:
ELISA
Application Details:
ELISA. For the quantification of Mature NGF and proNGF in Culture Supernatant, Serum, Plasma (Citrate). Please download the detailed product insert for complete instructions for the successful use of this ELISA. Use only as directed.
The ELISA kit box contains 2 x 96-well pre-coated strip plates per kit (1 x NGF antibody, 1 x proNGF antibody coated plate), protein standards, QC sample, detection reagents, heterophilic antibody blocker, wash and sample buffers, substrate buffer and detailed protocols.
Specificity:
Mature NGF ELISA: Detects human NGF, and cross-reacts with mouse and rat mature NGF. This mature NGF ELISA preferentially detects mature NGF over full-length proNGF. proNGF ELISA: Detects human proNGF only, does not cross-react with mouse and rat proNGF. Both capture and detection antibodies used in the proNGF ELISA kit binds to epitopes within the pro-domain of proNGF. Thus, the proNGF ELISA detects the full-length form of proNGF, and does not quantify mature NGF.
Typical limit of detection (LOD) for human mature NGF is 2 pg/mL determined as 150% of the blank value. Typical limit of detection (LOD) for human proNGF is < 60 pg/mL, determined as blank value plus 3x standard deviation of blank OD (n=10).
Cross Reactivity:
Cross-reactivity of NGF isoforms: Mature NGF ELISA: The antibodies used in the Mature NGF ELISA kit bind epitopes within the mature domain of the protein. However, human proNGF protein shows <0.1% cross-reactivity (determined at 25 ng/mL, diluted in assay buffer), demonstrating the preferential quantification of mature NGF over full-length human proNGF. The absence of proNGF cross-reactivity in the mature NGF ELISA kit has been independently confirmed by <a class="newA" target="_blank" href="https://pubmed.ncbi.nlm.nih.gov/32870355/">Mossa AH et al. (2020) . The Mature NGF ELISA does not cross-react with brain derived neurotrophic factor (BDNF), neurotrophin-3 (NT-3), NT-4/5, glial cell line-derived neurotrophic factor (GDNF) and vascular endothelial growth factor (VEGF165) tested at 25 ng/mL. Due to a high degree of NGF sequence homology, the antibodies used in this kit will also detect mature NGF from numerous other species including mouse and rat! proNGF ELISA: Does not cross-react with recombinant human mature NGF and proBDNF tested at 25 ng/mL. Does not react with rodent proNGF.
Target:
Mature NGF/proNGF Combo (BEK-2212/2226)
Accession Number:
P01138
Research Areas:
ELISA Assays & Reagents/ELISA Kits/Neurotrophins/Biosensis Cancer
The Biosensis Mouse Mature NGF/proNGF Combo RapidTM enzyme-linked immunosorbent assay (ELISA) Kit combines individual, but complementary ELISA kits for the two most important NGF isoforms: Mature NGF (BEK-2213) and full-length proNGF (BEK-2236). Both kits are sandwich ELISAs, useful for the quantification of mature NGF and proNGF in less than 4 hours in cell culture supernatants and tissue homogenates only if used as directed, with a simplified protocol and no loss of sensitivity or specificity. Researchers have used both kits for NGF/proNGF measurement in mouse urine, however, Biosensis has not yet internally validated the use of urine in both ELISA kits. End-users are strongly advised to perform essential validation experiments to assure accurate NGF/proNGF quantification in mouse urine. Please refer to the most current kit protocols for BEK-2213 (Mature BDNF RapidTM ELISA) and BEK-2236 (proNGF RapidTM ELISA), for specific use instructions for each substrate application. The Mature NGF ELISA kit consists of a pre-coated mouse monoclonal anti-NGF capture antibody, a biotinylated anti-NGF detection antibody and horseradish peroxidase (HRP)-conjugated streptavidin. The proNGF ELISA kit consists of a pre-coated anti-proNGF capture antibody, a biotinylated anti-NGF detection antibody and horseradish peroxidase (HRP)-conjugated streptavidin. The addition of a substrate (3,3',5,5'-tetramethylbenzidine, TMB) yields a coloured reaction product which is directly proportional to the concentration of mature NGF or proNGF present in samples and protein standards. A NGF and proNGF positive control (QC sample) is provided to assure consistent assay performance. The Mature NGF ELISA kit employs a native mouse NGF protein as standard, purified from mouse submaxillary glands according to published procedures. The calibrator standard reflects the native state of mouse NGF protein and has been chosen to give most accurate quantification of natural NGF protein levels in mouse samples. The proNGF ELISA kit contains a recombinant mouse proNGF standard expressed in E.coli. Note that this Mature NGF/proNGF Combo kit is designed to measure the mouse protein forms, although due to sequence homology the Mature NGF ELISA kit will detect human and rat mature NGF. The proNGF ELISA kit cross-reacts with rat proNGF due to high degree of homology (96%) with mouse proNGF based on amino acid sequence, and the ability of this kit in detecting proNGF in rat PC12 cell lysates and rat brain tissue homogenate. However, the proNGF ELISA shows only little cross-reactivity (20%) with human proNGF. This Combo kit is capable of distinguishing and independently quantifying the mature NGF and full-length NGF isoforms. Internal validation data demonstrates <0.1% cross-reactivity of full-length mouse proNGF in the Mature NGF ELISA when assayed at 25 ng/mL in assay buffer, and proNGF is not detectable when assayed across the mature NGF calibration range. The antibodies used in the proNGF ELISA kit bind epitopes within the pro-domain (capture) and mature domain (detection) of the protein, thus the proNGF ELISA assay does not detect the pro-domain peptide. No cross-reactivity is observed in the proNGF ELISA kit with mature mouse NGF and full-length proBDNF when tested in assay buffer. This ELISA kit has not been tested for other applications. It has been configured for research use only and is not to be used for diagnostic or clinical procedures.
Background Info:
Nerve growth factor (NGF) is synthesized as a precursor (proNGF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proNGF is synthesized in target tissues and glia, transported retrogradely and may be released.
Product Type:
ELISA Assay
Species Reactivity:
Mouse
Immunogen:
See BEK-2213 & BEK-2236 for specific details
Applications:
ELISA
Application Details:
ELISA. For the quantification of Mature NGF and proNGF in Culture Supernatant, Tissue Homogenates. Please download the detailed product insert for complete instructions for the successful use of this ELISA. Use only as directed.
The ELISA kit box contains 2 x 96-well pre-coated strip plates per kit (1 x NGF antibody, 1 x proNGF antibody coated plate), protein standards, QC sample, detection reagents, heterophilic antibody blocker, wash and sample buffers, substrate buffer and detailed protocols.
Specificity:
Mature NGF ELISA: Detects mouse NGF, and cross-reacts with human and rat mature NGF. This mature NGF ELISA preferentially detects mature NGF over full-length proNGF. proNGF ELISA: Detects mouse and rat proNGF only, and shows only little reactivity (20%) with human proNGF. The proNGF ELISA detects the full-length form of proNGF only, and does not quantify mature NGF or the pro-domain peptide.
Typical limit of detection (LOD) for mouse mature NGF is 2 pg/mL determined as 150% of the blank value. Typical limit of detection (LOD) for mouse proNGF is less than 50 pg/mL, determined as blank value plus 3x standard deviation of blank OD (n=10).
Cross Reactivity:
Cross-reactivity of NGF isoforms: Mature NGF ELISA: The antibodies used in this ELISA kit bind epitopes within the mature domain of the protein. No cross-reactivity was observed with brain derived neurotrophic factor (BDNF), neurotrophin-3 (NT-3) and NT-4/5 tested at 25 ng/mL in assay buffer. Mature mouse NGF (27 kDa) and full-length mouse proNGF (50 kDa) were assayed in parallel at equimolar protein concentrations across the Mouse NGF ELISA calibration range (3.9-250 pg/mL; 0.14-9.2 pmol/L). OD readings for mouse proNGF were indistinguishable from the assay's blank OD readings. proNGF ELISA: Does not cross-react with proBDNF and mature NGF. Mature NGF spiked into brain homogenate does not interfere with proNGF quantification.
Target:
Mature NGF/proNGF Combo (BEK-2213/2236)
Accession Number:
P01139
Research Areas:
ELISA Assays & Reagents/ELISA Kits/Neurotrophins/Biosensis Cancer
The Biosensis Rat Mature NGF/proNGF Combo RapidTM enzyme-linked immunosorbent assay (ELISA) Kit combines individual, but complementary ELISA kits for the two most important NGF isoforms: Mature NGF (BEK-2214) and full-length proNGF (BEK-2236). Both kits are sandwich ELISAs, useful for the quantification of mature NGF and proNGF in less than 4 hours in cell culture supernatants and tissue homogenates only if used as directed, with a simplified protocol and no loss of sensitivity or specificity. Please refer to the most current kit protocols for BEK-2214 (Mature BDNF RapidTM ELISA) and BEK-2236 (proNGF RapidTM ELISA), for specific use instructions for each substrate application. The Mature NGF ELISA kit consists of a pre-coated mouse monoclonal anti-NGF capture antibody, a biotinylated anti-NGF detection antibody and horseradish peroxidase (HRP)-conjugated streptavidin. The proNGF ELISA kit consists of a pre-coated anti-proNGF capture antibody, a biotinylated anti-NGF detection antibody and horseradish peroxidase (HRP)-conjugated streptavidin. The addition of a substrate (3,3',5,5'-tetramethylbenzidine, TMB) yields a coloured reaction product which is directly proportional to the concentration of mature NGF or proNGF present in samples and protein standards. A NGF and proNGF positive control (QC sample) is provided to assure consistent assay performance. The Mature NGF ELISA kit employs a high-quality recombinant rat NGF protein as standard, and thus the Mature NGF/proNGF Combo kit is designed to measure the rat NGF isoforms. However, the rat mature NGF ELISA kit will cross-react with mouse and human mature NGF protein. The proNGF ELISA kit contains a recombinant mouse proNGF standard expressed in E.coli. Mouse proNGF and rat proNGF share 96% sequence homology, and internal validation data has demonstrated the ability of the proNGF ELISA to detect proNGF in rat PC12 cell lysates and rat brain tissue homogenate. However, the proNGF ELISA shows only little cross-reactivity (20%) with human proNGF. This Combo kit is capable of distinguishing and independently quantifying the mature NGF and full-length NGF isoforms. Internal validation data demonstrates that the mature NGF ELISA assay antibodies preferentially detect the mature form of NGF. Cross-reaction of full-length proNGF was < 0.1% when assayed at 25 ng/mL in assay buffer, and not detectable when assayed across the mature NGF calibration range. The antibodies used in the proNGF ELISA kit bind epitopes within the pro-domain (capture) and mature domain (detection) of the protein, thus the proNGF ELISA assay does not detect the pro-domain peptide. No cross-reactivity is observed in the proNGF ELISA kit with mature mouse NGF and full-length proBDNF when tested in assay buffer. This ELISA kit has not been tested for other applications. It has been configured for research use only and is not to be used for diagnostic or clinical procedures.
Background Info:
Nerve growth factor (NGF) is synthesized as a precursor (proNGF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proNGF is synthesized in target tissues and glia, transported retrogradely and may be released.
Product Type:
ELISA Assay
Species Reactivity:
Rat
Immunogen:
See BEK-2214 & BEK-2236 for specific details
Applications:
ELISA
Application Details:
ELISA. For the quantification of Mature NGF and proNGF in Culture Supernatant, Tissue Homogenates. Please download the detailed product insert for complete instructions for the successful use of this ELISA. Use only as directed.
The ELISA kit box contains 2 x 96-well pre-coated strip plates per kit (1 x NGF antibody, 1 x proNGF antibody coated plate), protein standards, QC sample, detection reagents, heterophilic antibody blocker, wash and sample buffers, substrate buffer and detailed protocols.
Specificity:
Mature NGF ELISA: Detects rat NGF, and cross-reacts with human and mouse mature NGF. This mature NGF ELISA preferentially detects mature NGF over full-length proNGF. proNGF ELISA: Detects mouse and rat proNGF only, and shows only little reactivity (20%) with human proNGF. The proNGF ELISA detects the full-length form of proNGF only, and does not quantify mature NGF or the pro-domain peptide.
Typical limit of detection (LOD) for rat mature NGF is 2 pg/mL determined as 150% of the blank value. Typical limit of detection (LOD) for rat proNGF is less than 50 pg/mL, determined as blank value plus 3x standard deviation of blank OD (n=10).
Cross Reactivity:
Cross-reactivity of NGF isoforms: Mature NGF ELISA: The antibodies used in this ELISA kit bind epitopes within the mature domain of the protein. No cross-reactivity was observed with brain derived neurotrophic factor (BDNF), neurotrophin-3 (NT-3) and NT-4/5 tested at 25 ng/mL in assay buffer. Mature NGF (27 kDa) and full-length proNGF (50 kDa) were assayed in parallel at equimolar protein concentrations across the mature NGF ELISA calibration range (3.9-250 pg/mL; 0.14-9.2 pmol/L). OD readings for proNGF were indistinguishable from the assay's blank OD readings. proNGF ELISA: Does not cross-react with proBDNF and mature NGF. Mature NGF spiked into brain homogenate does not interfere with proNGF quantification.
Target:
Mature NGF/proNGF Combo (BEK-2214/2236)
Accession Number:
P25427
Research Areas:
ELISA Assays & Reagents/ELISA Kits/Neurotrophins/Biosensis Cancer
The matrix metalloproteinases (MMPs) are a large family of zinc endopeptidases that degrade extracellular matrix components such as fibronectin and collagen type III. The tissue inhibitors of metalloproteinase (TIMPs) complex with these matrix metalloproteinases and irreversibly inactivate them. The TIMP proteins are homologous and are either secreted in soluble form (TIMP1, TIMP2 and TIMP4) or bind to extracellular matrix components (TIMP3). Metalloproteinase inhibitor 2 (TIMP2) is known to inhibit MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19.
A synthetic peptide (RGAAPPKQEFLDIEDP) corresponding to a region (205-220) from the C-terminus of human Metalloproteinase inhibitor 2. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0-2.0 µg/mL is recommended for WB. Human TIMP2 (precursor) has a predicted length of 220 residues and MW of 24 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Tissue inhibitor of metalloproteinases 2; TIMP-2; CSC-21K; TIMP2;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB against the antigen. Human; mouse; rat; rabbit;
Rabbit anti-Metalloproteinase inhibitor 3 Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
The matrix metalloproteinases (MMPs) are a large family of zinc endopeptidases that degrade extracellular matrix components such as fibronectin and collagen type III. The tissue inhibitors of metalloproteinase (TIMPs) complex with these matrix metalloproteinases and irreversibly inactivate them. The TIMP proteins are homologous and are either secreted in soluble form (TIMP1, TIMP2 and TIMP4) or bind to extracellular matrix components (TIMP3). Metalloproteinase inhibitor 3 (TIMP3) is known to inhibit MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.
A synthetic peptide (WAPPDKSIINATDP) corresponding to a region (198-211) from the C-terminus of human Metalloproteinase inhibitor 3. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human TIMP3 (precursor) has a predicted length of 211 residues and MW of 24 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Tissue inhibitor of metalloproteinases 3; TIMP-3; MIG-5; TIMP3;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB against the antigen. Human;
Rabbit anti-Metalloproteinase inhibitor 4 Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
The matrix metalloproteinases (MMPs) are a large family of zinc endopeptidases that degrade extracellular matrix components such as fibronectin and collagen type III. The tissue inhibitors of metalloproteinase (TIMPs) complex with these matrix metalloproteinases and irreversibly inactivate them. The TIMP proteins are homologous and are either secreted in soluble form (TIMP1, TIMP2 and TIMP4) or bind to extracellular matrix components (TIMP3). Metalloproteinase inhibitor 4 (TIMP4) is known to inhibit MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid (0.5 mL) in 50% glycerol, 0.9 mg NaCl and 0.2 mg Na2HPO4
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse (Predicted),Rat
Immunogen:
A synthetic peptide (YRGHLPLRKEFVDIVQP) corresponding to a region (208-224) from the C-terminus of human Metalloproteinase inhibitor 4. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 0.1-0.5 µg/mL is recommended for WB. Human TIMP4 (precursor) has a predicted length of 224 residues and MW of 26 kDa. A concentration of 0.5-1.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Tissue inhibitor of metalloproteinases 4; TIMP-4; TIMP4;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human; rat; expected to react with mouse due to sequence homology;
Rabbit anti-Met-Enkephalin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded, ICC.
Background Info:
Human Methionine enkephalin (Met-Enkephalin) is a small 5 amino acid peptide cleaved from the precursor pro-opiomelanocortin (POMC). Met-Enkephalin is an endogenous opioid peptide that interacts with opioid receptors and produces analgesic effects.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic human Met-enkephalin peptide (237-241) conjugated to BSA.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Pro-opiomelanocortin; POMC;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; rat. Met-Enkephalin is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Leu-enkephalin 5.8%; with beta-lipotropin 0.01%; with beta-endorphin 0.01%
Superoxide dismutase [Mn], mitochondrial destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems (Ref: SwissProt).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (KHSLPDLPYDGALEPHINC) of human/rat/mouse mitochondrial manganese Superoxide Dismutase (SOD2), conjugated to Keyhole Limpet Hemocyanin.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
IF, WB. Typical working dilutions for light microscopy are 1:500 to 1:1,000 depending on tissue and detection method. For IF, a dilution range of 1:50 to 1:100 is recommended. For WB, a dilution range of 1: 1,000 to 1: 4,000 is recommended. This antibody clearly detects a protein at approximately 24 kDa on WB of human brain tissue. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Superoxide dismutase [Mn], mitochondrial;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Mitochondrial manganese Superoxide Dismutase (SOD2), no cross reactivity to SOD1
Chicken anti-Mitochondrial uncoupling protein 3 (UCP 3) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Uncoupling Protein 3 (UCP3) belongs to the mitochondrial carrier family. Located in the mitochondrion inner membrane, UCP3 creates proton leaks across the membrane thus uncoupling oxidative phosphorylation (Ref: SWISSPROT).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Pig,Rat
Immunogen:
A peptide from the C-terminus of human Uncoupling Protein 3 (298-312 aa).
Applications:
WB
Antibody Isotype:
IgY
Application Details:
WB. Suggested dilution at 1:1,000 to 1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
UCP3; Mitochondrial uncoupling protein 3; UCP 3; Solute carrier family 25 member 9; SLC25A9;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody detects UCP3 at approx 35 kDa. Human, Mouse, Rat, Porcine
Mouse anti-Myc proto-oncogene protein Monoclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
Myc proto-oncogene protein (c-Myc) is a transcription factor with roles in cellular proliferation, differentiation, apoptosis and cell cycle progression. Mutations in the c-Myc gene and protein over-expression have been associated with a variety of hematopoietic tumors, leukemias and lymphomas.
A synthetic peptide (AEEQKLISEEDLLRKRREQLKHKLEQLRNSCA) corresponding to C terminal residues 408-439 of human Myc proto-oncogene protein (c-Myc).
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Clone number:
IMD-3
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 4.0 µg/mL is recommended for WB. Human c-Myc (isoform 1) has a predicted length of 439 residues and a MW of 49 kDa. A concentration of 8.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
c-Myc; Transcription factor p64; MYC;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human;
Purification:
IgG
Target:
Myc proto-oncogene protein
Accession Number:
P01106
Research Areas:
Antibodies & Conjugates/Apoptosis,Antibodies & Conjugates/Biosensis Stem Cells,Antibodies & Conjugates/Biosensis Cancer
Chicken anti-Nestin Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Required for brain and eye development. Promotes the disassembly of phosphorylated vimentin intermediate filaments (IF) during mitosis and may play a role in the trafficking and distribution of IF proteins and other cellular factors to daughter cells during progenitor cell division. Required for survival, renewal and mitogen-stimulated proliferation of neural progenitor cells (By similarity). Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from a solution containing PBS buffer pH 7.2-7.6, without preservatives.
Host Animal:
Chicken
Species Reactivity:
Human,Rat
Immunogen:
Part of recombinant human protein (amino acids 315-630).
Applications:
ICC,WB
Antibody Isotype:
IgY
Application Details:
Western blotting (1:1,000-1:5,000) and Immunocytochemistry (1:2,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
NES;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with human and rat. Other species not tested.
Mouse anti-Nestin Monoclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Nestin is a member of the class IV intermediate filament protein family which is expressed in neuronal stem cells. The molecular weight of human Nestin as determined by SDS-PAGE mobility is about 240 kDa. However the real molecular weight is considerably less than this, at 177 kDa, the disparity being likely due to the highly charged region of the C-terminal segment. Nestin is relatively poorly conserved in protein sequence across species boundaries, so that the mouse and human proteins have an overall identity of only 62%. As a result antibodies to the human protein often fail to recognize the rodent homologue and vice versa. However this antibody stains both rodent and human Nestin. Antibodies to Nestin are widely used to identify neural stem cells.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a solution containing PBS buffer pH 7.2-7.6 with 0.1% trehalose and 5 mM sodium azide as preservative.
Host Animal:
Mouse
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Partial segment (region 317-630 aa) of human Nestin expressed in E.coli
Applications:
ICC,WB
Clone number:
4D11
Antibody Isotype:
IgG1, kappa
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Flow Cytometry. Suggested dilution for WB is 1:1,000-5,000 and 1:250-500 for IC. Use 2 ug/10^6 cells for Flow Cytometry. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Nestin; NES;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody is specific for the 240 kDa Nestin protein by WB on developing rat brain (P18) homogenate. A much weaker band at approx. 90 kDa may also be seen. This is suggested to be a breakdown product of the 240 kDa band. Human, Rodent
Rabbit anti-Nestin Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Required for brain and eye development. Promotes the disassembly of phosphorylated vimentin intermediate filaments (IF) during mitosis and may play a role in the trafficking and distribution of IF proteins and other cellular factors to daughter cells during progenitor cell division. Required for survival, renewal and mitogen-stimulated proliferation of neural progenitor cells (By similarity). Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Part of recombinant human protein (amino acids 315-630).
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunocytochemistry (1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human. Other species not tested.
Rabbit anti-Neuron specific enolase (NSE) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Enolase is a metalloenzyme that catayzes the reaction between 2-phospho-D-glycerate and phosphoenolpyruvate during glycolysis. Mammalian enolase is composed of 3 subunits; alpha, beta and gamma (Neuron-specific enolase). These subunits can form homodimers or heterodimers. The alpha/gamma heterodimer and the gamma/gamma homodimer are found primarily in neurons.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human Neuron Specific Enolase (NSE) expressed in and purified from E.coli
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:1,000 - 1:2,000 is recommended for WB. A dilution of 1:500 is recommended for ICC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rabbit anti-Oxysterols receptor LXR-alpha Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
LXR-alpha is an orphan receptor that belongs to the nuclear hormone receptor family. It is expressed in adult spleen, pituitary, lung, liver and fat (Ref: SWISSPROT).
A synthetic peptide (QVERLQHTYVEALHAYVSINHPHD) corresponding to a region (375-398) from the C-terminus of rat Oxysterols receptor LXR-alpha.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Rat Oxysterols receptor LXR-alpha protein has a predicted length of 445 amino acids and MW of 51 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Liver X receptor alpha; Nuclear receptor subfamily 1 group H member 3; RLD-1; Nr1h3; Lxra; NR1H3; LXRA;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB against the antigen. Rat; predicted to react with mouse due to sequence homology;
Mouse anti-Parkinson disease protein 7 (PARK7) Monoclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Protein DJ-1 has many roles including protecting cells against oxidative stress and cell death (Ref: SwissProt). Mutations in the DJ-1 gene have been associated with rare forms of autosomal recessive early-onset Parkinson's disease.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS. Contains 5% trehalose.
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Full length recombinant human DJ-1 expressed in and purified from E. coli.
Applications:
ICC,WB
Clone number:
4H4
Antibody Isotype:
IgG1, kappa
Application Details:
WB, ICC. Suggested dilution of at least 1:500 for ICC. Dilutions of 1:5,000 or lower is recommended for WB. This antibody reveals a prominent ~21 kDa band and stains mainly in cytoplasm of tissue culture cells. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Oncogene DJ1; Parkinson disease protein 7; PARK7; DJ-1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
References:
Nagakubo D, Taira T, Kitaura H, Ikeda M, Tamai K, Iguchi-Ariga SM and Ariga H DJ-1, a novel oncogene which transforms mouse NIH3T3 cells in cooperation with ras. Biochem. Biophys. Res. Commun. 231, 509-513 (1997). Bonifati V, Rizzu P, van Baren, M.J., Schaap O, Breedveld GJ, Krieger E, Dekker MC, Squitieri F, Ibanez P, Joosse M et al. Mutations in the DJ-1 gene associated with autosomal recessive early-onset Parkinsonism. Science, 299, 256-259 (2003). Xu J, Zhong N, Wang H, Elias JE, Kim CY, Woldman I, Pifl C, Gygi SP, Geula C, Yankner BA. The Parkinson's disease-associated DJ-1 protein is a transcriptional co-activator that protects against neuronal apoptosis. Hum Mol Genet. 14 (9):1231-41 (2005). Yokota T, Sugawara K, Ito K, Takahashi R, Ariga H. And Mizusawa, H. Down regulation of DJ-1 enhances cell death by oxidative stress, ER stress, and proteasome inhibition. Biochem. Biophys. Res. Commun., 312, 1342-1348 (2003). Taira T, Saito Y, Niki T, Iguchi-Ariga SM, Takahashi K and Ariga H. DJ-1 has a role in antioxidative stress to prevent cell death. EMBO Rep., 5, 213-218 (2004). Bonifati V, Oostra BA. and Heutink, P. Linking DJ-1 to neurodegeneration offers novel insights for understanding the pathogenesis of Parkinson's disease. J.Mol,Med.82,163-174 (2004).
Specificity:
The antibody reacts with a 21 kDa band by Western blot on whole HeLa cell lysate. It has also been used successfully for immunocytochemistry. Does not react with rat and mouse DJ-1 protein on western blots.
The enzyme Peptidylprolyl isomerase (Pin1) is responsible for flipping the proline ring from the cis to trans conformation. This enzyme regulates mitosis presumably by interacting with NIMA and attenuating its mitosis-promoting activity (ref: SWISSPROT). Pin1 is concentrated in the nucleus in small punctate structures and is particularly obvious in tumor cells.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with 5% trehalose
Host Animal:
Chicken
Species Reactivity:
Cat,Human,Mouse,Other Mammals (Predicted),Rat
Immunogen:
Recombinant full length Peptidylprolyl isomerase (Pin1) purified from E.coli
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgY
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:500-1,000 is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB. This antibody detects ~21 kDa Pin1 protein. Human, Rat, Mouse and Feline. Predicted to react with other mammalian tissue.
Peroxiredoxin-2 has a role in redox regulation of the cell.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (VVDGAFKEVKLS) corresponding to region (20-31 aa) from human Peroxiredoxin-2 conjugated to diptheria toxin.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF of 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 4,000 is recommended. A dilution of 1: 1,000 to 1: 4,000 is recommended for ELISA. This antibody stains basal cells in rat airways and specific kidney tubule cells. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Peroxiredoxin-3 has a role in redox regulation of the cell.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (CEVVAVSVDSHFSHLAW) from a region (127-143 aa) on human Peroxiredoxin-3 conjugated to KLH.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF of 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 2,000 is recommended. This antibody detects a protein at approx 23 kDa on WB of human brain tissue which is the mature form of this protein. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Thioredoxin-dependent peroxide reductase, mitochondrial; Antioxidant protein 1; AOP-1; HBC189; Peroxiredoxin III; Prx-III; Peroxiredoxin-3; Protein MER5 homolog; PRDX3; AOP1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Peroxiredoxin-3 no cross reactivity to other family members
Peroxiredoxin-4 has a probable role in redox regulation of the cell.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (SRVSVADHSLHLSKAKISK) corresponding to a region (65-83 aa) from human Peroxiredoxin-4 conjugated to diptheria toxin.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF of 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 4,000 is recommended. A dilution of 1: 1,000 to 1: 4,000 is recommended for ELISA. This antibody stains non-ciliated bronchiolar cells in rat lung and what appears to be sebaceous glands in rat skin. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
P Glycoprotein belongs to the MDR/TAP subfamily of ATP-binding cassette (ABC) transporters. P Glycoprotein is an ATP-dependent drug efflux pump expressed in liver, kidney, small intestine and brain. It is responsible for decreased drug accumulation in multidrug-resistant cells. Genetic variation in P Glycoprotein is thought to play a role in patients who do not respond to drug treatment. P Glycoprotein also functions as a transporter in the blood-brain barrier.
Human and hamster drug-resistant whole cells and crude plasma membranes
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Clone number:
PG-13
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 0.5-1.0 µg/mL is recommended for WB. Human P Glycoprotein has a predicted length of 1280 residues and MW of 141 kDa. A concentration of 1.0-2.0 µg/mL is recommended for IHC to detect the protein in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is required. A concentration of 1.0-2.0 µg/mL is recommended for IHC to detect the protein in formalin/acetone fixed frozen tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Multidrug resistance protein 1; ATP-binding cassette sub-family B member 1; P-glycoprotein 1; CD243; ABCB1; MDR1; PGY1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human;
The protein identified as CD44 is also known as the receptor for hyaluronic acid (HA). The protein mediates cell-cell and cell-matrix interactions through its affinity for HA, and possibly also through its affinity for other ligands such as osteopontin, collagens, and matrix metalloproteinases (MMPs). Adhesion with HA plays an important role in cell migration, tumor growth and progression. In cancer cells, CD44 may play an important role in invadopodia formation, and it also is involved in lymphocyte activation, recirculation and homing, and in hematopoiesis. Altered expression or dysfunction of CD44 causes numerous pathogenic phenotypes. CD44 has great protein heterogeneity due to numerous alternative splicing and post-translational modification events. Biosensis' anti-CD44 rabbit polyclonal antibody is a new antibody made against a synthetic peptide epitope near the very C-terminus, cytoplasmic domain of human CD44. The antibody has been shown to react with multiple species including human, mouse and rat, in both western blot and immunohistochemistry applications including formalin fixed, paraffin embedded tissues. See applications detail for specific use instructions.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
lyophilized.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human CD44 cytoplasmic domain aa 728-742. The immunogen differs by only single amino acid between human, mouse and rat proteins.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
WB: Western blot: reduced RIPA samples or membrane preparations (0.1-.5 µg/mL) dependent upon antigen load and antibody incubation times and detection substrate used. IH: frozen or acetone fixed tissue: 0.5-1.0 ug.mL, permeabilization is necessary as epitope is internal IH(P): 1-2 µg/mL with HEIR treatment required.
Chicken anti-Presenilin-1 (PS-1) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Presenilin-1 (PSEN1) is a multi-pass membrane protein and component of the gamma-secretase complex. PSEN1 is thought to play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. It may also play a role in hematopoiesis. Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3), a familial early-onset form of Alzheimer disease (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Mixture of two human Presenilin 1 peptides (311-322 and 341-352 aa). Both sequences are highly conserved in human, mouse and rat.
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
WB and ELISA. Suggested dilution of 1:1,000 to 1:4,000. To minimise background staining, a higher concentration of detergent (such as Tween-20) is suggested in the dilution and washing steps. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Presenilin 1; PS-1; Protein S182; PS1-CTF12; PSEN1; AD3; PS1; PSNL1;
Chicken anti-Presenilin-2 (PS-2) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Presenilin-2 (PSEN2) is a multi-pass membrane protein and component of the gamma-secretase complex. Defects in PSEN2 are a cause of Alzheimer disease type 4 (AD4), an autosomal dominant Alzheimer disease. (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Mixture of two human Presenilin 2 peptides (319-330 and 349-360 aa). Both sequences are highly conserved in human, mouse and rat.
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
WB and ELISA. Suggested dilution of 1:1,000 to 1:4,000. To minimise background staining, a higher concentration of detergent (such as Tween-20) is suggested in the dilution and washing steps. Biosensis recommends that the optimal working dilution should be determined by the end user.
A synthetic peptide corresponding to a region (319-334 aa) from human Presenilin-2.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunohistochemistry (IHC). A concentration of 1.0 µg/mL is recommended for WB. Human Presenilin-2 (isoform 1) has a predicted length of 448 amino acids and MW of 50 kDa. A concentration of 1.0 µg/mL is recommended for IHC to detect the protein in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is required. A concentration of 1.0 µg/mL is also recommended for IHC in frozen tissue. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB (Human, Rat) and IHC (Rat) against the antigen. Human; rat; predicted to react with mouse due to sequence homology
Proliferating cell nuclear antigen (PCNA) belongs to the DNA sliding clamp family. PCNA helps increase the processivity of DNA polymerase during leading strand synthesis in DNA replication. In response to DNA damage, PCNA is ubiquitinated and is involved in the RAD6 dependent DNA repair pathway.
Protein A-PCNA fusion obtained from rat liver tissue.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Clone number:
IML-83
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 2.0 µg/mL is recommended for WB. Human PCNA has a predicted length of 261 residues and MW of 29 kDa. A concentration of 0.4-1.0 µg/mL is recommended to detect PCNA in formalin fixed and paraffin embedded tissues as well as formalin/acetone fixed tissues. Antigen retrieval may improve staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
PCNA; Cyclin;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human; mouse; rat
Rabbit anti-Prominin-1 Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Paraffin-embedded.
Background Info:
May play a role in cell differentiation, proliferation and apoptosis (PubMed:24556617). Binds cholesterol in cholesterol-containing plasma membrane microdomains and may play a role in the organization of the apical plasma membrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner (PubMed:20818439). Ref: uniprot.org.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from a solution containing 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
E-coli derived human CD133/PROM1 recombinant protein (position: P531-H865) has been used as the immunogen. Human CD133 shares 61% amino acid sequence identity with mouse CD133.
Applications:
IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Western Blot (0.1-0.5 µg/mL): tested in MCF-7 whole cell lysate. Immunohistochemistry: paraffin-embedded section (0.5-1.0 µg/mL) with HIER, pH 6.5; tested in human tonsil tissue. Other applications not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Prominin-1, Prominin-like protein 1, PROM1, PROML1, Antigen AC133, MSTP061; CD133;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody is specific for CD133 as demonstrated by western blotting.
Purification:
Affinity purified
Target:
Prominin-1
Accession Number:
O43490
Research Areas:
Antibodies & Conjugates/Development,Antibodies & Conjugates/Biosensis Stem Cells,Antibodies & Conjugates/Biosensis Cancer
Nerve growth factor (NGF) is synthesized as a precursor (proNGF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proNGF is synthesized in target tissues and glia, transported retrogradely and may be released.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a solution containing PBS buffer pH 7.4 with 3% trehalose, without preservatives.
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
A synthetic peptide (C-HTIPQAHWTKLQ, aa: 30-41) of human proNGF protein has been used as the immunogen. The sequence is located on the pro-domain of the proNGF full-length protein and is 80% homologous to mouse and rat proNGF.
Applications:
FC,ICC,WB
Clone number:
BS312
Antibody Isotype:
IgG2b, lambda
Application Details:
Flow Cytometry (2 ug/ 10^6 cells). Immunocytochemistry (1-2 µg/mL), Western Blotting (1-2 µg/mL). Other applications not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Nerve growth factor (NGF) is synthesized as a precursor (proNGF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proNGF is synthesized in target tissues and glia, transported retrogradely and may be released. Biosensis now offers biotinylated proNGF antibody allowing more flexibility in experimental design by using the biotin-avidin/streptavidin detection method. The ability of biotinylated proNGF antibody to detect proNGF has been validated by WB.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a solution containing PBS buffer pH 7.4 with 3% trehalose, without preservatives.
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
A synthetic peptide (C-HTIPQAHWTKLQ, aa: 30-41) of human proNGF protein has been used as the immunogen. The sequence is located on the pro-domain of the proNGF full-length protein and is 80% homologous to mouse and rat proNGF.
Applications:
WB
Clone number:
BS312
Antibody Isotype:
IgG2, lambda
Application Details:
The biotinylated proNGF antibody has been tested by Western Blotting (0.1-0.5 µg/mL) and is also expected to work in applications validated for the unlabelled antibody M-1738-100 at same or higher dilutions: Flow Cytometry and Immunofluorescence. Other applications not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Pro-brain nerve growth factor; proNGF; NGF
Biosensis Brand:
Biosensis®
Conjugate:
Biotin
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Species cross-reactivity not tested.
Purification:
Antibody was purified from cell culture supernatant by Protein G chromatography, biotinylated and buffer-exchanged into PBS, pH 7.4 buffer
Target:
Pro-Nerve growth factor (proNGF)
Accession Number:
P01138
Research Areas:
Antibodies & Conjugates/Biosensis Neurotrophic Factors,Antibodies & Conjugates/Biosensis Cancer
Rabbit anti-Rho-associated protein kinase 1 (ROCK1) Monoclonal Antibody (Unconjugated), suitable for IHC-Paraffin-embedded, WB.
Background Info:
Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of DAPK3, GFAP, LIMK1, LIMK2, MYL9/mLC2, PFN1 and PPP1R12A. Phosphorylates FHOD1 and acts synergistically with it to promote SRC-dependent non-apoptotic plasma membrane blebbing. Phosphorylates JIP3 and regulates the recruitment of JNK to JIP3 upon UVB-induced stress. Acts as a suppressor of inflammatory cell migration by regulating PTEN phosphorylation and stability. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Required for centrosome positioning and centrosome-dependent exit from mitosis. Plays a role in terminal erythroid differentiation. May regulate closure of the eyelids and ventral body wall by inducing the assembly of actomyosin bundles. Promotes keratinocyte terminal differentiation. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid. Rabbit IgG in phosphate buffered saline, pH 7.4, 150 mM NaCl, 0.02% sodium azide, 0.4-0.5 mg/mL BSA, 50% glycerol.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthesized peptide derived from human ROCK1
Applications:
IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Western blotting 1:500-1:2000; IHC(P) 1:50-1:200, heat-mediated antigen retrieval required (20 min, citrate buffer pH 6). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Renal carcinoma antigen NY-REN-35; Rho-associated, coiled-coil-containing protein kinase 1; Rho-associated, coiled-coil-containing protein kinase I; ROCK-I; p160 ROCK-1; p160ROCK
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human, mouse and rat ROCK1.
Purification:
Affinity purified
Target:
Rho-associated protein kinase 1 (ROCK1)
Accession Number:
Q13464
Research Areas:
Antibodies & Conjugates/Signalling & Transcription,Antibodies & Conjugates/Biosensis Cancer
Rabbit anti-Rho-associated protein kinase 2 Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
<span itemprop="description">Rho-associated protein kinase 2 (ROCK2) is a serine/threonine kinase that phosphorylates many important signalling proteins involved in the regulation of cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions complexes as well as malignant cell transformation, tumor invasion and metastasis.</span>
A synthetic peptide corresponding to a region (35-51) from human Rho-associated protein kinase 2.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 0.1-0.5 µg/mL is recommended for WB. Human Rho-associated protein kinase 2 has a predicted length of 1388 amino acids and MW of 160 kDa. A concentration of 0.5-1.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is required. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rabbit anti-Rho-associated protein kinase 2 (ROCK2) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded, WB.
Background Info:
Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of ADD1, BRCA2, CNN1, EZR, DPYSL2, EP300, MSN, MYL9/mLC2, NPM1, RDX, PPP1R12A and VIM. Phosphorylates SORL1 and IRF4. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Positively regulates the activation of p42/MAPK1-p44/MAPK3 and of p90RSK/RPS6KA1 during myogenic differentiation. Plays an important role in the timely initiation of centrosome duplication. Inhibits keratinocyte terminal differentiation. May regulate closure of the eyelids and ventral body wall through organization of actomyosin bundles. Plays a critical role in the regulation of spine and synaptic properties in the hippocampus. Plays an important role in generating the circadian rhythm of the aortic myofilament Ca2+ sensitivity and vascular contractility by modulating the myosin light chain phosphorylation.
E.coli-derived human ROCK2 recombinant protein (amino acids E652-D923).
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 0.1-0.5 µg/mL is recommended for WB. Human Rho-associated protein kinase 2 has a predicted length of 1388 amino acids and MW of 161 kDa. A concentration of 0.5-1.0 µg/mL is recommended to detect the protein in paraffin embedded tissues. Heat mediated antigen retrieval is required. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Rho kinase 2; Rho-associated, coiled-coil-containing protein kinase 2; Rho-associated, coiled-coil-containing protein kinase II; ROCK-II; p164 ROCK-2
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human, reacts with human, rat, mouse..
Purification:
Affinity purified
Target:
Rho-associated protein kinase 2 (ROCK2)
Accession Number:
P20656
Research Areas:
Antibodies & Conjugates/Signalling & Transcription,Antibodies & Conjugates/Biosensis Cancer
Flavoprotein subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q) (Ref: SWISSPROT).
A synthetic peptide (YRPVIDKTLNEADCAT) corresponding to a region (641-656 aa) from the C-terminus of human Succinate dehydrogenase [ubiquinone] flavoprotein subunit (SDNA).
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human SDHA (precursor) has a predicted length of 664 residues and MW of 73 kDa. A concentration of 2.0 µg/mL is recommended for IHC to detect the protein in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is required. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human (WB); rat (WB, IHC-P); predicted to react with mouse due to sequence homology;
A synthetic peptide (SNKTRIDEANQRATK) corresponding to a region (187-201 aa) from the C-terminus of human Synaptosomal-associated protein 25 (SNAP25).
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Rat SNAP25 (isoform SNAP-25b) has a predicted length of 206 residues and MW of 23 kDa. A concentration of 1.0 µg/mL is recommended for IHC to detect the protein in formalin fixed and paraffin embedded tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
SNAP-25; Super protein; SUP; Synaptosomal-associated 25 kDa protein; Snap25; Snap;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Rat; predicted to react with mouse and human due to sequence homology;
Rabbit anti-Synovial sarcoma, X breakpoint 2 (SSX2) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Synovial sarcoma, X breakpoint 2 (SSX2) proteins may act as repressors of transcription. Chromosomal translocations involving SSX2 have been implicated in synovial sarcoma. SSX2 is expressed at high levels in testis and at low levels in thyroid. At least 2 isoforms are produced by alternative splicing. SSX2 isoform 2 is the longer form of this protein.
A synthetic peptide (NREAQEKEERRGTAHRWSSQNTHNIGRF) corresponding to a region (157-184) of human Synovial sarcoma, X breakpoint 2 isoform 2. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human Synovial sarcoma, X breakpoint 2 isoform 2 has a predicted length of 223 amino acids and MW of 25 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Tenascin is a hexameric extracellular matrix protein. Tenascin may have a role in guiding migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. In the embryo, Tenascin is found in developing epithelia, cartilage and bone. In the adult, Tenascin is found in smooth muscle, tendon and hyper-proliferative skin. At least 6 isoforms of human Tenascin are produced by alternative splicing.
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0-2.0 µg/mL is recommended for WB. Human Tenascin (isoform 1) has a predicted length of 2,201 residues and MW of 241 kDa. A concentration of 2.0-4.0 µg/mL is recommended for IHC to detect the protein in formalin fixed and paraffin embedded tissues as well as formalin/acetone fixed frozen tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Transforming growth factor alpha (TGF alpha) is a mitogenic polypeptide that is able to bind to the EGF receptor. At least 5 isoforms of the protein are produced by alternate splicing (Ref: SWISSPROT).
A synthetic peptide corresponding to a region (73-90 aa) from human Transforming growth factor alpha.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human TGF alpha (isoform 1 precursor) has a predicted length of 160 amino acids and MW of 17 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Transforming growth factor beta-1 (TGFB1) is a multi-functional cytokine with roles in proliferation, differentiation and other functions in many cell types. The secreted TGFB1 protein is cleaved into a latency-associated peptide (LAP) and a mature TGFB1 peptide (Ref: SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Pig,Rat
Immunogen:
A peptide from human and mouse Transforming growth factor beta-1 (372-386 aa).
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
WB and ELISA. Suggested dilution of 1:2,000-1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
TGFB1; TGFB; TGF-beta-1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
TGF beta 1, cross reactivity to other species is expected
A synthetic peptide (NKYVQLNVGGSLYYTTVRALTRHDTM) corresponding to a region (27-52 aa) from the N-terminus of human tumor necrosis factor, alpha-induced protein 1, endothelial (TNFAIP1).
Applications:
ICC,IHC-Frozen
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC), Immunocytochemistry (ICC) and Western Blotting (WB). A concentration of 0.5-1.0 µg/mL is recommended for WB. Human TNFAIP1 has a predicted length of 316 residues and MW of 36 kDa. A concentration of 0.25-0.5 µg/mL is recommended for IHC to detect the protein in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is required. A concentration of 0.25-0.5 µg/mL is recommended for IHC to detect the protein in frozen tissues. A concentration of 0.25-0.5 µg/mL is recommended for ICC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2; hBACURD2; BTB/POZ domain-containing protein TNFAIP1; Protein B12; TNFAIP1; BACURD2; EDP1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human; rat; predicted to react with mouse due to sequence homology;
Purification:
Affinity purified
Target:
Tumor necrosis factor, alpha-induced protein 1 (TNFAIP1)
A synthetic peptide corresponding to a region (73-88 aa) from human Tumor Necrosis Factor beta.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human TNF-beta has a predicted length of 205 amino acids and MW of 23 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Tumor necrosis factor receptor 1 (TNF Receptor 1) binds cytokines TNF-alpha and TNF-beta resulting in the activation of pathways involved in both cell survival and apoptosis. TNF Receptor 1 contains an extracellular death domain that binds to the death domain adaptor protein TRADD and triggers the activation of caspases. At least 3 isoforms are produced by alternative splicing.
A synthetic peptide corresponding to a region (195-211) from human Tumor necrosis factor receptor 1 (precursor). To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human TNF Receptor 1 (precursor) has a predicted length of 455 residues and MW of 51 kDa. A concentration of 1.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is required. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Tumor necrosis factor receptor 2 (TNF Receptor 2) binds cytokines TNF-alpha and TNF-beta. At least 2 isoforms of TNF Receptor 2 are produced by alternative splicing. This product supercedes R-1140-100.
A synthetic peptide corresponding to a region (103-121 aa) from human Tumor necrosis factor receptor 2. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human TNF Receptor 2 (precursor) has a predicted length of 461 residues and MW of 48 kDa. A concentration of 1.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is required. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
This receptor for Urokinase Plasminogen Activator has a role in localizing and promoting plasmin formation. At least 3 isoforms are produced by alternative splicing (Ref: SWISSPROT).
A synthetic peptide corresponding to a region (293-304 aa) from human Urokinase plasminogen activator surface receptor (UPAR).
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunohistochemistry (IHC). A concentration of 0.1-0.5 µg/mL is recommended for WB. Human UPAR (isoform 1 precursor) has a predicted length of 335 amino acids and MW of 37 kDa. A concentration of 0.5-2.0 µg/mL is recommended for IHC to detect the protein in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is required. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rabbit anti-Vascular endothelial growth factor D (VEGF-D) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
VEGF-D belongs to the PDGF/VEGF growth factor family and is active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration as well as effects on the permeability of blood vessels (Ref: SWISSPROT).
A synthetic peptide (VIDEEWQRTQCSPRE) corresponding to a region (101-115 aa) from human Vascular endothelial growth factor D (VEGF-D).
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human VEGF-D (precursor) has a predicted length of 354 amino acids and MW of 40 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Mouse anti-Vimentin Monoclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
Vimentins are class-III intermediate filaments specific to mesenchymal tissue. Vimentin is an important cytoskeletal component responsible for maintaining cell integrity and has a probable role in the intracellular transport of proteins such as lipoproteins between the nucleus and plasma membrane. Immunohistochemical staining for Vimentin is characteristic of sarcomas.
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 0.5-1.0 µg/mL is recommended for WB. Human vimentin (precursor) has a predicted length of 466 residues and MW of 54 kDa. A concentration of 1.5-2.5 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
VIM;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human; mouse; rat;
X
We use cookies to help personalise and improve your web experience.
By using our website you consent to our use of cookies, some of which may have already been set on your device.
View our Cookie Policy to learn more.