The Nestin [IHC105] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Applications:
IHC
Clone number:
IHC105
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Tonsil, Glioma
Buffer:
Tris Buffer, pH 7.3 - 7.7, with 1% BSA and <0.1% Sodium Azide
The Nestin [IHC105] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Applications:
IHC
Clone number:
IHC105
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Tonsil, Glioma
Buffer:
Tris Buffer, pH 7.3 - 7.7, with 1% BSA and <0.1% Sodium Azide
Mouse anti-Nestin Monoclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Nestin is a member of the class IV intermediate filament protein family which is expressed in neuronal stem cells. The molecular weight of human Nestin as determined by SDS-PAGE mobility is about 240 kDa. However the real molecular weight is considerably less than this, at 177 kDa, the disparity being likely due to the highly charged region of the C-terminal segment. Nestin is relatively poorly conserved in protein sequence across species boundaries, so that the mouse and human proteins have an overall identity of only 62%. As a result antibodies to the human protein often fail to recognize the rodent homologue and vice versa. However this antibody stains both rodent and human Nestin. Antibodies to Nestin are widely used to identify neural stem cells.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Mouse
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Partial segment (region 317-630 aa) of human Nestin expressed in E.coli
Applications:
ICC,WB
Clone number:
4D11
Antibody Isotype:
IgG1, kappa
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Flow Cytometry. Suggested dilution for WB is 1:1,000-5,000 and 1:250-500 for IC. Use 2 ug/10^6 cells for Flow Cytometry. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Nestin; NES;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Schomann T et al. (2020) Multimodal imaging of hair follicle bulge-derived stem cells in a mouse model of traumatic brain injury. Cell Tissue Res. [Epub ahead of print]. Application: IHC/IF; Species: Mouse. Schomann T et al. (2017) Neuronal differentiation of hair-follicle-bulge-derived stem cells co-cultured with mouse cochlear modiolus explants. PLos One. 12(10):e0187183. Application: ICC/IF; Species: Mouse, Hair follicle bulge-derived neural crest-derived stem cells (HFBSCs). Gho CG et al. (2015) Isolation, expansion and neural differentiation of stem cells from human plucked hair- a further step towards autologous nerve recovery. Cytotechnology In press. Application: IF; Species: Human, Hair follicle bulge-derived neural crest-derived stem cells (HFBSCs), Keywords: Hair follicle stem cell, Regeneration, Neural crest, Neuron, Glia, Cryopreservation
Specificity:
This antibody is specific for the 240 kDa Nestin protein by WB on developing rat brain (P18) homogenate. A much weaker band at approx. 90 kDa may also be seen. This is suggested to be a breakdown product of the 240 kDa band. Human, Rodent
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
The Nestin [IHC105] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Applications:
IHC
Clone number:
IHC105
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Tonsil, Glioma
Buffer:
Tris Buffer, pH 7.3 - 7.7, with 1% BSA and <0.1% Sodium Azide
Rabbit anti-Nestin Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Required for brain and eye development. Promotes the disassembly of phosphorylated vimentin intermediate filaments (IF) during mitosis and may play a role in the trafficking and distribution of IF proteins and other cellular factors to daughter cells during progenitor cell division. Required for survival, renewal and mitogen-stimulated proliferation of neural progenitor cells (By similarity). Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Part of recombinant human protein (amino acids 315-630).
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunocytochemistry (1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human. Other species not tested.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Mouse anti-NeuN/Fox3 Monoclonal Antibody (Unconjugated), suitable for WB, ICC, IHC-Frozen.
Background Info:
Fox3 is one of a family of mammalian homologues of Fox-1. The Fox proteins are about 46 kDa in size, and each includes a central highly conserved RRM type RNA recognition motif. Much interest has focused on Fox3 as a result of the recent finding that this protein corresponds to NeuN, a neuronal nuclear antigen. NeuN/Fox-3 has a function in RNA splicing and is expressed heavily and specifically in neuronal nuclei and cytoplasm. Our antibody was raised against the N-terminal 100 amino acids of human Fox3 as expressed in and purified from E. coli. We did not use full length Fox3 as immunogen since the three mammalian Fox homologues, namely Fox1, Fox2 and Fox3, include virtually identical RRM motifs. The N-terminal region of the three molecules are much more variable in the three molecules so antibodies specific for each of the three molecules can therefore be generated.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Mouse
Species Reactivity:
Bovine,Human,Mouse,Pig,Rat
Immunogen:
Antibody was raised against the N-terminal 100 amino acids of human Fox3 as expressed in and purified from E. coli.
Applications:
ICC,IHC-Frozen,WB
Clone number:
1B7
Antibody Isotype:
IgG2a
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:1,000 - 1:2,000 is recommended for WB, ICC and IHC (frozen sections). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Feminizing locus on X; Fox-1; Fox3; NeuN;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Suzuki Y et al. (2022) "High-Throughput Screening Assay Identifies Berberine and Mubritinibas Neuroprotection Drugs for Spinal Cord Injury via Blood?Spinal Cord Barrier Protection." Neurotherapeutics. [Epub ahead of print] Application: IHC (IF). Species: Mouse. Yeh SJ et al. (2021) "Capping Protein Regulator and Myosin 1 Linker 3 (CARMIL3) as a Molecular Signature of Ischemic Neurons in the DWI-T2 Mismatch Areas After Stroke." Front Mol Neurosci. 14:754762. Application: IHC (IF). Species: Rat. Han Y & Zhou XF (2019) "Method of Producing Multipotent Stem Cells." US Patent US 10,196,606 B2 . Application: ICC (IF). Species: Human. Santos J et al. (2017) "Proteomic Analysis of Human Adipose Derived Stem Cells during Small Molecule Chemical Stimulated Pre-neuronal Differentiation." Int J Stem Cells. 2017; 10(2):193-217. Application: WB. Species: Human. Hamanoue M et al. (2016) "Cell-permeable p38 MAP kinase promotes migration of adult neural stem/progenitor cells" Sci Rep. 6:24279. Application: WB. Species: Mouse. Han YC et al. (2016) "Direct Reprogramming of Mouse Fibroblasts to Neural Stem Cells by Small Molecules" Stem Cells Int. 2016; 2016:4304916. Application: ICC (IF). Species: Mouse.
Specificity:
The specificity of this antibody has been confirmed by WB. Two alternate transcripts can be seen at 46 kDa and 48 kDa.
Storage:
Store lyophilized antibody at 2-8ºC for up to 12 months after date of receipt. After reconstitution of lyophilized antibody, aliquot and store at -20°C for up to 6 months for a higher stability. Avoid freeze-thaw cycles.
Neurofilaments are a group of intermediate filaments found abundantly around the axons of vertebrate neurons. They are also expressed in paragangliomas, adrenal pheochromocytomas, Merkel cell tumours, carcinoid tumours, neuroendocrine carcinomas of the skin, and oat cell carcinomas of the lung. Anti-Neurofilament stains a variety of neural, neuroendocrine, and endocrine tumours, such as neuromas, ganglioneuromas, gangliogliomas, ganglioneuroblastomas, and neuroblastomas.
Neurofilaments are a group of intermediate filaments found abundantly around the axons of vertebrate neurons. They are also expressed in paragangliomas, adrenal pheochromocytomas, Merkel cell tumours, carcinoid tumours, neuroendocrine carcinomas of the skin, and oat cell carcinomas of the lung. Anti-Neurofilament stains a variety of neural, neuroendocrine, and endocrine tumours, such as neuromas, ganglioneuromas, gangliogliomas, ganglioneuroblastomas, and neuroblastomas.
Rabbit anti-Neurofilament Heavy, phosphorylated and non-phosphorylated (pNF-H) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Neurofilaments contain three intermediate filament proteins: light (68 kDa), medium (160 kDa) and heavy (200 kDa). Neurofilament heavy (NF200 or NF-H) is phosphorylated and it is thought that this results in the formation of interfilament cross bridges that are important in the maintenance of axonal caliber.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Other Mammals (Predicted),Rat
Immunogen:
Purified rat NF-H construct containing most of the tandem KSP repeats expressed and purified from E.coli.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (IC). Suggested dilution for WB of 1:5,000-10,000. Suggested dilution for IC is 1:500-1,000. This antibody stains dendritic and perikaryal neurofilaments particularly well. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
NF-200; NF200; NF-H; NEFH; N52; Neurofilament heavy polypeptide; Neurofilament triplet H protein; 200 kDa neurofilament protein; KIAA0845; NFH;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB. This antibody reacts with noth phosphorylated NF-H at approx 200 kDa and non-phosphorylated NF-H at 160 kDa. Rat. Predicted to react with other mammals due to sequence homology.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
Neurofilament Heavy, phosphorylated and non-phosphorylated (pNF-H)
Neurofilaments contain three intermediate filament proteins: light (68 kDa), medium (160 kDa) and heavy (200 kDa). Neurofilament heavy (NF200 or NF-H) is phosphorylated and it is thought that this results in the formation of interfilament cross bridges that are important in the maintenance of axonal caliber.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Mouse
Species Reactivity:
Chicken,Other Mammals (Predicted),Pig,Rat
Immunogen:
Full length native protein (purified) from Pig spinal cord.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Clone number:
NAP4
Antibody Isotype:
IgG1
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (IHC) and Flow Cytometry (2 ug/10^6 cells). Suggested dilution for WB of 1:5,000-10,000. This antibody recognises NF-H in frozen sections, tissue culture and in formalin-fixed sections. Suggested dilution for IC is 1:500-1,000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
NF-200; NF200; NF-H; NEFH; N52; Neurofilament heavy polypeptide; Neurofilament triplet H protein; 200 kDa neurofilament protein; KIAA0845; NFH;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Boylan K. et al (2009) Immunoreactivity of the phosphorylated axonal neurofilament H subunit (pNF-H) in blood of ALS model rodents and ALS patients: evaluation of blood pNF-H as a potential ALS biomarker. J Neurochem. 2009 Dec;111(5):1182-91. Rangaraju S. et al (2009) Molecular architecture of myelinated peripheral nerves is supported by calorie restriction with aging. Aging Cell. 2009 Apr;8(2):178-91.
Specificity:
The specificity of this antibody has been confirmed by WB. This antibody recognises phosphorylated NF-H KSP (lysine-serine-proline) type sequences. In some species there is some cross-reactivity with the related KSP sequences found in subunit NF-M. Chicken, Rat. Predicted to react with mammals due to sequence homology.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Neurofilaments contain three intermediate filament proteins: light (68 kDa), medium (160 kDa) and heavy (200 kDa). Neurofilament heavy (NF200 or NF-H) is phosphorylated and it is thought that this results in the formation of interfilament cross bridges that are important in the maintenance of axonal caliber.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Horse,Human,Mouse,Pig,Rat
Immunogen:
Native NF-H purified from bovine spinal cord
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunocytochemistry (IHC). Suggested dilution for WB of 1:5,000-10,000. Suggested dilution for ICC/IHC is 1:1,000-1:5,000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
NF-200; NF200; NF-H; NEFH; N52; Neurofilament heavy polypeptide; Neurofilament triplet H protein; 200 kDa neurofilament protein; KIAA0845; NFH;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Hashiguchi S et al. (2019) "Ataxic phenotype with altered CaV3.1 channel property in a mouse model for spinocerebellar ataxia 42." Neurobiol Dis. Jun 20:104516 [Epub ahead of print]. Application: IHC. Species: Human.
Specificity:
The specificity of this antibody has been confirmed by WB. This antibody reacts with phosphorylated NF-H and is seen as a band of approx 200 kDa. Rat. Predicted to react with other mammals due to sequence homology.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Chicken anti-Neurofilament heavy polypeptide, phosphorylated (pNF-H) Polyclonal Antibody (Unconjugated), suitable for WB, ICC, IHC-Frozen.
Background Info:
Neurofilaments contain three intermediate filament proteins: light (68 kDa), medium (160 kDa) and heavy (200 kDa). Neurofilament heavy (NF200 or NF-H) is phosphorylated and it is thought that this results in the formation of interfilament cross bridges that are important in the maintenance of axonal caliber. This antibody binds primarily to the phosphorylated axonal forms of NF-H.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). Suggested dilution for WB is 1:20,000-50,000. Suggested dilution for ICC/IHC is 1:20,000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
NF-200; NF200; NF-H; NEFH; N52; Neurofilament heavy polypeptide; Neurofilament triplet H protein; 200 kDa neurofilament protein; KIAA0845; NFH;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Jarjour A.A. et al (2007) Maintenance of axo-oligodendroglial paranodal junctions requires DCC and netrin-1. J Neurosci. 2008 Oct 22;28(43):11003-14. Pearse D.D. et al (2007) Transplantation of Schwann cells and/or olfactory ensheathing glia into the contused spinal cord: Survival, migration, axon association, and functional recovery. Glia. 2007 Jul;55(9):976-1000. Shaw G. et al (2005) Hyperphosphorylated neurofilament NF-H is a serum biomarker of axonal injury. Biochem Biophys Res Commun. 2005 Nov 4;336(4):1268-77.
Specificity:
This antibody reacts with phosphorylated NF-H and is seen as a band of approx 200 kDa in WB. Refer to publication by Shaw et al (2005) for the use of this antibody in an ELISA to detect NF-H. Hu, Rat, Ms, Fel, Chk. Predicted to react with other mammalian tissues due to sequence homology.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
IgY
Target:
Neurofilament heavy polypeptide, phosphorylated (pNF-H)
Mouse anti-Neurofilament light (NF-L) Monoclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, ICC, FC.
Background Info:
Neurofilaments are composed of three intermediate filament proteins: light (NF-L ~68 kDa), medium (NF-M ~160 kDa) and heavy (NF-H ~200 kDa), found specifically in neurons, which are involved in the maintenance of the neuronal caliber. Neurofilament light (NF68 or NF-L) is the most abundant of the three proteins.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Mouse
Species Reactivity:
Bovine,Human,Mouse,Pig,Rat
Immunogen:
C-terminal peptide of human NF-L protein (amino acids 514-542). The antibody has been made against the peptide GEEEDTKESEEEEKKEESAGEEQVAKKKD with an N-terminal C added for coupling to KLH.
Applications:
FC,ICC,IHC-Frozen,WB
Clone number:
6H112
Antibody Isotype:
IgG1
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (IHC) and Flow Cytometry (2 ug per 10^6 cells). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:100 - 1:500 is recommended for IC and IH. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Mouse anti-Neurofilament light (NF-L) Monoclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, ICC, FC.
Background Info:
Neurofilaments are composed of three intermediate filament proteins: light (NF-L ~68 kDa), medium (NF-M ~160 kDa) and heavy (NF-H ~200 kDa), found specifically in neurons, which are involved in the maintenance of the neuronal caliber. Neurofilament light (NF68 or NF-L) is the most abundant of the three proteins.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Mouse
Species Reactivity:
Bovine,Human,Mouse,Pig,Rat
Immunogen:
Full length native protein purified from pig spinal cord. The antibody binds NF-L from a variety of species including human, rat and mouse.
Applications:
FC,ICC,IHC-Frozen,WB
Clone number:
7D1
Antibody Isotype:
IgG2b
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (IHC) and Flow Cytometry (2 ug per 10^6 cells). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:100 - 1:500 is recommended for IC and IH. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Mouse anti-Neurofilament light (NF-L) Monoclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, ICC, FC.
Background Info:
Neurofilaments are composed of three intermediate filament proteins: light (~68 kDa), medium (~160 kDa) and heavy (~200 kDa), which are involved in the maintenance of the neuronal caliber. Neurofilament light (NF68 or NF-L) is the most abundant of the three proteins.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Mouse
Species Reactivity:
Bovine,Cat,Chicken,Human,Mouse,Pig,Rat
Immunogen:
Enzymatically dephosphorylated full length pig NF-L protein. The antibody binding epitope has been mapped to a short peptide in the C-terminal tail region of the molecule within the sequence YYTSHVQEEQIEVEETIEA, amino acids 441-460 of the human sequence.
Applications:
FC,ICC,IHC-Frozen,WB
Clone number:
DA2
Antibody Isotype:
IgG1
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (IHC) and Flow Cytometry (2 ug per 10^6 cells). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:100 - 1:500 is recommended for IC and IH. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Neurofilaments are composed of three intermediate filament proteins: light (~68 kDa), medium (~160 kDa) and heavy (~200 kDa), which are involved in the maintenance of the neuronal caliber. Neurofilament light (NF68 or NF-L) is the most abundant of the three proteins.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Pig,Rat
Immunogen:
Recombinant full length human NF-L protein
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:10,000 - 1:20,000 is recommended for WB. A dilution of 1:2,000 - 1:5,000 is recommended for ICC/IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Neurofilaments are composed of three intermediate filament proteins: light (~68 kDa), medium (~160 kDa) and heavy (~200 kDa), which are involved in the maintenance of the neuronal caliber. Neurofilament light (NF68 or NF-L) is the most abundant of the three proteins.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Purified porcine NF-L from spinal cord and recombinant NF-L.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgY
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:1,000 - 1:5,000 is recommended for ICC and IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rangaraju S. et al (2009) Molecular architecture of myelinated peripheral nerves is supported by calorie restriction with aging. Aging Cell. 2009 Apr;8(2):178-91.
Specificity:
The specificity of this antibody has been confirmed by IC. Hu, Rat, Ms, Fel, Chk. Predicted to react with other mammalian tissues due to sequence homology.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Mouse anti-Neurofilament medium (NF-M) Monoclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, ICC, FC.
Background Info:
Neurofilaments are composed of three intermediate filament proteins: light (~68 kDa), medium (~160 kDa) and heavy (~200 kDa), which are involved in the maintenance of the neuronal caliber. Neurofilament medium runs on SDS-PAGE gels in the range 145-170 kDa, with some variation in different species.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Mouse
Species Reactivity:
Bovine,Cat,Chicken,Human,Mouse,Pig,Rat
Immunogen:
Raised against a recombinant fusion protein containing the extreme C-terminus of rat NF-M expressed in and purified from E. coli. The epitope is localized to within the last 56 amino acids at the extreme C-terminus of rat NF-M, the so-called KE segment which is highly conserved between NF-M molecules from different species.
Applications:
FC,ICC,IHC-Frozen,WB
Clone number:
3H11
Antibody Isotype:
IgG1
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (IHC) and Flow Cytometry. A dilution of 1:2,000 - 1:10,000 is recommended for WB. A dilution of 1:1,000 - 1:5,000 is recommended for IC and IH. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neurofilament medium polypeptide; NF-M; 160 kDa neurofilament protein; Neurofilament 3; Neurofilament triplet M protein; Nefm; Nef3; Nfm;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Felitsyn N. et al (2008) The heme precursor delta-aminolevulinate blocks peripheral myelin formation. J Neurochem. 2008 Sep;106(5):2068-79.
Specificity:
Specifically recognizes the medium neurofilament subunit NF-L in WB. Hu, Rat, Ms, Fel, Bov, Por, Chk
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Neurofilament Medium (NF-M) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, ICC.
Background Info:
Neurofilaments are composed of three intermediate filament proteins: light (~68 kDa), medium (~160 kDa) and heavy (~200 kDa), which are involved in the maintenance of the neuronal caliber. Neurofilament medium runs on SDS-PAGE gels in the range 145-170 kDa, with some variation in different species.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Chicken,Horse,Human,Mouse,Pig,Rat
Immunogen:
A recombinant fusion protein containing the extreme C-terminus of rat NF-M expressed in and purified from E. coli.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:1,000 - 1:5,000 is recommended for WB, ICC and IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neurofilament medium polypeptide; NF-M; 160 kDa neurofilament protein; Neurofilament 3; Neurofilament triplet M protein; Nefm; Nef3; Nfm;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specifically recognizes the medium neurofilament subunit NF-L in WB. Band appears at ~145 kDa in WB from rodent and ~160 kDa for human and bovine WB. Hu, Rat, Ms, Fel, Chk
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Chicken anti-Neurofilament medium polypeptide (NF-M) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded, ICC.
Background Info:
Neurofilaments are composed of three intermediate filament proteins: light (~68 kDa), medium (~160 kDa) and heavy (~200 kDa), which are involved in the maintenance of the neuronal caliber. Neurofilament medium runs on SDS-PAGE gels in the range 145-170 kDa, with some variation in different species.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Recombinant fusion protein containing the extreme C-terminal segment of rat NF-M.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgY
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:1,000 - 1:2,000 is recommended for ICC and IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neurofilament medium polypeptide; NF-M; 160 kDa neurofilament protein; Neurofilament 3; Neurofilament triplet M protein; Nefm; Nef3; Nfm;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Jarjour A.A. et al (2007) Maintenance of axo-oligodendroglial paranodal junctions requires DCC and netrin-1. J Neurosci. 2008 Oct 22;28(43):11003-14. Rangaraju S. et al (2009) Molecular architecture of myelinated peripheral nerves is supported by calorie restriction with aging. Aging Cell. 2009 Apr;8(2):178-91. Pearse D.D. et al (2007) Transplantation of Schwann cells and/or olfactory ensheathing glia into the contused spinal cord: Survival, migration, axon association, and functional recovery. Glia. 2007 Jul;55(9):976-1000. Shaw G. et al (2004) Characterization of the bovine neurofilament NF-M protein and cDNA sequence, and identification of in vitro and in vivo calpain cleavage sites. Biochem Biophys Res Commun. 2004 Dec 10;325(2):619-25.
Specificity:
Specifically recognizes the medium neurofilament subunit NF-L in WB. Band appears at ~145 kDa in WB from rodent and ~160 kDa for human and bovine WB. Hu, Rat, Ms, Fel, Chk. Predicted to react with other mammalian tissues due to sequence homology.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit Polyclonal Antibody to Neurofilament NF-L C-terminus (Unconjugated), suitable for WB, IF, ICC.
Background Info:
Neurofilaments are the 10nm or intermediate filament proteins found specifically in neurons, and are composed predominantly of three major proteins called NF-L, NF-M and NF-H, though other filament proteins may be included also. The major function of neurofilaments is likely to control the diameter of large axons. NF-L is the neurofilament light or low molecular weight polypeptide and runs on SDS-PAGE gels at 68-70kDa with some variability across species. Antibodies to NF-L are useful for identifying neuronal cells and their processes in cell culture and sectioned material. NF-L antibody can also be useful for the visualization of neurofilament rich accumulations seen in many neurological diseases, such as Lou Gehrigs disease (ALS), giant axon neuropathy, Charcot-Marie Tooth disease and others.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Pig,Rat
Immunogen:
C-terminal synthetic peptide of rat NF-L protein,(GEEEDTKESEEEEKKEESAGEEQAAKKKD) with an N-terminal Cys for coupling to KLH.
Applications:
FC,ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (IHC) and Flow Cytometry (2 ug per 10^6 cells). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:100 - 1:500 is recommended for IC and IH. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neurofilament light polypeptide; 68 kDa neurofilament protein; Neurofilament triplet L protein
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Physical State:
Solid
Product references:
Bacioglu M et al. (2016) Neurofilament light chain in blood and CSF as a marker of disease progression in mouse models and in neurodegenerative diseases. Neuron. 27292537 Application: Mouse and Human.
Specificity:
No cross reactivity with other proteins.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Neurofilaments are a group of intermediate filaments found abundantly around the axons of vertebrate neurons. They are also expressed in paragangliomas, adrenal pheochromocytomas, Merkel cell tumours, carcinoid tumours, neuroendocrine carcinomas of the skin, and oat cell carcinomas of the lung. Anti-Neurofilament stains a variety of neural, neuroendocrine, and endocrine tumours, such as neuromas, ganglioneuromas, gangliogliomas, ganglioneuroblastomas, and neuroblastomas.
Rabbit anti-Neurokinin-3 Receptor (NK-3R) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
FUNCTION: This is a receptor for the tachykinin neuropeptide neuromedin K (neurokinin B). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein. PTM: The anchoring of this receptor to the plasma membrane is probably mediated by the palmitoylation of a cysteine residue. MISCELLANEOUS: The rank order of affinity of this receptor to tachykinins is: neuromedin K > substance K > substance P. SIMILARITY: Belongs to the G-protein coupled receptor 1 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Rat
Immunogen:
A synthetic peptide (ASTTSSF ISSPYTSVDE YS) corresponding to the absolute C-terminal of rat NK-3 receptor protein (aa: 434-452) conjugated to KLH
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:500 to 1:2000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neuromedin K receptor; NKR; Neurokinin B receptor; NK-3 receptor; NK-3R; Tachykinin receptor 3; Tacr3; Tac3r
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity has been shown by western blot using rat brain homogenate. A band of 66 kDa, the theoretical MW of NK-3R, could be easily detected. This antiserum is know to cross react with rat NK-3 R.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Fox3 is one of a family of mammalian homologues of Fox-1. The Fox proteins are about 46 kDa in size, and each includes a central highly conserved RRM type RNA recognition motif. Much interest has focused on Fox3 as a result of the recent finding that this protein corresponds to NeuN, a neuronal nuclear antigen. NeuN/Fox-3 has a function in RNA splicing and is expressed heavily and specifically in neuronal nuclei and cytoplasm. Our antibody was raised against the N-terminal 100 amino acids of human Fox3 as expressed in and purified from E. coli. We did not use full length Fox3 as immunogen since the three mammalian Fox homologues, namely Fox1, Fox2 and Fox3, include virtually identical RRM motifs. The N-terminal region of the three molecules are much more variable in the three molecules so antibodies specific for each of the three molecules can therefore be generated.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Peptide corresponding to amino acids 5-24 of human FOX3 coupled to KLH.
Applications:
ICC,IHC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:500 - 1:1,000 is recommended for WB. A dilution of 1:5,000 - 1:10,000 is recommended for ICC and IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Feminizing locus on X; Fox-1; Fox3; NeuN; NeuN antigen; Neuronal nuclei antigen; Fox-1 homolog C; RNA binding protein fox-1 homolog 3
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Rabbit anti-Neuron specific enolase (NSE) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Enolase is a metalloenzyme that catayzes the reaction between 2-phospho-D-glycerate and phosphoenolpyruvate during glycolysis. Mammalian enolase is composed of 3 subunits; alpha, beta and gamma (Neuron-specific enolase). These subunits can form homodimers or heterodimers. The alpha/gamma heterodimer and the gamma/gamma homodimer are found primarily in neurons.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human Neuron Specific Enolase (NSE) expressed in and purified from E.coli
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:1,000 - 1:2,000 is recommended for WB. A dilution of 1:500 is recommended for ICC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Guinea Pig anti-Neuropeptide RFRP-3 Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Neuropeptide VF is the precursor of neuropeptides NPSF (RFRP-1), RFRP-2 and RFRP-3 (NPVF). RFRP-3 is reported to inhibit forskolin-induced production of cAMP. RFRP-3 has also been shown to block morphine-induced analgesia.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Guinea Pig
Species Reactivity:
Human,Rat,Sheep
Immunogen:
A synthetic peptide (VPNLPQRF) corresponding to the amino acids 124-131 from human Neuropeptide VF. Neuropeptide VF is the precursor of the neuropeptides NPSF (RFRP-1), RFRP-2 and RFRP-3. The synthetic peptide was conjugated to a carrier protein KLH to enhance the immunological response.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
Immunohistochemistry (IHC). A concentration of 1 in 2000 is recommended. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity was demonstrated by immunohistochemistry. This antibody is known to react with rat and sheep.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Neuropeptide Y (NPY) is a member of a regulatory peptide family and has a marked sequence homology with pancreatic polypeptide (PP) and peptide YY (PYY), which are other members of the family. In the rat central nervous system, immunohistochemistry has found NPY-like cell bodies in the cortex, caudate-putamen, hypothalamus (arcuate nucleus), hippocampus, anterior olfactory bulb, nucleus accumbens, amygdaloid complex and periaqueductal grey. NPY-like fibers and terminals are detected in high numbers in the bed nucleus of the stria terminalis, the peri- and paraventricular regions of the hypothalamus and thalamus and in discrete hypothalamic nuclei, particularly the suprachiasmatic nucleus. It has been used to detect NPY in a wide range of species including rat, mouse, human (1-7), fish, cat, bird, guinea pig, zebrafish, squirrels, frog, and newt.
Rabbit anti-Neuropeptide Y (NPY) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Neuropeptide Y is a 36 amino acid neurotransmitter found in the brain and autonomic nervous system. It has been associated with numerous physiologic processes in the brain, including the regulation of energy balance, memory and learning, and epilepsy. The main effect is increased food intake and decreased physical activity. It is also implicated in the secretion of gonadotrophin-release hormone. It is secreted by the hypothalamus and it is one of the most abundant peptides in the nervous system. It is also found in some chromaffin cells of the adrenal medulla. The sheep form of NPY is 94% homologous with human NPY.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat,Sheep
Immunogen:
Sheep Neuropeptide Y (29-64: NB. includes only the NPY peptide and not either of the flanking peptides) conjugated to keyhole limpet hemocyanin.
Corder KM et al. (2018) Prefrontal cortex-dependent innate behaviors are altered by selective knockdown of Gad1 in neuropeptide Y interneurons. PLoS One. 2018 Jul 19;13(7):e0200809 Application: IHC/IF, frozen sections.
Specificity:
Specificity has been confirmed by direct ELISA against the antigen. Sheep, Human, Mouse & Rat.
Storage:
Maintain lyophilized material at 2-8°C for up to 12 months. After reconstitution keep aliquots at -20°C for up to six months or at 2-8°C with an appropriate antibacterial agent for up to 4 weeks. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified on antigen column. Refer to vial label for antibody concentration after reconstitution.
The Neuropeptide Y Y1 Receptor was quality control tested using standard immunohistochemical methods. The antiserum demonstrates strongly positive labeling of rat cortex, arcuate and hippocampus using indirect immunofluorescent and biotin/avidin-HRP techniques. Recommended primary dilutions are 1/500 - 1/1000 in PBS - Bn/Av-HRP detection.
The antibody was characterized by immunohistochemistry and Western blot. Western blot showed one immunoreactive band of 40 kD and a single high molecular weight band, presumably a precursor molecule. Preincubation of the antibody with an excess of the synthetic peptide blocked staining. Immunohistochemical staining of rat brain correlates well with Northern analysis, in situ hybridization and receptor autoradiography. BlastP database sequence homology searches confirmed that this sequence is unique to rat, mouse and human NPY Y1 receptors.
The Neurotensin antiserum was quality control tested using standard immunohistochemical methods. The antiserum demonstrates strongly positive labeling of rat amygdala using indirect immunofluorescent and biotin/avidin-HRP techniques. Recommended primary dilutions are 1/200-1/400 in PBS/0.3% Triton x-100 - Cy3 Technique and 1/4000-1/8000 in PBS/0.3% Triton x-100 - Bn/Av-HRP Technique. Staining is completely eliminated by pretreatment with 10 µg of Neurotensin per 1 mL of diluted antibody.
Synthetic human Neurotensin peptide (151-163 aa) conjugated to BSA
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neuromedin N; NTS; NN; NmN; NT; NmN-125;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; rat. Highly conserved and expected to interact with bovine, feline and monkey
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
Chicken anti-Neurotrophin-3 (NT-3) Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
FUNCTION: Seems to promote the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse
Immunogen:
Mixture of two human NT3 peptides (90-104 and 199-214 aa).
Applications:
ELISA
Antibody Isotype:
IgY
Application Details:
ELISA at suggested dilution of 1:500-1:2,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
The Biosensis NT3 Rapid TM enzyme-linked immune-sorbent assay (ELISA) Kit is a sandwich ELISA that allows the specific, fast and reliable quantification of NT3 in less than 4 hours in cell culture supernatants and human plasma (EDTA and citrate) only if used as directed. Please refer to the kit protocol for specific use instructions for each substrate application, in particular human plasma. Accurate quantification of NT3 in human plasma requires a heterophilic antibody (HA) blocker which can be purchased separately ( BL-004-500 ). This ELISA kit consists of a pre-coated polyclonal anti-NT3 capture antibody, a biotinylated monoclonal anti-NT3 detection antibody and horseradish peroxidase (HRP)-conjugated streptavidin. The addition of a substrate (3,3',5,5'-tetramethylbenzidine, TMB) yields a colored reaction product, which is directly proportional to the concentration of NT3 present in samples and protein standards. This NT3 Rapid TM ELISA kit employs a recombinant human NT3 standard. NT3 is highly conserved and nearly identical in many species. The assay's capture and detection antibodies detect NT3 from other species including mouse, rat and monkey, thus it is expected that this NT3 Rapid TM ELISA will also react with those species and possibly more because of the conversation of the immunogen used. The antibodies used in this kit bind to epitopes within the mature domain of NT3. Thus, this ELISA kit may detect the full-length pro-form of NT3. This kit has not been tested for other applications. Sufficient amount of NT3 standard is supplied to allow for spike- and recovery experiments in order to validate this ELISA assay for other sample matrices if required. This kit has been configured for research use only and is not to be used in diagnostic or clinical procedures.
Background Info:
NT3 is understood to be important in promote the survival of visceral and proprioceptive sensory neurons. It is a secreted protein that belongs to the NGF-beta family and is found in brain and peripheral tissues.
Product Type:
ELISA Assay
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Human recombinant NT3, made in E.coli
Applications:
ELISA
Application Details:
ELISA. For the quantification of Neurotrophin-3 (NT-3) in Culture Supernatant, Plasma (Citrate), Plasma (EDTA). Please download the detailed product insert for complete instructions for the successful use of this ELISA. Use only as directed.
The ELISA kit box contains 96-well pre-coated strip plate, protein standards, detection reagents, wash and sample buffers, substrate buffer and detailed protocols.
Product references:
Possamai-Della T et al. (2022) Imipramine Can Be Effective on Depressive-Like Behaviors, but Not on Neurotrophic Factor Levels in an Animal Model for Bipolar Disorder Induced by Ouabain Mol Neurobiol. [Epub ahead of print] Application: Rat, brain tissue homogenate. March B et al. (2021) ELISA-based quantification of neurotrophic growth factors in urine from prostate cancer patients. FASEB Bioadv. [Epub ahead of print]. Application: Human urine. Bavaresco DV et al. (2018) Depressive symptoms and neurotrophin levels in ostomy patients. J Bras Psiquiatr. 67(3). Application: Human serum. Shen W et al. (2017) Effects of Ranibizumab and Aflibercept on Human Mueller Cells and Photoreceptors under Stress Conditions. Int J Mol Sci. 2017 Mar 1;18(3). pii: E533. doi: 10.3390/ijms18030533. Application: Human cell line supernatants.
Specificity:
Human. The capture and detection antibodies used detect NT3 from other species including mouse, rat and monkey, thus it is expected that this NT3 Rapid ELISA will also react with those species.
The Biosensis NT3 Rapid TM enzyme-linked immune-sorbent assay (ELISA) Kit is a sandwich ELISA that allows the specific, fast and reliable quantification of NT3 in less than 4 hours in cell culture supernatants and human plasma (EDTA and citrate) only if used as directed. Please refer to the kit protocol for specific use instructions for each substrate application, in particular human plasma. Accurate quantification of NT3 in human plasma requires a heterophilic antibody (HA) blocker which can be purchased separately ( BL-004-500 ). This ELISA kit consists of a pre-coated polyclonal anti-NT3 capture antibody, a biotinylated monoclonal anti-NT3 detection antibody and horseradish peroxidase (HRP)-conjugated streptavidin. The addition of a substrate (3,3',5,5'-tetramethylbenzidine, TMB) yields a colored reaction product, which is directly proportional to the concentration of NT3 present in samples and protein standards. This NT3 Rapid TM ELISA kit employs a recombinant human NT3 standard. NT3 is highly conserved and nearly identical in many species. The assay's capture and detection antibodies detect NT3 from other species including mouse, rat and monkey, thus it is expected that this NT3 Rapid TM ELISA will also react with those species and possibly more because of the conversation of the immunogen used. The antibodies used in this kit bind to epitopes within the mature domain of NT3. Thus, this ELISA kit may detect the full-length pro-form of NT3. This kit has not been tested for other applications. Sufficient amount of NT3 standard is supplied to allow for spike- and recovery experiments in order to validate this ELISA assay for other sample matrices if required. This kit has been configured for research use only and is not to be used in diagnostic or clinical procedures.
Background Info:
NT3 is understood to be important in promote the survival of visceral and proprioceptive sensory neurons. It is a secreted protein that belongs to the NGF-beta family and is found in brain and peripheral tissues.
Product Type:
ELISA Assay
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Human recombinant NT3, made in E.coli
Applications:
ELISA
Application Details:
ELISA. For the quantification of Neurotrophin-3 (NT-3) in Culture Supernatant, Plasma (Citrate), Plasma (EDTA). Please download the detailed product insert for complete instructions for the successful use of this ELISA. Use only as directed.
The ELISA kit box contains 96-well pre-coated strip plates, protein standards, detection reagents, wash and sample buffers, substrate buffer and detailed protocols.
Product references:
Possamai-Della T et al. (2022) Imipramine Can Be Effective on Depressive-Like Behaviors, but Not on Neurotrophic Factor Levels in an Animal Model for Bipolar Disorder Induced by Ouabain Mol Neurobiol. [Epub ahead of print] Application: Rat, brain tissue homogenate. March B et al. (2021) ELISA-based quantification of neurotrophic growth factors in urine from prostate cancer patients. FASEB Bioadv. [Epub ahead of print]. Application: Human urine. Bavaresco DV et al. (2018) Depressive symptoms and neurotrophin levels in ostomy patients. J Bras Psiquiatr. 67(3). Application: Human serum. Shen W et al. (2017) Effects of Ranibizumab and Aflibercept on Human Mueller Cells and Photoreceptors under Stress Conditions. Int J Mol Sci. 2017 Mar 1;18(3). pii: E533. doi: 10.3390/ijms18030533. Application: Human cell line supernatants.
Specificity:
Human. The capture and detection antibodies used detect NT3 from other species including mouse, rat and monkey, thus it is expected that this NT3 ELISA will also react with those species.
FUNCTION: Seems to promotes the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Chicken,Human,Rat
Immunogen:
Recombinant human NT3
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A dilution of 1:500 to 1:1000 is recommended for IHC, ELISA and western blot. For inhibition of biological activity: 1:10-50 for in vitro, 2-10 µL/g body weight for in vivo. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% to mouse NGF, recombinant human BDNF and 5% to NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Seems to promote the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human (aa: 139-149), mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A dilution of 1:500 to 1:2000 is recommended for IHC, western blot. For inhibition of biological activity: 1:10-50 for in vitro, 5-10 µL/g body weight for in vivo. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human (aa: 139-149), mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Seems to promotes the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS with no preservatives.
Host Animal:
Rabbit
Species Reactivity:
Chicken,Human,Rat
Immunogen:
Recombinant human NT3
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% to mouse NGF, recombinant human BDNF and 5% to NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Seems to promotes the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human (aa: 139-149), mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Feron F et al (2008) Neurotrophin expression in the adult olfactory epithelium. Brain Res. 1196:13-21 Application: IHC ; Species: Rat
Specificity:
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
Recombinant human NT3
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA, WB, dot blot, inhibition of biological activity. A dilution of 1:200 to 1:2000 is recommended for IHC, ELISA and western blot. For inhibition of biological activity: 1:10-50 for in vitro, 5-10 µL/g body weight for in vivo. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% to mouse NGF, recombinant human BDNF and 5% to NT4/5 has been shown by 1-site ELISA. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human, mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A dilution of 1:500 to 1:2000 is recommended for IHC, western blot. For inhibition of biological activity: 1:10-50 for in vitro, 5-10 µL/g body weight for in vivo. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human, mouse and rat NT3 protein conjugated to BSA
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
Recombinant human NT3
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. This antiserum will neutralise NT3 but not other neurotrophins. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% to mouse NGF, recombinant human BDNF and 5% to NT4/5 has been shown by 1-site ELISA. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Seems to promotes the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human, mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Chicken anti-Neurotrophin-4/5 (NT-4/5) Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse
Immunogen:
Mixture of two human NT4/NT5 peptides (104-118 and 198-210 aa).
Applications:
ELISA
Antibody Isotype:
IgY
Application Details:
ELISA at suggested dilution of 1:500-1:2,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
The Biosensis Neurotrophin 4/5 Rapid TM enzyme-linked immunosorbent assay (ELISA) Kit is a sandwich ELISA that allows the specific, fast and reliable quantification of NT4/5 in less than 4 hours in cell culture supernatants, human citrate-plasma and brain extracts only if used as directed. Please refer to the kit protocol for specific use instructions for each substrate application, in particular blood samples. Accurate quantification of NT4/5 in human citrate-plasma requires a heterophilic antibody (HA) blocker which can be purchased separately ( BL-003-1000 ). This ELISA kit consists of a pre-coated polyclonal anti-NT4/5 capture antibody, a biotinylated anti-NT4/5 detection antibody and horseradish peroxidase (HRP)-conjugated streptavidin. The addition of a substrate (3,3',5,5'-tetramethylbenzidine, TMB) yields a colored reaction product, which is directly proportional to the concentration of NT4/5 present in samples and protein standards. This NT4/5 ELISA kit employs a recombinant human NT4/5 standard. The capture and detection antibodies will also detect NT4/5 from other species due to a high degree of NT4/5 amino acid sequence homology. Therefore, this ELISA kit can be used to quantify NT4/5 in many species including mouse, rat and monkey. The antibodies used in this kit bind to epitopes within the mature domain of NT4/5. Thus, this ELISA kit will quantify the mature form of NT4/5, and may also detect the full-length pro-form of NT4/5. This ELISA kit has not been tested for other applications. It has been configured for research use only and is not to be used for diagnostic or clinical procedures.
Background Info:
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
ELISA Assay
Species Reactivity:
Human,Mouse,Primate,Rat
Immunogen:
Recombinant human NT4/5, made in E.coli
Applications:
ELISA
Application Details:
ELISA. For the quantification of Neurotrophin-4/5 (NT-4/5) in Culture Supernatant, Plasma (Citrate), Tissue Homogenates. Please download the detailed product insert for complete instructions for the successful use of this ELISA. Use only as directed.
The ELISA kit box contains 96-well pre-coated strip plate, protein standards, detection reagents, wash and sample buffers, substrate buffer and detailed protocols.
Product references:
March B et al. (2021) ELISA-based quantification of neurotrophic growth factors in urine from prostate cancer patients. FASEB Bioadv. [Epub ahead of print]. Application: Human urine. Ishimoto T et al. (2018) Ergothioneine-induced neuronal differentiation is mediated through activation of S6K1 and neurotrophin 4/5-TrkB signaling in murine neural stem cells. Cell Signal. [Epub ahead of print]. Application: Mouse cell lysate and brain homogenate. Allen RS et al. (2018) TrkB signaling pathway mediates the protective effects of exercise in the diabetic rat retina. Eur J Neurosci. doi: 10.1111/ejn.13909. [Epub ahead of print]. Application: Rat retina homogenates. Maejima H et al. (2017) Exercise enhances cognitive function and neurotrophin expression in the hippocampus accompanied by changes in epigenetic programming in senescence-accelerated mice. Neurosci Lett. doi: 10.1016/j.neulet.2017.11.023. [Epub ahead of print]. Application: Mouse hippocampus homogenates. Takahashi K et al. (2016) Exercise combined with low-level GABAA receptor inhibition up-regulates the expression of neurotrophins in the motor cortex. Neurosci Lett. doi: 10.1016/j.neulet.2016.10.052. [Epub ahead of print]. Application: Mouse cortex homogenates, in native cell lysis buffer.
Specificity:
Human. The capture and detection antibodies will also detect NT4/5 from other species due to a high degree of NT4/5 amino acid sequence homology. Therefore, this ELISA kit can be used to quantify NT4/5 in many species including mouse, rat and monkey.
The Biosensis Neurotrophin 4/5 Rapid TM enzyme-linked immunosorbent assay (ELISA) Kit is a sandwich ELISA that allows the specific, fast and reliable quantification of NT4/5 in less than 4 hours in cell culture supernatants, human citrate-plasma and brain extracts only if used as directed. Please refer to the kit protocol for specific use instructions for each substrate application, in particular blood samples. Accurate quantification of NT4/5 in human citrate-plasma requires a heterophilic antibody (HA) blocker which can be purchased separately ( BL-003-1000 ). This ELISA kit consists of a pre-coated polyclonal anti-NT4/5 capture antibody, a biotinylated anti-NT4/5 detection antibody and horseradish peroxidase (HRP)-conjugated streptavidin. The addition of a substrate (3,3',5,5'-tetramethylbenzidine, TMB) yields a colored reaction product, which is directly proportional to the concentration of NT4/5 present in samples and protein standards. This NT4/5 ELISA kit employs a recombinant human NT4/5 standard. The capture and detection antibodies will also detect NT4/5 from other species due to a high degree of NT4/5 amino acid sequence homology. Therefore, this ELISA kit can be used to quantify NT4/5 in many species including mouse, rat and monkey. The antibodies used in this kit bind to epitopes within the mature domain of NT4/5. Thus, this ELISA kit will quantify the mature form of NT4/5, and may also detect the full-length pro-form of NT4/5. This ELISA kit has not been tested for other applications. It has been configured for research use only and is not to be used for diagnostic or clinical procedures.
Background Info:
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
ELISA Assay
Species Reactivity:
Human,Mouse,Primate,Rat
Immunogen:
Recombinant human NT4/5, made in E.coli
Applications:
ELISA
Application Details:
ELISA. For the quantification of Neurotrophin-4/5 (NT-4/5) in Culture Supernatant, Plasma (Citrate), Tissue Homogenates. Please download the detailed product insert for complete instructions for the successful use of this ELISA. Use only as directed.
The ELISA kit box contains 96-well pre-coated strip plates, protein standards, detection reagents, wash and sample buffers, substrate buffer and detailed protocols.
Product references:
March B et al. (2021) ELISA-based quantification of neurotrophic growth factors in urine from prostate cancer patients. FASEB Bioadv. [Epub ahead of print]. Application: Human urine. Ishimoto T et al. (2018) Ergothioneine-induced neuronal differentiation is mediated through activation of S6K1 and neurotrophin 4/5-TrkB signaling in murine neural stem cells. Cell Signal. [Epub ahead of print]. Application: Mouse cell lysate and brain homogenate. Allen RS et al. (2018) TrkB signaling pathway mediates the protective effects of exercise in the diabetic rat retina. Eur J Neurosci. doi: 10.1111/ejn.13909. [Epub ahead of print]. Application: Rat retina homogenates. Maejima H et al. (2017) Exercise enhances cognitive function and neurotrophin expression in the hippocampus accompanied by changes in epigenetic programming in senescence-accelerated mice. Neurosci Lett. doi: 10.1016/j.neulet.2017.11.023. [Epub ahead of print]. Application: Mouse hippocampus homogenates. Takahashi K et al. (2016) Exercise combined with low-level GABAA receptor inhibition up-regulates the expression of neurotrophins in the motor cortex. Neurosci Lett. doi: 10.1016/j.neulet.2016.10.052. [Epub ahead of print]. Application: Mouse cortex homogenates, in native cell lysis buffer.
Specificity:
Human. The capture and detection antibodies will also detect NT4/5 from other species due to a high degree of NT4/5 amino acid sequence homology. Therefore, this ELISA kit can be used to quantify NT4/5 in many species including mouse, rat and monkey.
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Primate,Rat
Immunogen:
Recombinant human NT4
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA (1 site), Western Blot, inhibition of biological activity in vitro/in vivo. Recommended to be used at a dilution of 1:500 to 1:2000 for immunohistochemistry, ELISA and Western blot. 1:10 to 1:50 for inhibition of biological activity in vitro. Use neat for in vivo studies at 5-10 µL/g body weight. Note that the concentration of NT4 is generally low in most tissues nevertheless, neonatal testes of rat can be used as a good positive control. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Less than 1% cross-reactivity against NGF, recombinant human BDNF and 5% to NT3 has been shown by 1-site ELISA. Known to react with NT4 from rat and human, mouse and monkey.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Primate,Rat
Immunogen:
Recombinant human NT4
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA (1 site), Western Blot, ICC, inhibition of biological activity in vitro/in vivo. Recommended to be used at a concentration of 1-10 µg/mL for immunohistochemistry, ELISA, ICC and Western blot and inhibition of biological activity in vitro. Use neat for in vivo studies at 2-10 µg/mL (ED50). Note that the concentration of NT4 is generally low in most tissues nevertheless, neonatal testes of rat can be used as a good positive control. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Less than 1% cross-reactivity against NGF, recombinant human BDNF and 5% to NT3 has been shown by dot blot. Known to react with NT4 from rat and human, mouse and monkey.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Primate,Rat
Immunogen:
Recombinant human NT4
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA (1 site), Western Blot, dot blot, inhibition of biological activity in vitro/in vivo. Recommended to be used at a dilution of 1:500 to 1:2000 for immunohistochemistry, ELISA and Western blot. 1:10 to 1:50 for inhibition of biological activity in vitro. Use neat for in vivo studies at 5-10 µL/g body weight. Note that the concentration of NT4 is generally low in most tissues nevertheless, neonatal testes of rat can be used as a good positive control. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Less than 1% cross-reactivity against NGF, recombinant human BDNF and 5% to NT3 has been shown by 1-site ELISA. Known to react with NT4 from rat and human, mouse and monkey.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Primate,Rat
Immunogen:
Recombinant human NT4
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA (1 site), Western Blot, inhibition of biological activity in vitro/in vivo. Recommended to be used at a concentration of 2-10 µg/mL for immunohistochemistry, ELISA and Western blot and inhibition of biological activity in vitro. Use neat for in vivo studies at 2-10 µg/mL (ED50). Note that the concentration of NT4 is generally low in most tissues nevertheless, neonatal testes of rat can be used as a good positive control. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Beros J et al. (2021) Age Related Response of Neonatal Rat Retinal Ganglion Cells to Reduced TrkB Signaling in vitro and in vivo. Front Cell Dev Biol. 9:671087. Application: Rat, Block/Inhibit. Beros J (2020) Pretreatment of ovaries with collagenase before vitrification keeps the ovarian reserve by maintaining cell-cell adhesion integrity in ovarian follicles. PhD Thesis Application: Rat, Block/Inhibit. Feron F et al. (2008) Neurotrophin expression in the adult olfactory epithelium. Brain Res. 1196:13-21 Application: Rat, IHC.
Specificity:
Less than 1% cross-reactivity against NGF, recombinant human BDNF and 5% to NT3 has been shown by dot blot. Known to react with NT4 from rat and human, mouse and monkey.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Neurotrophins are growth factors that regulate neuronal development, maintenance and plasticity. These homo-dimeric proteins activate a multitude of intracellular signalling cascades through their interaction with Trk receptors and p75NTR. The Neurotrophin Antibody Kit (Trial Size) contains a collection of Biosensis' popular sheep antibodies raised against BDNF ( S-015-500 ), NGF ( S-052-500 ), NT3 ( S-057-500 ) and NT4/5 ( S-059-500 ). The kit is completed with one vial of normal sheep IgG ( S-1754-100 ) for use as negative control. This kit presents a cost-effective way to investigate neurotrophin protein expression and function by immunological techniques such as immunohistochemistry, ELISA, and inhibition of biological activity.
Background Info:
Neurotrophins are growth factors that regulate neuronal development, maintenance and plasticity. These homo-dimeric proteins activate a multitude of intracellular signalling cascades through their interaction with Trk receptors and p75NTR. <br /><br />The Neurotrophin Antibody Kit (Trial Size) contains a collection of Biosensis' popular sheep antibodies raised against BDNF (<a class="newA" target="_blank" href="https://www.biosensis.com/sheep-antibody-bdnf-p-61.htmL">S-015-500</a>), NGF (<a class="newA" target="_blank" href="https://www.biosensis.com/sheep-antibody-beta-p-164.htmL">S-052-500</a>), NT3 (<a class="newA" target="_blank" href="https://www.biosensis.com/sheep-antibody-p-172.htmL">S-057-500</a>) and NT4/5 (<a class="newA" target="_blank" href="https://www.biosensis.com/sheep-antibody-p-176.htmL">S-059-500</a>). The kit is completed with one vial of normal sheep IgG (<a class="newA" target="_blank" href="https://www.biosensis.com/normal-sheep-from-immunized-animal-protein-purified-p-1585.htmL">S-1754-100</a>) for use as negative control. This trial size of Biosensis' Neurotrophin Antibody Kit contains 100 ?g sheep IgG of each antibody.<br /><br />This kit presents a cost-effective way to investigate neurotrophin protein expression and function by immunological techniques such as immunohistochemistry, ELISA, and inhibition of biological activity.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4, without preservatives.
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
BDNF: recombinant human BDNF<br>NGF: native mouse beta NGF purified from submaxillary salivary gland (95% purity by PAGE)<br>NT3: recombinant human NT3<br>NT4/5: recombinant human NT4
Applications:
IHC,Neutralize
Antibody Isotype:
IgG
Application Details:
<b>Immunohistochemistry</b>: 1-10 µg/mL. BDNF antibody works best on Zamboni's fixed, frozen tissue, and is not recommended for paraffin-embedded tissue.<br><b>ELISA:</b> 1-10 µg/mL.<br><b>Western Blotting:</b> 1-10 µg/mL. Western blotting is not recommended for the BDNF antibody.<br><b>Inhibition of biological activity in vitro/in vivo:</b> Expected ED50 (in vivo) values are in the range of 2-10 µg/mL. The NGF antibody completely inhibits neuronal survival and the outgrowth actions of murine NGF in chicken DRG in vitro.<br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user. The negative control (normal sheep IgG) should be used at the same concentration as the neurotrophin antibodies.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
BDNF Antibody: A cross-reactivity of less than 1% against mouse NGF, recombinant human NT3 or NT4/5 has been shown by ELISA. NGF Antibody: A cross-reactivity of less than 1% against recombinant human BDNF, NT3 and NT4/5 by ELISA has been shown. NT3 Antibody: A cross-reactivity of less than 1% to mouse NGF, recombinant human BDNF and 5% to NT4/5 has been shown by ELISA. NT4/5 Antibody: Less than 1% cross-reactivity against NGF, recombinant human BDNF and 5% to NT3 has been shown by dot blot. Neurotrophins share a large degree of homology among human, rodent and other mammalian species, thus these neurotrophin antibodies are useful for a number of species, including human, mouse and rat.
Storage:
Store lyophilized, unopened vials at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Neurotrophins are growth factors that regulate neuronal development, maintenance and plasticity. These homo-dimeric proteins activate a multitude of intracellular signalling cascades through their interaction with Trk receptors and p75NTR. The Neurotrophin Antibody Kit (Trial Size) contains a collection of Biosensis' popular sheep antibodies raised against BDNF ( S-015-500 ), NGF ( S-052-500 ), NT3 ( S-057-500 ) and NT4/5 ( S-059-500 ). The kit is completed with one vial of normal sheep IgG ( S-1754-100 ) for use as negative control. This kit presents a cost-effective way to investigate neurotrophin protein expression and function by immunological techniques such as immunohistochemistry, ELISA, and inhibition of biological activity.
Background Info:
Neurotrophins are growth factors that regulate neuronal development, maintenance and plasticity. These homo-dimeric proteins activate a multitude of intracellular signalling cascades through their interaction with Trk receptors and p75NTR. <br /><br />The Neurotrophin Antibody Kit (Trial Size) contains a collection of Biosensis' popular sheep antibodies raised against BDNF (<a href="https://www.biosensis.com/sheep-antibody-bdnf-p-61.htmL" target="_blank" class="newA">S-015-500</a>), NGF (<a href="https://www.biosensis.com/sheep-antibody-beta-p-164.htmL" target="_blank" class="newA">S-052-500</a>), NT3 (<a href="https://www.biosensis.com/sheep-antibody-p-172.htmL" target="_blank" class="newA">S-057-500</a>) and NT4/5 (<a href="https://www.biosensis.com/sheep-antibody-p-176.htmL" target="_blank" class="newA">S-059-500</a>). The kit is completed with one vial of normal sheep IgG (<a href="https://www.biosensis.com/normal-sheep-from-immunized-animal-protein-purified-p-1585.htmL" target="_blank" class="newA">S-1754-100</a>) for use as negative control. This full size version of Biosensis' Neurotrophin Antibody Kit contains 500 ?g sheep IgG of each antibody.<br /><br />This kit presents a cost-effective way to investigate neurotrophin protein expression and function by immunological techniques such as immunohistochemistry, ELISA, and inhibition of biological activity.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4, without preservatives.
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
BDNF: recombinant human BDNF<br>NGF: native mouse beta NGF purified from submaxillary salivary gland (95% purity by PAGE)<br>NT3: recombinant human NT3<br>NT4/5: recombinant human NT4
Applications:
IHC,Neutralize
Antibody Isotype:
IgG
Application Details:
<b>Immunohistochemistry</b>: 1-10 µg/mL. BDNF antibody works best on Zamboni's fixed, frozen tissue, and is not recommended for paraffin-embedded tissue.<br><b>ELISA:</b> 1-10 µg/mL.<br><b>Western Blotting:</b> 1-10 µg/mL. Western blotting is not recommended for the BDNF antibody.<br><b>Inhibition of biological activity in vitro/in vivo:</b> Expected ED50 (in vivo) values are in the range of 2-10 µg/mL. The NGF antibody completely inhibits neuronal survival and the outgrowth actions of murine NGF in chicken DRG in vitro.<br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user. The negative control (normal sheep IgG) should be used at the same concentration as the neurotrophin antibodies.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
BDNF Antibody: A cross-reactivity of less than 1% against mouse NGF, recombinant human NT3 or NT4/5 has been shown by ELISA. NGF Antibody: A cross-reactivity of less than 1% against recombinant human BDNF, NT3 and NT4/5 by ELISA has been shown. NT3 Antibody: A cross-reactivity of less than 1% to mouse NGF, recombinant human BDNF and 5% to NT4/5 has been shown by ELISA. NT4/5 Antibody: Less than 1% cross-reactivity against NGF, recombinant human BDNF and 5% to NT3 has been shown by dot blot. Neurotrophins share a large degree of homology among human, rodent and other mammalian species, thus these neurotrophin antibodies are useful for a number of species, including human, mouse and rat.
Storage:
Store lyophilized, unopened vials at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Mouse anti-Neurturin Monoclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Neurturin (NTN) is a member of the GDNF family of neurotrophic factors. This protein is a potent survival factor for several populations of central and peripheral neurons in mature and developing rodents. FUNCTION: Supports the survival of sympathetic neurons in culture. May regulate the development and maintenance of the CNS. Might control the size of non-neuronal cell population such as haemopoietic cells. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. DISEASE: Defects in NRTN are a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, and possibly with other loci, defects in NRTN are involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
PBS pH 7.4, with 0.1% sodium azide
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant human NRTN protein produced using CHO-based suspension cell line. Protein was purified from the cell culture supernatant.
Applications:
WB
Clone number:
1B11
Antibody Isotype:
IgG1
Application Details:
Western blot (WB) at a suggested dilution of 1:5,000-1:10,000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human NTN (Neurturin)
Storage:
Store at -20°C or -70°C upon receipt. After opening divide antibody into smaller aliquots and store at -20°C or -70°C for up to six months. Avoid multiple freeze-thaw cycles as product degradation may result.
Rabbit anti-Neurturin (NTN) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
<span itemprop="description">Neurturin (NTN) is a member of the GDNF family of neurotrophic factors. This protein is a potent survival factor for several populations of central and peripheral neurons in mature and developing rodents. FUNCTION: Supports the survival of sympathetic neurons in culture. May regulate the development and maintenance of the CNS. Might control the size of non-neuronal cell population such as haemopoietic cells. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. DISEASE: Defects in NRTN are a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, and possibly with other loci, defects in NRTN are involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.</span>
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Concentrated ammonium sulphate in PBS pH 7.4.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant human NRTN protein produced using CHO-based suspension cell line. Protein was purified from the cell culture supernatant.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western blot (WB) at a suggested dilution of 1:500-1:1,000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Antibody does not show cross-reactivity to other GDNF-family proteins.
Storage:
Store at 2-8°C upon receipt. As product is (NH4)2SO4 (ammonium sulfate) precipitate, mix well by pipetting or vortexing prior to use.
Rabbit anti-Neurturin (NTN) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Neurturin (NTN) is a member of the GDNF family of neurotrophic factors. This protein is a potent survival factor for several populations of central and peripheral neurons in mature and developing rodents. FUNCTION: Supports the survival of sympathetic neurons in culture. May regulate the development and maintenance of the CNS. Might control the size of non-neuronal cell population such as haemopoietic cells. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. DISEASE: Defects in NRTN are a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, and possibly with other loci, defects in NRTN are involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human Neurturin (rh NTN)
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
Immunohistochemistry (IHC) at a suggested dilution of 1:2000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
NRTN; NTN;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity of this product was demonstrated by immunohistochemistry and dot blot showed no cross reactivity with GDNF. This antibody is known to react with human, mouse and rat.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Neurturin (NTN) is a member of the GDNF family of neurotrophic factors. This protein is a potent survival factor for several populations of central and peripheral neurons in mature and developing rodents. FUNCTION: Supports the survival of sympathetic neurons in culture. May regulate the development and maintenance of the CNS. Might control the size of non-neuronal cell population such as haemopoietic cells. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. DISEASE: Defects in NRTN are a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, and possibly with other loci, defects in NRTN are involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human Neurturin (rh NTN)
Applications:
ELISA,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, immunoblot, 1-site ELISA. Recommended to be used at a dilution of 1:2000-3000 for immunohistochemistry and Western blot, 1: 2000 to 1:4000 for ELISA. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neurturin; NRTN;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Dot blot shows no cross reactivity to GDNF. This antibody is known to react with human, mouse and rat. Not yet tested against other species.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Nerve growth factor (NGF) receptor, also known as p75NTR, is a low affinity NGF receptor. It binds with equal affinity neurotrophins such as beta NGF, BDNF, NT-3 and NT-4. NGF receptors mediate signaling of neurotrophins for neuronal survival, apoptosis, neurite outgrowth and synaptic plasticity. These receptors are also thought to play a role in neurogenerative diseases such as Alzheimers disease. The NGF receptor is a type I transmembrane glycoprotein (399 aa) consisting of a signal peptide (28 aa), an extracellular domain (222 aa) which contains four cysteine rich domains responsible for ligand binding, a transmembrane domain (22 aa) and a cytoplasmic domain (155 aa).
Product Type:
Protein
Format:
The NGF Receptor-Fc chimera consists of 25-45% carbohydrate by weight.
Lyophilized products should be stored at 2-8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE and visualized by silver stain
Nerve growth factor (NGF) receptor, also known as p75NTR, is a low affinity NGF receptor. It binds with equal affinity all members of the neurotrophin family including beta NGF, BDNF, NT-3 and NT-4/5. It also binds the pro-neurotrophins. NGF receptors mediate signaling of neurotrophins for neuronal survival, apoptosis, neurite outgrowth and synaptic plasticity. These receptors are also thought to play a role in neurogenerative diseases such as Alzheimers disease. The p75NTR NGF receptor is a type I transmembrane glycoprotein (396 aa) consisting of a signal peptide (21 aa), an extracellular domain (225 aa) which contains four cysteine rich domains responsible for ligand binding, a transmembrane domain (19 aa) and a cytoplasmic domain (152 aa). It is a member of the TNF-alpha receptor family (TNR16). Recently, p75NTR has been shown to act as a receptor for many pathogens such as prions, rabies virus and amyloid beta. It also acts as a co-receptor for NOGO, mediating inhibitory signals of myelin associated protein.
Lyophilized products should be stored at 2-8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Monoclonal antibody MC192 against the rat low affinity nerve growth factor receptor (p75NTR) is derived from the fusion of Sp2/0-Ag 14 myeloma cells with mouse immune splenocytes. MC192 monoclonal antibody was originally generated by Chandlers et al. p75NTR was originally discovered as a low affinity nerve growth factor receptor. Later it was found that it was the receptor for all neurotrophins. It mediates signals of neurotrophins for neuronal survival, apoptosis, neurite outgrowth and synaptic plasticity. Recently, it has been revealed that p75NTR not only acts as the receptor for neurotrophins but also the receptor for many other pathological ligands such as prions, rabies virus and amyloid beta. p75NTR also acts as a co-receptor for NOGO which mediates inhibitory signals of myelin associated protein. p75NTR is highly expressed in a number of non-neuronal and neuronal cells including motor neurons during development and also in damaged neurons. MC192 recognizes the extracellular domain of the neurotrophin receptor p75NTR in rat. MC192 antibody may be used for immunocytochemical localisation of rat cells expressing p75NTR, ELISA and western blot. This antibody has also been used for the construction of the MC192-saporin immunotoxin for specific elimination of neuronal populations in basal forebrain cholinergic neurons to generate an animal model for Alzheimer's disease. Using Flow Cytometry, this antibody has frequently been employed for panning to isolate p75NTR-expressing rat cells. MC192 has a potential use as the ligand for gene delivery into p75NTR-expressing rat cells via a receptor-mediated mechanism. FUNCTION: Low affinity receptor which can bind to NGF, BDNF, NT-3, and NT-4. Can mediate cell survival as well as cell death of neural cells. SUBUNIT: Homodimer; disulfide-linked. Interacts with p75NTR-associated cell death executor. Interacts with NGFRAP1/BEX3. Interacts with TRAF2, TRAF4, TRAF6, PTPN13 and RANBP9. Interacts through TRAF6 with SQSTM1 which bridges NGFR to NTRK1 (By similarity). Interacts with BEX1. SUBCELLULAR LOCATION: Membrane; single-pass type I membrane protein. DOMAIN: Death domain is responsible for interaction with RANBP9. PTM: N- and O-glycosylated. PTM: Phosphorylated on serine residues. SIMILARITY: Contains 1 death domain. SIMILARITY: Contains 4 TNFR-Cys repeats.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized
Host Animal:
Mouse
Species Reactivity:
Rat
Immunogen:
NGF receptor
Applications:
ELISA,IHC-Frozen,WB
Clone number:
MC192
Antibody Isotype:
IgG1
Application Details:
IH (lightly fixed), ELISA, WB, Flow Cytometry (2 ug per 10^6 cells) IP (non-reducing conditions only!; do not use reducing agents such as DTT or beta-mercaptoethanol), Traditional formalin fixed paraffin embedded immunohistochemistry is NOT recommended with MC192. Motor neuron isolation, Gene/Toxin Delivery to rat sensory/motor neurons. A working solution of 1-2 µg/mL was determined by immunohistochemical staining on 4% paraformaldehyde fixed, or alcohol fixed rat spinal cord and brain. For non-denatured WB, 1-5 µg/mL was found to be suitable with suitable controls (PC12 lysate). ELISA: detection only, 1-5 µg/mL has been suggested in literature.Immunoprecipitation: 5 µg/mL, > 0.5% triton X-100 buffer/500 ug/lysate; PC12 positive control strong suggested. MC192 is not suitable as a blocking agent, although it has been incorrectly used for this purpose in many published works. The antibody was generated specifically by screening for monoclonals that had the ability to ENHANCE the binding of NGF, the natural ligand for p75. Therefore, this antibody is particularly unusual. The full details can be found in the original paper, which is listed on our datasheet (see Chandler et al, 1984). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Riffault B, Kourdougli N, Dumon C, Ferrand N, Buhler E, Schaller F, Chambon C, Rivera C, Gaiarsa JL, Porcher C (2016) Pro-Brain-Derived Neurotrophic Factor (proBDNF)-Mediated p75NTR Activation Promotes Depolarizing Actions of GABA and Increases Susceptibility to Epileptic Seizures. Cereb. Cortex [Epub ahead of print]. Application: Western Blot ; Species: Rat Brandli A, Johnstone DM, Stone J (2016) Remote Ischemic Preconditioning Protects Retinal Photoreceptors: Evidence From a Rat Model of Light-Induced Photoreceptor Degeneration. Invest Ophthalmol Vis Sci. 57(13):5302-13 Application: Western Blot, IHC ; Species: Rat Riffault B, Medina I, Dumon C, Thalman C, Ferrand N, Friedel P, Gaiarsa JL, Porcher C. (2014) "Pro-Brain-Derived Neurotrophic Factor Inhibits GABAergic Neurotransmission by Activating Endocytosis and Repression of GABAA Receptors." J. Neurosci. 34(40):13516-34 Application: Western Blot ,Neuronal cells and hippocampi; Species: Rat Kalincik T et al (2011) Selected changes in spinal cord morphology after T4 transection and olfactory ensheathing cell transplantation. Auton Neurosci. 158(1-2):31-8 Application: IF ; Species: Rat Wu A et al (2011) Delayed olfactory ensheathing cell transplants reduce nociception after dorsal root injury. Exp Neurol. 229(1):143-57 Application: IF ; Species: Rat Davies A et al (2010) The alpha2delta subunits of voltage-gated calcium channels form GPI-anchored proteins, a post translational modification essential for function Proc Natl Acad Sci U S A. Jan 26;107(4):1654-9 Kalincik T et al (2010) Olfactory ensheathing cells reduce duration of autonomic dysreflexia in rats with high spinal cord injury. Auton Neurosci. 154 (1-2):20-9 Application: IHC ; Species: Rat Wilson-Gerwing T.D. et al (2009) J Comp Neurol. 2009 Sep 1;516(1):49-58 Feron F et al (2008) Neurotrophin expression in the adult olfactory epithelium. Brain Res. 1196:13-21 Application: IHC ; Species: Rat Bianco JI et al (2004) Neurotrophin 3 promotes purification and proliferation of olfactory ensheathing cells from human nose. Glia. 45(2):111-23 Application: IHC, IF ; Species: Rat Eyles D et al (2003) Neuroscience. 2003;118(3):641-53. Application: IHC ; Species: Rat Lu J et al (2001) Transplantation of nasal olfactory tissue promotes partial recovery in paraplegic adult rats. Brain Res. 889(1-2):344-57 Application: IF ; Species: Rat
Specificity:
MC192 is specific only for RAT NGFR, no reactivity to Human or Mouse NGFR has been reported This monoclonal antibody has been tested for immunohistochemical localisation of p75NTR-expressing rat cells in the spinal cord and brain. This monoclonal antibody does not cross react with p75NTR-expressing cells in other species.
Storage:
The MC192 is supplied in lyophilized form from Protein G-purified hybridoma cell culture supernatants. The lyophilized antibody is stable when stored at 2-8°C or -20°C. After reconstitution undiluted aliquots should be kept at -20°C for up to six months. For additional stability Glycerol (1:1) may be added after reconstitution. Repetitive freeze/thaw cycle should be avoided.
p75NTR (CD271) was originally discovered as a low affinity nerve growth factor receptor (NGFR). Later it was found that it was the receptor for all neurotrophins, including NGF, BDNF, NT3 and NT4/5. It mediates signals of neurotrophins for neuronal survival, apoptosis, neurite outgrowth and synaptic plasticity. Recently, it has been revealed that p75NTR not only acts as the receptor for neurotrophins but also the receptor for many other pathological ligands such as prions, rabies virus and amyloid beta. p75NTR also acts as a co-receptor for NOGO which mediates inhibitory signals of myelin associated protein. p75NTR is highly expressed in a number of non-neuronal and neuronal cells including motor neurons during development and also in damaged neurons. Recent research proposes the extracellular domain of p75NTR as a biomarker for monitoring the progression of motor neuron disease (MND), also known as Amyotrophic Lateral Sclerosis (ALS) or Lou Gehrig's Disease. SUBUNIT: Homodimer; disulfide-linked. Interacts with p75NTR-associated cell death executor. Interacts with NGFRAP1/BEX3.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a solution containing PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives.
Host Animal:
Mouse
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant extracellular domain (amino acids 29-250) of human NGFR/p75NTR protein with N-terminal His-tag.
Applications:
FC,ICC,IHC-Frozen,Immunopanning,IP,WB
Clone number:
8J2
Antibody Isotype:
IgG2a
Application Details:
Flow Cytometry: 5-20 µg/mL.<br>Western Blotting: 0.5-2.0 µg/mL, <b>non-reducing conditions only</b> (no DTT or beta-mercaptoethanol).<br>Immunoprecipitation: lysate dependent. 10 ug per 200-500 ug total protein.<br>Immunopanning: 1-5 µg/mL.<br>Immunocytochemistry: 1-5 µg/mL. Staining is strongest in non-fixed cells, light fixation is tolerable.<br>Immunohistochemistry: fresh, acetone fixed sections only, epitope is fixation sensitive. Not suitable in formalin-fixed, paraffin (FFPE) embedded tissues.<br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Hulme AJ et al. (2020) Molecular and Functional Characterization of Neurogenin-2 Induced Human Sensory Neurons . Front Cell Neurosci. 14:600895 Application: Human, ICC(IF).
Specificity:
Human, reacts with human, mouse and rat. Cross-reactivity with other species not tested but expected.This antibody is specific for NGFR/p75NTR as demonstRated by western blotting and immunprecipitation. The antibody recognizes extracellular p75NTR under non-reducing conditions.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Mouse anti-p75 neurotrophin receptor (p75NTR) Monoclonal Antibody (Unconjugated), suitable for IHC-Frozen, FC.
Background Info:
Nerve growth factor receptor (NGFR) is also referred to as p75(NTR) due to its molecular mass and its ability to bind at low affinity not only NGF (see 162030), but also other neurotrophins, including brain-derived neurotrophic factor (BDNF; 113505), neurotrophin-3 (NTF3; 162660), and neurotrophin-4/5 (NTF5; 162662). At the time of its discovery, NGFR was considered a unique type of protein. Subsequently, however, a large superfamily of tumor necrosis factor receptors were found to share the overall structure of NGFR (4 extracellular ligand-binding, cysteine-rich repeats, or CRs, and signaling through association with, or disassociation from, cytoplasmic interactors). The identification of this superfamily helped elucidate some of the biologic functions of NGFR, including its ultimate involvement in the nuclear factor kappa-B (NFKB; see 164011) and apoptosis pathways. As a monomer, NGFR binds NGF with low affinity. Higher affinity binding is achieved by association with higher molecular mass, low-affinity neurotrophin receptors, namely the tropomyosin receptor kinases, TRKA (NTRK1; 191315), TRKB (NTRK2; 600456), and TRKC (NTRK3; 191316). TRKA, TRKB, and TRKC are specific for or 'preferred by' NGF, NTF5 and BDNF, and NTF3, respectively (Ip et al., 1993). NTF3 also binds to TRKA and TRKB, but with significantly lower affinity
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized
Host Animal:
Mouse
Species Reactivity:
Cat,Dog,Human,Pig,Rabbit,Sheep
Immunogen:
The p75NTR antibody was derived from immunization of mice with human WM245 melanoma cells.
Applications:
FC,IHC-Frozen
Clone number:
ME20.4
Antibody Isotype:
IgG1
Application Details:
Immunohistochemistry, immunofluorescence, flow cytometry. Suggested working dilutions: For Immunohistochemistry a concentration of 2 µg/mL is recommended. Antibody not appropriate for Western Blot. For FACS a concentration of 20 µg/mL is recommended. At least 1 in 5000 dilution is recommended for 1 site ELISAs. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Liu W. et al (2012) Distribution of P75 neurotrophin receptor in adult human cochlea-an immunohistochemical study. Cell Tissue Res. 2012 Mar 31. Inoue K. et al. (2009) Differential expression of stem-cell-associated markers in human hair follicle epithelial cells. Lab Invest. 2009 Aug;89(8):844-56. Ariga M. et al. (2008) Functional role of sortilin in myogenesis and development of insulin-responsive glucose transport system in C2C12 myocytes J Biol Chem. 2008 Apr 11;283(15):10208-20 Rogers ML et al (2010) ProNGF mediates death of Natural Killer cells through activation of the p75NTR-sortilin complex. J Neuroimmunol. 2010 Sep 14;226(1-2):93-103. Jiao et al. Differentiation defect in neural crest-derived smooth muscle cells in patients with aortopathy associated with bicuspid aortic valves. EBioMedicine (2016) 10:282-90.
Specificity:
This antibody recognises p75NTR (low affinity neurotrophin receptor) Reacts with human, cat, dog, pig, rabbit and sheep. Does not react with rat or mouse.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Immunoglobulin (IgG1) was purified using Protein G column (Amersham Pharmacia), polished with Sephacryl 200HR (Amersham Pharmacia) in PBS and then lyophilized. Purity was analysed using electrophoresis, 4-12% Bis Tris Gel (Invitrogen).
Nerve growth factor receptor (NGFR) is also referred to as p75(NTR) due to its molecular mass and its ability to bind at low affinity not only NGF (see 162030), but also other neurotrophins, including brain-derived neurotrophic factor (BDNF; 113505), neurotrophin-3 (NTF3; 162660), and neurotrophin-4/5 (NTF5; 162662). At the time of its discovery, NGFR was considered a unique type of protein. Subsequently, however, a large superfamily of tumor necrosis factor receptors were found to share the overall structure of NGFR (4 extracellular ligand-binding, cysteine-rich repeats, or CRs, and signaling through association with, or disassociation from, cytoplasmic interactors). The identification of this superfamily helped elucidate some of the biologic functions of NGFR, including its ultimate involvement in the nuclear factor kappa-B (NFKB; see 164011) and apoptosis pathways. As a monomer, NGFR binds NGF with low affinity. Higher affinity binding is achieved by association with higher molecular mass, low-affinity neurotrophin receptors, namely the tropomyosin receptor kinases, TRKA (NTRK1; 191315), TRKB (NTRK2; 600456), and TRKC (NTRK3; 191316). TRKA, TRKB, and TRKC are specific for or 'preferred by' NGF, NTF5 and BDNF, and NTF3, respectively (Ip et al., 1993). NTF3 also binds to TRKA and TRKB, but with significantly lower affinity
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid (1 mg/mL) in PBS, pH 7.2-7.6 without preservatives. Typical Fluorophore/Protein (F/P) - ratio is 3-10.
Host Animal:
Mouse
Species Reactivity:
Cat,Dog,Human,Pig,Rabbit,Sheep
Immunogen:
The p75NTR antibody was derived from immunization of mice with human WM245 melanoma cells.
Applications:
ICC
Clone number:
ME20.4
Antibody Isotype:
IgG1, kappa
Application Details:
This antibody is recommended for use in immunohistochemistry, immunofluorescence, flow cytometry and NGF receptor p75 dynamics. For immunohistochemistry a concentration of 2 µg/mL is recommended. Not appropriate for Western Blots. For FACS a concentration of 20 µg/mL is recommended and for 1 site ELISA at least a 1 in 5000 dilution. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
This antibody recognises p75NTR (low affinity neurotrophin receptor) Reacts with human, cat, dog, pig, rabbit and sheep. Does not react with rat or mouse.
Storage:
Aliquot antibody and store frozen at -20°C to -80°C. For short-term storage, the antibody conjugate can be stored at 2-8°C for up to 4 months with the addition of appropriate antibacterial agent, or for up to 1 week without the addition of a preservative.
Purification:
Protein G purified IgG was labelled with ATTO 488 and free dye removed by gel filtration.
Monoclonal antibody MC192 against the rat low affinity nerve growth factor receptor (p75NTR) is derived from the fusion of Sp2/0-Ag 14 myeloma cells with mouse immune splenocytes. MC192 monoclonal antibody was originally generated by Chandlers et al. p75NTR was originally discovered as a low affinity nerve growth factor receptor. Later it was found that it was the receptor for all neurotrophins. It mediates signals of neurotrophins for neuronal survival, apoptosis, neurite outgrowth and synaptic plasticity. Recently, it has been revealed that p75NTR not only acts as the receptor for neurotrophins but also the receptor for many other pathological ligands such as prions, rabies virus and amyloid beta. p75NTR also acts as a co-receptor for NOGO which mediates inhibitory signals of myelin associated protein. p75NTR is highly expressed in a number of non-neuronal and neuronal cells including motor neurons during development and also in damaged neurons. MC192 has a potential use as the ligand for gene delivery into p75NTR-expressing rat cells via a receptor-mediated mechanism. FUNCTION: Low affinity receptor which can bind to NGF, BDNF, NT-3, and NT-4. Can mediate cell survival as well as cell death of neural cells. SUBUNIT: Homodimer; disulfide-linked. Interacts with p75NTR-associated cell death executor. Interacts with NGFRAP1/BEX3. Interacts with TRAF2, TRAF4, TRAF6, PTPN13 and RANBP9. Interacts through TRAF6 with SQSTM1 which bridges NGFR to NTRK1 (By similarity).
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Host Animal:
Mouse
Species Reactivity:
Rat
Immunogen:
Rat p75NTR
Applications:
FC,ICC,IHC-Frozen,IHC-Paraffin-embedded
Clone number:
MC192
Antibody Isotype:
IgG1
Application Details:
IF: live or lightly fixed cells or tissues (acetone or 4% PFA): 2-5µg/mL. Not suitable for western blots; not suitable for IH on formalin fixed tissues. FACS (20µg/mL) is recommended, unfixed cells.
Davies A. et al (2010) The alpha2delta subunits of voltage-gated calcium channels form GPI-anchored proteins, a post translational modification essential for function Proc Natl Acad Sci U S A. Jan 26;107(4):1654-9
Specificity:
MC192 recognizes the extracellular domain of the neurotrophin receptor p75NTR in rat and does not react with human or mouse NGFR. Reacts with rat. Does not react with mouse or human NGFR
Storage:
The antibody conjugate can be stored at 2-8°C for up to 4 months with the addition of appropriate antibacterial agent.
Purification:
Immunoglobulin (IgG1) was purified using Protein G column (Amersham Pharmacia), polished with Sephacryl 200HR (Amersham Pharmacia) in PBS. The IgG was then conjugated to ATTO 488 (ATTO TEC) and purified via gel filtration using a G25 fine grain gel in 10 mMTris/50mM NaCl solution.
p75NTR (CD271) was originally discovered as a low affinity nerve growth factor receptor (NGFR). Later it was found that it was the receptor for all neurotrophins, including NGF, BDNF, NT3 and NT4/5. It mediates signals of neurotrophins for neuronal survival, apoptosis, neurite outgrowth and synaptic plasticity. Recently, it has been revealed that p75NTR not only acts as the receptor for neurotrophins but also the receptor for many other pathological ligands such as prions, rabies virus and amyloid beta. p75NTR also acts as a co-receptor for NOGO which mediates inhibitory signals of myelin associated protein. p75NTR is highly expressed in a number of non-neuronal and neuronal cells including motor neurons during development and also in damaged neurons. Recent research proposes the extracellular domain of p75NTR as a biomarker for monitoring the progression of motor neuron disease (MND), also known as Amyotrophic Lateral Sclerosis (ALS) or Lou Gehrig's Disease. SUBUNIT: Homodimer; disulfide-linked. Interacts with p75NTR-associated cell death executor. Interacts with NGFRAP1/BEX3.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid antibody (1 mg/mL) in PBS, pH 7.2-7.6, without preservative. Typical Fluorophore/Protein (F/P) - ratio is 3-10.
Host Animal:
Mouse
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant extracellular domain (amino acids 29-250) of human NGFR/p75NTR protein with N-terminal His-tag.
Applications:
FC,ICC
Clone number:
8J2
Antibody Isotype:
IgG2a
Application Details:
Immunocytochemistry: 1-5 µg/mL. Light fixation only, or unfixed works best. Epitope is sensitive to fixation.<br>Flow Cytometry: 5-20 µg/mL.<br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human, reacts with human, mouse and rat. Cross-reactivity with other species not tested but expected.This antibody is specific for NGFR/p75NTR as demonstRated by western blotting and immunprecipitation. The antibody recognizes extracellular p75NTR under non-reducing conditions.
Storage:
Liquid antibody is shipped cold. Upon arrival, spin vial briefly, divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Purification:
Protein A purified IgG was labelled with ATTO 488 and free dye removed by gel filtration.
Mouse anti-p75 neurotrophin receptor (p75NTR) Monoclonal Antibody (FITC), suitable for IHC-Frozen, ICC, FC.
Background Info:
Monoclonal antibody MC192 against the rat low affinity nerve growth factor receptor (p75NTR) is derived from the fusion of Sp2/0-Ag 14 myeloma cells with mouse immune splenocytes. MC192 monoclonal antibody was originally generated by Chandlers et al. p75NTR was originally discovered as a low affinity nerve growth factor receptor. Later it was found that it was the receptor for all neurotrophins. It mediates signals of neurotrophins for neuronal survival, apoptosis, neurite outgrowth and synaptic plasticity. Recently, it has been revealed that p75NTR not only acts as the receptor for neurotrophins but also the receptor for many other pathological ligands such as prions, rabies virus and amyloid beta. p75NTR also acts as a co-receptor for NOGO which mediates inhibitory signals of myelin associated protein. p75NTR is highly expressed in a number of non-neuronal and neuronal cells including motor neurons during development and also in damaged neurons. MC192 has a potential use as the ligand for gene delivery into p75NTR-expressing rat cells via a receptor-mediated mechanism. FUNCTION: Low affinity receptor which can bind to NGF, BDNF, NT-3, and NT-4. Can mediate cell survival as well as cell death of neural cells. SUBUNIT: Homodimer; disulfide-linked. Interacts with p75NTR-associated cell death executor. Interacts with NGFRAP1/BEX3. Interacts with TRAF2, TRAF4, TRAF6, PTPN13 and RANBP9.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Host Animal:
Mouse
Species Reactivity:
Rat
Immunogen:
Rat p75NTR
Applications:
FC,ICC,IHC-Frozen
Clone number:
MC192
Antibody Isotype:
IgG1
Application Details:
Immunohistochemistry, immunofluorescence, flow cytometry, NGF receptor p75 dynamics, retrograde transport studies, study of intracellular trafficking. Suggested working dilutions: For immunohistochemistry a concentration of 1-2 µg/mL is recommended. The antibody is not appropriate for Western Blots. The recommended concentration for FACS is 20 µg/mL and at least 1 in 5000 dilution is recommended for 1-site ELISA. Optimal working dilution should be determined by the end user. MC192 is not suitable as a blocking agent, although it has been incorrectly used for this purpose in many published works. The antibody was generated specifically by screening for monoclonals that had the ability to ENHANCE the binding of NGF, the natural ligand for p75. Therefore, this antibody is particularly unusual. The full details can be found in the original paper, which is listed on our datasheet (see Chandler et al, 1984). Biosensis recommends optimal dilutions/concentrations should be determined by the end user. The FITC version of MC192 is primarily targeted for FACS or IF applications on live or lightly fixed cells. Antibody will not work in traditional formalin fixed tissues.
Davies A. et al (2010) The alpha2delta subunits of voltage-gated calcium channels form GPI-anchored proteins, a post translational modification essential for function Proc Natl Acad Sci U S A. Jan 26;107(4):1654-9
Specificity:
MC192 recognizes the extracellular domain of the neurotrophin receptor p75NTR in rat. Reacts with rat. Does not react with mouse or human p75 NGFR
Storage:
The antibody conjugate can be stored at 2-8°C for up to 4 months with the addition of appropriate antibacterial agent.
Purification:
Immunoglobulin (IgG1) was purified using Protein G column (Amersham Pharmacia), polished with Sephacryl 200HR (Amersham Pharmacia) in PBS. The antibody was then conjugated to Fluorescein isomer 1 (FITC, Sigma). A minimum fluorescein: protein ratio of 3:1 is guaranteed. The conjugate was purified via gel filtration using a G25 fine grain gel in 10 mMTris/50mM NaCl solution.
Mouse anti-p75 neurotrophin receptor (p75NTR) Monoclonal Antibody (FITC), suitable for IHC-Frozen, ICC, FC.
Background Info:
Nerve growth factor receptor (NGFR) is also referred to as p75(NTR) due to its molecular mass and its ability to bind at low affinity not only NGF (see 162030), but also other neurotrophins, including brain-derived neurotrophic factor (BDNF; 113505), neurotrophin-3 (NTF3; 162660), and neurotrophin-4/5 (NTF5; 162662). At the time of its discovery, NGFR was considered a unique type of protein. Subsequently, however, a large superfamily of tumor necrosis factor receptors were found to share the overall structure of NGFR (4 extracellular ligand-binding, cysteine-rich repeats, or CRs, and signaling through association with, or disassociation from, cytoplasmic interactors). The identification of this superfamily helped elucidate some of the biologic functions of NGFR, including its ultimate involvement in the nuclear factor kappa-B (NFKB; see 164011) and apoptosis pathways. As a monomer, NGFR binds NGF with low affinity. Higher affinity binding is achieved by association with higher molecular mass, low-affinity neurotrophin receptors, namely the tropomyosin receptor kinases, TRKA (NTRK1; 191315), TRKB (NTRK2; 600456), and TRKC (NTRK3; 191316). TRKA, TRKB, and TRKC are specific for or 'preferred by' NGF, NTF5 and BDNF, and NTF3, respectively. NTF3 also binds to TRKA and TRKB, but with significantly lower affinity.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid. 10mM Tris, 50mM NaCl
Host Animal:
Mouse
Species Reactivity:
Cat,Dog,Human,Pig,Rabbit,Sheep
Immunogen:
The p75NTR antibody was derived from immunization of mice with human WM245 melanoma cells.
Applications:
FC,ICC,IHC-Frozen
Clone number:
ME20.4
Antibody Isotype:
IgG1
Application Details:
This antibody is recommended for use in immunohistochemistry, immunofluorescence, flow cytometry and NGF receptor p75 dynamics. For immunohistochemistry a concentration of 2 µg/mL is recommended. Not appropriate for Western Blots. For FACS a concentration of 20 µg/mL is recommended and for 1 site ELISA at least a 1 in 5000 dilution. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
This antibody recognises p75NTR (low affinity neurotrophin receptor) Reacts with human, cat, dog, pig, rabbit and sheep. Does not react with rat or mouse.
Storage:
The antibody conjugate can be stored at 2-8°C for up to 4 months with the addition of appropriate antibacterial agent.
Purification:
Immunoglobulin (IgG1) was purified using Protein G column (Amersham Pharmacia), polished with Sephacryl 200HR (Amersham Pharmacia) in PBS. The antibody was then conjugated to Fluorescein isomer 1 (FITC, Sigma). A minimum fluorescein: protein ratio of 3:1 is guaranteed. The conjugate was purified via gel filtration using a G25 fine grain gel in 10 mMTris/50mM NaCl solution.
p75NTR (CD271) was originally discovered as a low affinity nerve growth factor receptor (NGFR). Later it was found that it was the receptor for all neurotrophins, including NGF, BDNF, NT3 and NT4/5. It mediates signals of neurotrophins for neuronal survival, apoptosis, neurite outgrowth and synaptic plasticity. Recently, it has been revealed that p75NTR not only acts as the receptor for neurotrophins but also the receptor for many other pathological ligands such as prions, rabies virus and amyloid beta. p75NTR also acts as a co-receptor for NOGO which mediates inhibitory signals of myelin associated protein. p75NTR is highly expressed in a number of non-neuronal and neuronal cells including motor neurons during development and also in damaged neurons. Recent research proposes the extracellular domain of p75NTR as a biomarker for monitoring the progression of motor neuron disease (MND), also known as Amyotrophic Lateral Sclerosis (ALS) or Lou Gehrig's Disease. SUBUNIT: Homodimer; disulfide-linked. Interacts with p75NTR-associated cell death executor. Interacts with NGFRAP1/BEX3.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid antibody (1 mg/mL) in PBS, pH 7.2-7.6, without preservative. Typical Fluorophore/Protein (F/P) - ratio is 3-10.
Host Animal:
Mouse
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant extracellular domain (amino acids 29-250) of human NGFR/p75NTR protein with N-terminal His-tag.
Applications:
FC,ICC
Clone number:
8J2
Antibody Isotype:
IgG2a
Application Details:
Immunocytochemistry: 1-5 µg/mL. Light fixation only, or unfixed works best. Epitope is sensitive to fixation.<br>Flow Cytometry: 5-20 µg/mL.<br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human, reacts with human, mouse and rat. Cross-reactivity with other species not tested but expected.This antibody is specific for NGFR/p75NTR as demonstRated by western blotting and immunprecipitation. The antibody recognizes extracellular p75NTR under non-reducing conditions.
Storage:
Liquid antibody is shipped cold. Upon arrival, spin vial briefly, divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Purification:
Protein A purified IgG was labelled with FITC and free dye removed by gel filtration.
MC192-saporin is an antibody conjugate comprising of the monoclonal antibody MC192 against rat p75 NTR , the nerve growth factor receptor, chemically conjugated via a reducible disulfide bridge to the ribosome-inactivating protein saporin, purified from saponaria officinalis . Unconjugated saporin is incapable of entering the cells due to the apparent lack of ligand. Upon specific binding via MC192 to the cells expressing p75 NTR , saporin transverses the cell membrane leading to lesion of neurochemically defined neuronal populations. The targets of MC192-Saporin are p75 NTR -expressing cells including cholinergic neurons of the basal forebrain, cerebellar Purkinje cells, medial septum, diagonal band of Broca, Nucleus basalis of Meynert and some tumour cells. MC192-saporin has been used in the study of learning and memory and its primary application is in vivo , MC192-saporin is specific for applications in rat. The antibody does not cross-react with human or mouse p75 NTR receptors.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a 1 mg/mL solution containing PBS pH 7.2-7.6 without preservative.
Host Animal:
Mouse
Species Reactivity:
Rat
Immunogen:
Rat NGF receptor (p75NTR)
Applications:
In-vivo
Clone number:
MC192
Antibody Isotype:
IgG1
Application Details:
1. To specifically target and eliminate rat cells expressing p75NTR <i>in vivo</i>. MC192-saporin has been used to selectively lesion cholinergic neurons of basal forebrain to create an animal model to study Alzheimer's disease. <br> 2. To be used as a model for gene delivery into neurons.<br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Active. Ablates p75-positive cells in rat in vivo. Routinely tested for dose-dependent killing of rat C6 cells in vitro. Note that the primary use of MC192-saporin is for in vivo applications in rat. Effective MC192-saporin concentrations must be determined for every new batch.
Biosensis Brand:
Biosensis®
Conjugate:
Saporin
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
MC192 antibody is specific only for rat NGFR, no reactivity to human or mouse NGFR has been reported This monoclonal antibody does not cross react with p75NTR-expressing cells in other species than rat.
Storage:
Lyophilized product is shipped at ambient room temperature. Upon receipt, pulse-centrifuge the vial to collect solid that may be entrapped in the lid. After reconstitution, immediately prepare aliquots and keep the undiluted stock at -80°C for long-term storage. Avoid repeated thaw-freezing. For short-term storage, keep at 2-8°C for up to 2 weeks. it is recommended to handle this product under sterile conditions.
Purification:
Conjugate was purified by ion-exchange chromatography. Purity > 90% by non-reducing SDS-PAGE
MC192-saporin is an antibody conjugate comprising of the monoclonal antibody MC192 against rat p75 NTR , the nerve growth factor receptor, chemically conjugated via a reducible disulfide bridge to the ribosome-inactivating protein saporin, purified from saponaria officinalis . Unconjugated saporin is incapable of entering the cells due to the apparent lack of ligand. Upon specific binding via MC192 to the cells expressing p75 NTR , saporin transverses the cell membrane leading to lesion of neurochemically defined neuronal populations. The targets of MC192-Saporin are p75 NTR -expressing cells including cholinergic neurons of the basal forebrain, cerebellar Purkinje cells, medial septum, diagonal band of Broca, Nucleus basalis of Meynert and some tumour cells. MC192-saporin has been used in the study of learning and memory and its primary application is in vivo , MC192-saporin is specific for applications in rat. The antibody does not cross-react with human or mouse p75 NTR receptors.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a 1 mg/mL solution containing PBS pH 7.2-7.6 without preservative.
Host Animal:
Mouse
Species Reactivity:
Rat
Immunogen:
Rat NGF receptor (p75NTR)
Applications:
In-vivo
Clone number:
MC192
Antibody Isotype:
IgG1
Application Details:
1. To specifically target and eliminate rat cells expressing p75NTR <i>in vivo</i>. MC192-saporin has been used to selectively lesion cholinergic neurons of basal forebrain to create an animal model to study Alzheimer's disease. <br> 2. To be used as a model for gene delivery into neurons.<br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Active. Ablates p75-positive cells in rat in vivo. Routinely tested for dose-dependent killing of rat C6 cells in vitro. Note that the primary use of MC192-saporin is for in vivo applications in rat. Effective MC192-saporin concentrations must be determined for every new batch.
Biosensis Brand:
Biosensis®
Conjugate:
Saporin
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
MC192 antibody is specific only for rat NGFR, no reactivity to human or mouse NGFR has been reported This monoclonal antibody does not cross react with p75NTR-expressing cells in other species than rat.
Storage:
Lyophilized product is shipped at ambient room temperature. Upon receipt, pulse-centrifuge the vial to collect solid that may be entrapped in the lid. After reconstitution, immediately prepare aliquots and keep the undiluted stock at -80°C for long-term storage. Avoid repeated thaw-freezing. For short-term storage, keep at 2-8°C for up to 2 weeks. it is recommended to handle this product under sterile conditions.
Purification:
Conjugate was purified by ion-exchange chromatography. Purity > 90% by non-reducing SDS-PAGE
MC192-saporin is an antibody conjugate comprising of the monoclonal antibody MC192 against rat p75 NTR , the nerve growth factor receptor, chemically conjugated via a reducible disulfide bridge to the ribosome-inactivating protein saporin, purified from saponaria officinalis . Unconjugated saporin is incapable of entering the cells due to the apparent lack of ligand. Upon specific binding via MC192 to the cells expressing p75 NTR , saporin transverses the cell membrane leading to lesion of neurochemically defined neuronal populations. The targets of MC192-Saporin are p75 NTR -expressing cells including cholinergic neurons of the basal forebrain, cerebellar Purkinje cells, medial septum, diagonal band of Broca, Nucleus basalis of Meynert and some tumour cells. MC192-saporin has been used in the study of learning and memory and its primary application is in vivo , MC192-saporin is specific for applications in rat. The antibody does not cross-react with human or mouse p75 NTR receptors.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a 1 mg/mL solution containing PBS pH 7.2-7.6 without preservative.
Host Animal:
Mouse
Species Reactivity:
Rat
Immunogen:
Rat NGF receptor (p75NTR)
Applications:
In-vivo
Clone number:
MC192
Antibody Isotype:
IgG1
Application Details:
1. To specifically target and eliminate rat cells expressing p75NTR <i>in vivo</i>. MC192-saporin has been used to selectively lesion cholinergic neurons of basal forebrain to create an animal model to study Alzheimer's disease. <br> 2. To be used as a model for gene delivery into neurons.<br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Active. Ablates p75-positive cells in rat in vivo. Routinely tested for dose-dependent killing of rat C6 cells in vitro. Note that the primary use of MC192-saporin is for in vivo applications in rat. Effective MC192-saporin concentrations must be determined for every new batch.
Biosensis Brand:
Biosensis®
Conjugate:
Saporin
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
MC192 antibody is specific only for rat NGFR, no reactivity to human or mouse NGFR has been reported This monoclonal antibody does not cross react with p75NTR-expressing cells in other species than rat.
Storage:
Lyophilized product is shipped at ambient room temperature. Upon receipt, pulse-centrifuge the vial to collect solid that may be entrapped in the lid. After reconstitution, immediately prepare aliquots and keep the undiluted stock at -80°C for long-term storage. Avoid repeated thaw-freezing. For short-term storage, keep at 2-8°C for up to 2 weeks. it is recommended to handle this product under sterile conditions.
Purification:
Conjugate was purified by ion-exchange chromatography. Purity > 90% by non-reducing SDS-PAGE
FUNCTION: Low affinity receptor which can bind to NGF, BDNF, NT-3, and NT-4. Can mediate cell survival as well as cell death of neural cells. SUBUNIT: Homodimer; disulfide-linked. Interacts with p75NTR-associated cell death executor. Interacts with TRAF2, TRAF4, TRAF6, PTPN13 and RANBP9. Interacts through TRAF6 with SQSTM1 which bridges NGFR to NTRK1. Interacts with BEX1 and NGFRAP1/BEX3. SUBCELLULAR LOCATION: Membrane; single-pass type I membrane protein. DOMAIN: Death domain is responsible for interaction with RANBP9. PTM: N- and O-glycosylated. PTM: O-linked glycans consist of Gal(1-3)GalNAc core elongated by 1 or 2 NeuNAc. PTM: Phosphorylated on serine residues. SIMILARITY: Contains 1 death domain. SIMILARITY: Contains 4 TNFR-Cys repeats.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
Extra cellular domain of human p75NTR
Applications:
ICC,IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence. Recommended to be used at a dilution of 1:500 to 1:2000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
IHC shows specific staining for p75NTR. This antibody is known to react to rat p75NTR.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Nicastrin, Central region Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Nicastrin, a type 1 membrane glycoprotein, is an essential component of the gamma secretase complex which is critical for the cleavage of the amyloid precursor protein and other membrane proteins. Nicastrin is widely expressed in different tissue types. This antibody reacts with immature forms of Nicastrin. Detection of higher mol. wt. mature forms is likely to be blocked by glycosylation in this region of the protein.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (C-QGETFDYIGSSRMVYD) corresponding to human Nicastrin [331-346] in the central region conjugated via additional N-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested concentration of 3-10 µg/mL is recommended for WB. Human or mouse brain samples commonly prepared with reducing (50 mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Unprocessed full length human Nicastrin is 709 amino acids, however this protein contains an N-terminal signal peptide which is considered to undergo removal/cleavage during processing and transit to the cell plasma membrane, in addition the protein undergoes glycosylation to produce a glycoprotein of about 145 kDa apparent MW by SDS PAGE. Biosensis recommends that the optimal working dilution should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using peptide absorption.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Nicastrin, C-terminal Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Nicastrin, a type 1 membrane glycoprotein, is an essential component of the gamma secretase complex which is critical for the cleavage of the amyloid precursor protein and other membrane proteins. Nicastrin is widely expressed in different tissue types. This antibody detects all processed forms of Nicastrin.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (C-NAKADVLFIAPREPGAVSY) corresponding to human Nicastrin [691-709] in the C-terminal region conjugated via additional N-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested concentration of 3-10 µg/mL is recommended for WB. Human or mouse brain samples commonly prepared with reducing (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Unprocessed full length human Nicastrin is 709 amino acids, however this protein contains an N-terminal signal peptide which is considered to undergo cleavage during processing and transit to the cell plasma membrane, in addition the protein undergoes glycosylation to produce a glycoprotein of about 145 kDa apparent MW by SDS PAGE. Biosensis recommends that the optimal working dilution should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using peptide absorption.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Nicastrin, N-terminal Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Nicastrin, a type 1 membrane glycoprotein, is an essential component of the gamma secretase complex which is critical for the cleavage of the amyloid precursor protein and other membrane proteins. Nicastrin is widely expressed in different tissue types. This antibody detects all processed forms of Nicastrin.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (RGNSVERKIYIPL-C) corresponding to human Nicastrin [32-44] in the N-terminal region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested concentration of 3-10 µg/mL is recommended for WB. Human or mouse brain samples commonly prepared with reducing (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Unprocessed full length human Nicastrin is 709 amino acids, however this protein contains an N-terminal signal peptide which is considered to undergo cleavage during processing and transit to the cell plasma membrane, in addition the protein undergoes glycosylation to produce a glycoprotein of about 145 kDa apparent MW by SDS PAGE. Biosensis recommends that the optimal working dilution should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using peptide absorption.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Nitrogenase is involved in biological fixation of atmospheric nitrogen to ammonia. Alternative protein names: nitrogenase component II, nitrogenase Fe protein, nitrogenase reductase, FeMoCo-nitrogenase.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid at 1.28 mg/ml
Storage Temp:
Store at 4 C; make aliquots to avoid working with a stock. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Azotobacter vinelandii (Gram-), Bradyrhizobium japonicum, Cyanobacteria, Cyanothece ATCC51142, Desulfotomaculum reducens (strain MI-1),Clostridium cellobioparum, Enterobacter , genera, euryachaeotes, Klebsiella pneumonia, Magnetococcus sp., Methanobacterium thermoautotrophicum, Methanococcus maripaludis, Methylobacterium sp., Mesoorhizobium loti, Rhodopseudomonas palustris TIE-1 strain, alpha,gamma,beta proteobacteria, enterobacteria, low GC gram+, high GC gram +, able to fix atmoshperic nitrogen, Rhizobium melilotiSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from known bacterial NifH subunits of bacterial nitrogenase enzymes of the FeMoCo type including Synechoccocus sp. Q2JP78 , Trichodesmium theibautii, Anabaena sp. P33178 and Nostoc sp. Q51296
Applications:
Immunofluorescence (IF), Immunohistochemistry (IHC), Western blot (WB)
An enzyme involved in chlorophyll synthesis, present in all cyanobacteria (fixing and non-nitrogen fixing) is a member of the NifH family/superfamily. Agrisera anti-NifH antibody will not show a strong reactivity to this target.In photobionts like Anabaena sp., low nitrate growth is required to turn on the NifH expression to high enough levels to detect NifH protein. Immunofluorescence protocol Insect dissected tissues (digestive tract, fat body, carrying NifH positive bacteria) of large workers were fixed in cold methanol (20 min, -20 °C) and then permeabilized in cold acetone (5 min, -20 °C). Samples were subsequently rinsed three times with PBS with 0.1 % Triton-X 100 at RT (PBST) and incubated for 5 minutes in PBST. This was followed by incubation of tissues for 1 hr with 6 ug/ml affinity purified anti-NifH antibody (Agrisera, AS01 021A) diluted in PBS-TBSA (PBS, 0.1 % v/v Triton-X-100, 1 mg/ml BSA) and 3 washings with PBST. Samples were then incubated in the dark with a goat anti-chicken IgY conjugated to Dylight 488 (Pierce, SA5-10070) for 45 min and were washed twice (PBS, 0.1%v/v Triton-X-100). Finally, the tissues were mounted in Vectashield medium containing DAPI (Vector Laboratories, H-1500) and viewed under a SP5 Leica confocal microscope with 10X and 63X objectives. Courtesy of Drs. Panagiotis Sapountzis and Mariya Zhukova, University of Copenhagen, Danmark
Application Details:
1 : 500 (IHC), 6 g/ml (IF), 1 : 2000 (WB)
Purity:
Immunogen affinity purified IgY in PBS pH 8 and 0.02 % sodium azide.
Molecular Weight:
27 | 32.5 kDa
Not reactive in:
Synechococcus sp. PCC 7942 and Synechocystis sp. PCC 6803 as NifH protein is not present in those cyanobacterial species, Frankia sp.
Selected references:
Santana-Sanchez, et al. (2023) Flv3A facilitates O2 photoreduction and affects H2 photoproduction independently of Flv1A in diazotrophic Anabaena filaments. New Phytol. 2023;237(1):126-139. doi:10.1111/nph.18506Chen et al. (2022) Exogenous hydrogen sulphide alleviates nodule senescence in Glycine max-Sinorhizobium fredii symbiotic system, Preprint from Research Square, 22 Jul 2022, DOI: 10.21203/rs.3.rs-1752770/v1Li et al. (2022), The effects of Ni availability on H2 production and N2 fixation in a model unicellular diazotroph: The expression of hydrogenase and nitrogenase. Limnol Oceanogr, 67: 1566-1576. https://doi.org/10.1002/lno.12151He et al. (2021) Vegetative cells may perform nitrogen fixation function under nitrogen deprivation in Anabaena sp. strain PCC 7120 based on genome-wide differential expression analysis. PLoS One. 2021 Mar 4;16(3):e0248155. doi: 10.1371/journal.pone.0248155. PMID: 33662009; PMCID: PMC7932525. (Immunolocalization)Liu et al. (2020). A VIT-like transporter facilitates iron transport into nodule symbiosomes for nitrogen fixation in soybean. New Phytol . 2020 Mar 2. doi: 10.1111/nph.16506.
Nitrogenase is involved in biological fixation of nitrogen to assimilable ammonia.This product is a recombinant protein standard, source: Nostoc/Anabaena 7120.
Product Type:
Antibody
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes.
Concentration: after adding 90 l of milliQ water final concentration of this standard is 0.15 pmoles/ul and this reagent is ready to use and load on a gel.Protein standard buffer composition: Glycerol 10%, Tris Base 141 mM, Tris HCl 106 mM, LDS 2%, EDTA 0.51 mM, SERVA Blue G250 0.22 mM, Phenol Red 0.175 mM, pH 8.5, 0.1mg/ml PefaBloc protease inhibitor (Roche), 50mM DTT.This standard is ready-to-load and does not require any additions or heating. It needs to be fully thawed and thoroughly mixed prior to using. Avoid vigorous vortexing, as buffers contain detergent. Following mixing, briefly pulse in a microcentrifuge to collect material from cap.This standard is stabilized and ready and does not require heating before loading on the gel. Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Application Details:
Standard curve: 3 loads are recommended (0.5, 2 and 4 μl).For most applications a sample load of 0.2 μg of chlorophyll will give a NifH signal in this range.Positive control: a 2 μl load per well is optimal for most chemiluminescent detection systems. This standard is stabilized and ready and does not require heating before loading on the gel.Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Reconstitution:
For reconstitution add 90 l of sterile water. Please notice that this product contains 10% glycerol and might appear as liquid but is provided lyophilized.
Molecular Weight:
34 kDa (larger than a native protein due to the addition of His-tag)
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known.
Selected references:
Levitan et a. (2010). Regulation of nitrogen metabolism in the marine diazotroph Trichodesmium IMS101 under varying temperatures and atmospheric CO concentrations. Environ. Microbiol (Epub ahead of print)
Special application note:
The NifH protein standard can be used in combination with global anti-NifH antibodies to quantitate NifH protein from a wide range of cyanobacterial species. Global antibodies are raised against highly conserved 15 amino acid sequence found in NifH proteins.Quantitative western blot: detailed method description, video tutorial
Nitrocellulose membranes are a popular matrix used in protein blotting because of their high protein-binding affinity, compatibility with a variety of detection methods (chemiluminescence, chromogenic, and fluorescence), and the ability to immobilize proteins, glycoproteins, or nucleic acids. 's Nitrocellulose Membrane, 0.25 µm, 9 cm x 10cm is used for low molecular-weight proteins and nucleic acids <500 bp.
Nitrocellulose membranes are a popular matrix used in protein blotting because of their high protein-binding affinity, compatibility with a variety of detection methods (chemiluminescence, chromogenic, and fluorescence), and the ability to immobilize proteins, glycoproteins, or nucleic acids. 's Nitrocellulose Membrane, 0.45 µm, 9 cm x 10cm is used for a wide range of protein molecular weights and nucleic acids >500 bp.
Nitrotyrosine can be detected in proteins from a variety of tissues, usually in association with pathological conditions. Reaction of nitric oxide with superoxide produces peroxynitrite, which can undergo heterolytic cleavage into nitronium and hydroxyl ions. Nitration of tyrosine residues by nitronium ion forms nitrotyrosine groups in the respective proteins. Nitrotyrosine is thus a marker for inflammation-associated tissue damage.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid at 1 mg/ml.
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on the label. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Mouse
Species Reactivity:
Nitrotyrosine ,Nitrotyrosine
Immunogen:
NO2-Tyr-CH2-Thyroglobulin
Applications:
Immunohistochemistry (IHC) paraffin, Iimmunohistochemistry (IHC) frozen sections, Western blot (WB)
NK1.1 / CD161bc (also known as NKRP1, Ly55c, or Ly59) is a cell surface antigen expressed on NK cells and NK-T cells of certain mouse strains, which is being used for identification or antibody-mediated depletion of these cells in the respective strains. This antigen participates in NK cell activation, including production of interferon gamma, and release of cytotoxic granules.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
NK1-positive murine splenic and bone marrow cells
Applications:
FC,IP,IHC,FA
Additional Info:
The mouse monoclonal antibody PK136 recognizes NK1.1 antigen (NK cell marker) expressed by some mouse strains (e.g. C57BL/6, NZB, CE, C58, Ma/My), whereas other strains (e.g. BALB/c, AKR, CBA, C3H) do not express this antigen. This antibody detects a conformational epitope on Nkrp1c and Nkrp1b gene products.
NK1.1 / CD161bc (also known as NKRP1, Ly55c, or Ly59) is a cell surface antigen expressed on NK cells and NK-T cells of certain mouse strains, which is being used for identification or antibody-mediated depletion of these cells in the respective strains. This antigen participates in NK cell activation, including production of interferon gamma, and release of cytotoxic granules.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
NK1-positive murine splenic and bone marrow cells
Applications:
FC,IP,IHC,FA
Additional Info:
The mouse monoclonal antibody PK136 recognizes NK1.1 antigen (NK cell marker) expressed by some mouse strains (e.g. C57BL/6, NZB, CE, C58, Ma/My), whereas other strains (e.g. BALB/c, AKR, CBA, C3H) do not express this antigen. This antibody detects a conformational epitope on Nkrp1c and Nkrp1b gene products.
NK1.1 / CD161bc (also known as NKRP1, Ly55c, or Ly59) is a cell surface antigen expressed on NK cells and NK-T cells of certain mouse strains, which is being used for identification or antibody-mediated depletion of these cells in the respective strains. This antigen participates in NK cell activation, including production of interferon gamma, and release of cytotoxic granules.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
NK1-positive murine splenic and bone marrow cells
Applications:
FC,IP,IHC,FA
Additional Info:
The mouse monoclonal antibody PK136 recognizes NK1.1 antigen (NK cell marker) expressed by some mouse strains (e.g. C57BL/6, NZB, CE, C58, Ma/My), whereas other strains (e.g. BALB/c, AKR, CBA, C3H) do not express this antigen. This antibody detects a conformational epitope on Nkrp1c and Nkrp1b gene products.
The histochemical antibody for Neurokinin 1 Receptor is generated in a rabbit from a synthetic peptide corresponding to rat NK1R 393-407 coupled to carrier protein. The antiserum is provided as l00 µL of lyophilized whole serum.
Product Type:
Antibody - Antibodies
Antibody Type:
polyclonal
Format:
Lyophilised
Host Animal:
Rabbit
Species Reactivity:
Rat
Expected Species:
100% sequence homology with rat and gerbil, 93% with mouse, 78% with human
Immunogen:
Synthetic peptide corresponding to rat NK1R 393-407 coupled to carrier protein.
The NK1R antiserum was quality control tested using standard immunohistochemical methods in rat brain using biotin/avidin-HRP techniques. Specificity of the antiserum was demonstrated by soluble pre-adsorption and Western blot. Tissue staining is completely eliminated by pretreatment of the diluted antibody with 10 mg of rat NK1R peptide residues 393-407. Western blot analysis demonstrates two immunoreactive bands of approximately 70 and 110 kD.
The peptide control for Neurokinin 1 Receptor is intended for the immuno-adsorption of Neurokinin 1 Receptor antiserum, catalog number 20060. Pre-adsorption of Neurokinin 1 Receptor antiserum, diluted according to the antibody specification sheet, with 10 µg/mL NK1R peptide immunogen following the instructions below provides complete blockage of Neurokinin 1 Receptor immunolabeling.
The peptide control for Neurokinin 1 Receptor is intended for the immuno-adsorption of Neurokinin 1 Receptor antiserum, catalog number 20060. Pre-adsorption of Neurokinin 1 Receptor antiserum, diluted according to the antibody specification sheet, with 10 µg/mL NK1R peptide immunogen following the instructions below provides complete blockage of Neurokinin 1 Receptor immunolabeling. The peptide is provided as 100 µL of 50 mg of synthetic peptide corresponding to rat NK1R 393-407.
The histochemical antibody for Neurokinin 3 Receptor is generated in a rabbit from a synthetic peptide corresponding to rat NK3R 438-452 coupled to carrier protein. The antiserum is provided as l00 µL of affinity purified liquid.
Product Type:
Antibody - Antibodies
Antibody Type:
polyclonal
Format:
Liquid
Host Animal:
Rabbit
Species Reactivity:
Rat
Expected Species:
100% sequence homology with rat, human, mouse, dog and gerbil
Immunogen:
Synthetic peptide corresponding to rat NK3R 438-452 coupled to carrier protein.
The NK3R antiserum was quality control tested using standard immunohistochemical methods in rat hypothalamus using biotin/avidin-HRP techniques.Specificity of the antiserum was demonstrated by soluble pre-adsorption and Western blot. Tissue staining is completely eliminated by pretreatment of the diluted antibody with 25 mg of rat NK3R peptide residues 438-452. Western blot analysis of crude rat brain homogenate demonstrates two immunoreactive bands of approximately 80 and 115 kD.
The neuronal nitric oxide synthase C-terminal antiserum was quality control tested using standard immunohistochemical methods. The antiserum demonstrates strongly positive labeling of rat hypothalamus, striatum, cortex and spinal cord using indirect immunofluorescent and biotin/avidin-HRP techniques. Recommended primary dilutions are 1/1,000 - 1/1,500 in PBS/0.3% Triton X-100 - Cy3 Technique and 1/8,000 - 1/12,000 in PBS/0.3% Triton X-100 - Bn/Av-HRP Technique. By Western blot analysis of brain homogenates the antibody specifically labels a band of approximately 155 kD. Immuno-labeling is completely abolished by pre-adsorption with synthetic human nNOS (1419-1433) at 5 µg per mL of diluted antibody. No cross reactivity with other forms of NOS were observed. The nNOS antiserum has been used successfully in human, rat, mouse, guinea pig, cat, and monkey tissue. Detection of nNOS from other species will depend upon sequence homology.
The peptide control for nNOS (C-terminal) is intended for the immuno-adsorption of nNOS (C-terminal) antiserum, catalog number 24287. Pre-adsorption of nNOS (C-terminal) antiserum, diluted according to the antibody specification sheet, with 5 µg/ml nNOS peptide immunogen following the instructions below provides complete blockage of nNOS (C-terminal) immunolabeling. The peptide is provided as 25 µg of lyophilized human nNOS, sequence 1419-1433. Please read the instructions carefully before beginning the procedure.
The ImmunoStar N-terminal neuronal nitric oxide synthase antiserum was quality control tested using standard immunohistochemical methods. The antiserum demonstrates strongly positive labeling of rat hypothalamus, striatum, cortex and spinal cord using indirect immunofluorescent and biotin/avidin-HRP techniques. Recommended primary dilutions are 1/1,000 - 1/2,000 in PBS/0.3% Triton X-100 - biotin/avidin-HRP. By Western blot analysis of brain homogenates the antibody specifically labels a band of approximately 155 kD. Immunolabeling is completely abolished by pre-adsorption with synthetic human nNOS (134-148) at 5 µg per mL of diluted antibody. No cross reactivity with other forms of NOS was observed.
The peptide control for nNOS (N-terminal) is intended for the immuno-adsorption of nNOS (N-terminal) antiserum, catalog number 24431. Pre-adsorption of nNOS (N-terminal) antiserum, diluted according to the antibody specification sheet, with 5ug/ml nNOS (N-terminal) peptide immunogen following the instructions below provides complete blockage of nNOS (N-terminal) immunolabeling. The peptide is provided as 25ug of lyophilized human nNOS (N-terminal), and approximately 0.09% sodium azide, sequence 134-148. Please read the instructions carefully.
Rabbit anti-Nociceptin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, ELISA.
Background Info:
FUNCTION: Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Expressed predominantly in the spinal cord and brain, being more abundant in the hypothalamus and striatum. Also found in small amounts in ovary. PTM: Specific enzymatic cleavages at paired basic residues probably yield other active peptides besides nociceptin. PTM: The N-terminal domain contains 6 conserved cysteines thought to be involved in disulfide bonding and/or processing. SIMILARITY: Belongs to the opioid neuropeptide precursor family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Guinea Pig,Rat
Immunogen:
A synthetic peptide (C-TG ARKSARKLAN Q) as part of rat Nociceptin peptide (aa: 139-151) conjugated to diphtheria toxoid
Applications:
ELISA,IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC, 1-site ELISA. A dilution of 1: 1000 to 1: 3000 is recommended for both applications. This antibody may also be used for staining of nerve fibres in guinea pig myenteric plexus. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
There are no synonyms for this peptide; however the precursor protein contains: Neuropeptide 1; Nociceptin (Orphanin FQ; PPNOC; ORL1 receptor agonist); Neuropeptide 2
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity has been tested by the use of different peptides including enkephalin, dynorphin and endorphin for absorption in immunihistochemistry. This antibody is known to cross react with guinea pig and rat.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
NodGS (Nodulin/glutamate-ammonia ligase-like protein) shares homology with nodulins and self-assembles into oligomers which are present in response to flagellin treatment. It contains a C-terminal domain of a prokaryotic glutamine synthetase type I. Protein is mainly localized to cytoplasm and is present in a oligomeric form of ca. 700 kDa.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Medicago truncatula, Theobroma cacao Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from a C-terminal of Arabidopsis thaliana NodGS, UniProt: Q8W473 , TAIR: AT3G53180
Applications:
Immunoprecipitation (IP), Immunofluorescence (IF), Western blot (WB)
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Doskocilova et al. (2011). A nodulin/glutamine synthetase-like fusion protein is implicated in the regulation of root morphogenesis and in signalling triggered by flagellin. Planta 234, 459–476. doi: 10.1007/s00425-011-1419-7
NodGS (Nodulin/glutamate-ammonia ligase-like protein) shares homology with nodulins and self-assembles into oligomers which are present in response to flagellin treatment. It contains a C-terminal domain of a prokaryotic glutamine synthetase type I. Protein is mainly localized to cytoplasm and is present in a oligomeric form of ca. 700 kDa.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Medicago truncatula, Theobroma cacao Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from a C-terminal of Arabidopsis thaliana NodGS, UniProt: Q8W473 , TAIR: AT3G53180
Applications:
Immunoprecipitation (IP), Immunofluorescence (IF), Western blot (WB)
Immunogen affinity purified serum in PBS pH 7.4. with glycerol at 50 %.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
94 | 90 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Doskocilova et al. (2011). A nodulin/glutamine synthetase-like fusion protein is implicated in the regulation of root morphogenesis and in signalling triggered by flagellin. Planta 234, 459–476. doi: 10.1007/s00425-011-1419-7
Noggin, Human, Purified Recombinant Protein, suitable for Cell Culture.
Background Info:
Noggin is a glycoprotein predominantly expressed by the dorsal mesoderm during embryogenesis and is secreted as a covalently linked homodimer. Noggin is essential for cartilage morphogenesis and joint formation. It is an inhibitor of bone morphogenic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite. Defects in Noggin are a cause of symphalangism proximal syndrome (SYM1), of multiple synostoses syndrome 1 (SYNS1), of the tarsal-carpal coalition syndrome (TCC), of stapes ankylosis with broad thumb and toes, and of brachydactyly type B2 (BDB2).
Product Type:
Protein
Format:
The Noggin product consists of 5-25% carbohydrate by weight. When reconstituted in 0.5 mL sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Applications:
Cell Culture
Alternative Names:
Nog;
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
Lyophilized products should be stored at 2-8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95% as determined by SDS-PAGE and visualized by silver stain.
Noggin, Human, Purified Recombinant Protein, suitable for Cell Culture.
Background Info:
Noggin is a glycoprotein predominantly expressed by the dorsal mesoderm during embryogenesis and is secreted as a covalently linked homodimer. Noggin is essential for cartilage morphogenesis and joint formation. It is an inhibitor of bone morphogenic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite. Defects in Noggin are a cause of symphalangism proximal syndrome (SYM1), of multiple synostoses syndrome 1 (SYNS1), of the tarsal-carpal coalition syndrome (TCC), of stapes ankylosis with broad thumb and toes, and of brachydactyly type B2 (BDB2).
Product Type:
Protein
Format:
The Noggin product consists of 5-25% carbohydrate by weight.
Applications:
Cell Culture
Alternative Names:
Nog;
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
Lyophilized products should be stored at 2-8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95% as determined by SDS-PAGE and visualized by silver stain.
Noggin, Human, Purified Recombinant Protein, suitable for Cell Culture.
Background Info:
Noggin is a glycoprotein predominantly expressed by the dorsal mesoderm during embryogenesis and is secreted as a covalently linked homodimer. Noggin is essential for cartilage morphogenesis and joint formation. It is an inhibitor of bone morphogenic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite. Defects in Noggin are a cause of symphalangism proximal syndrome (SYM1), of multiple synostoses syndrome 1 (SYNS1), of the tarsal-carpal coalition syndrome (TCC), of stapes ankylosis with broad thumb and toes, and of brachydactyly type B2 (BDB2).
Product Type:
Protein
Format:
The Noggin product consists of 5-25% carbohydrate by weight.
Applications:
Cell Culture
Alternative Names:
Nog;
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
Lyophilized products should be stored at 2-8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95% as determined by SDS-PAGE and visualized by silver stain.
Xyloglucans are polysaccharides commonly refered to as hemicelluloses found in the primary cell walls of vascular plants. This antibody recognizes the glycan group of xyloglucan-1 in the non-fucosylated form.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Antibody can be stored up to 1 month at 4 C, and at -80°Cfor up to 1 year. Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Mouse
Species Reactivity:
Arabidopsis thaliana, Solanum lycopersicum
Expected Species:
DicotsSpecies of your interest not listed? Contact us
CCRC-M101 does not bind to XXXG, but does bind to other xyloglucan oligosaccharides, CCRC-M101 also binds to pectic polysaccharide preparations from several plants
Application Details:
Undiluted or at 1 : 10 (ELISA), (IF), (IHC)
Conjugation:
IgG1
Isotype:
IgG1
Purity:
Cell culture supernatant.
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Pattathil et al. (2012). Immunological approaches to plant cell wall and biomass characterization: Glycome Profiling. Methods Mol Biol. 2012;908:61-72.doi: 0.1007/978-1-61779-956-3_6. Patathil et al. (2010). A comprehensive toolkit of plant cell wall glycan-directed monoclonal antibodies. Plant Physiol. 2010 Jun;153(2):514-25.doi: 10.1104/pp.109.151985.
Special application note:
Exact working dilution needs to be determined by end user
Xyloglucans are polysaccharides commonly refered to as hemicelluloses found in the primary cell walls of vascular plants. This antibody recognizes the glycan group of xyloglucan-2 in the non-fucosylated form.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Antibody can be stored up to 1 month at 4 C, and at -80°Cfor up to 1 year. Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
CCRC-M88 does not bind to XXXG, but does bind to other xyloglucan oligosaccharides, CCRC-M88 also binds to pectic polysaccharide preparations from several plants
Application Details:
Undiluted or at 1 : 10 (ELISA), (IF), (IHC)
Conjugation:
IgG1
Isotype:
IgG1
Purity:
Cell culture supernatant.
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Pattathil et al. (2012). Immunological approaches to plant cell wall and biomass characterization: Glycome Profiling. Methods Mol Biol. 2012;908:61-72.doi: 0.1007/978-1-61779-956-3_6. Patathil et al. (2010). A comprehensive toolkit of plant cell wall glycan-directed monoclonal antibodies. Plant Physiol. 2010 Jun;153(2):514-25.doi: 10.1104/pp.109.151985.
Special application note:
Exact working dilution needs to be determined by end user
Xyloglucans are polysaccharides commonly refered to as hemicelluloses found in the primary cell walls of vascular plants. This antibody binds to galactosylated side-chains of non-fucosylated xyloglucan-3, and appears to preferentially bind to the galactosylated side-chain closest to the reducing end of xyloglucan oligosaccharide sub-units (XXXG).
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Antibody can be stored up to 1 month at 4 C, and at -80°Cfor up to 1 year. Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
CCRC-M100 binds only to the xyloglucan sub-unit, XXXG, and shows no cross-reactivity with other xyloglucan sub-units tested, CCRC-M100 shows some cross-reactivity with sycamore pectic polysaccharides and linseed mucilage
Application Details:
Undiluted or at 1 : 10 (ELISA), (IF), (IHC)
Conjugation:
IgM
Isotype:
IgM
Purity:
Cell culture supernatant.
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Pattathil et al. (2012). Immunological approaches to plant cell wall and biomass characterization: Glycome Profiling. Methods Mol Biol. 2012;908:61-72.doi: 0.1007/978-1-61779-956-3_6.
Special application note:
Exact working dilution needs to be determined by end user
Xyloglucans are polysaccharides commonly refered to as hemicelluloses found in the primary cell walls of vascular plants. This antibody binds to galactosylated side-chains of non-fucosylated xyloglucan-5, and appears to preferentially bind to the galactosylated side-chain closest to the reducing end of xyloglucan oligosaccharide sub-units (XXLG, XLLG).
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Antibody can be stored up to 1 month at 4 C, and at -80°Cfor up to 1 year. Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
CCRC-M48 binds to galactosylated side-chains of non-fucosylated xyloglucan, and appears to preferentially bind to the galactosylated side-chain closest to the reducing end of xyloglucan oligosaccharide sub-units (XXLG, XLLG)
Application Details:
Undiluted or 1 : 10 (ELISA), (IHC), (IF)
Conjugation:
IgG1
Isotype:
IgG1
Purity:
Cell culture supernatant.
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Exact working dilution needs to be determined by end user
Xyloglucans are polysaccharides commonly refered to as hemicelluloses found in the primary cell walls of vascular plants. This antibody binds to galactosylated side-chains of non-fucosylated xyloglucan-3, and appears to preferentially bind to the galactosylated side-chain closest to the reducing end of xyloglucan oligosaccharide sub-units (XLLG).
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Antibody can be stored up to 1 month at 4 C, and at -80°Cfor up to 1 year. Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Mouse anti-Non-specific control IgG Monoclonal Antibody (Unconjugated), suitable for WB, IHC, ICC, FC, ELISA.
Background Info:
Commonly used mouse IgG1 negative control antibody clone derived from a Balb/c myeloma and is recommend as a negative control for a variety of immunohistochemical applications where mouse IgG experimental antibodies are use. To date no published reactivity as been associated with X63.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized
Host Animal:
Mouse
Species Reactivity:
Non-Reactive (Negative Control)
Immunogen:
None. This control IgG has no known binding ability.
Applications:
ELISA,FC,ICC,IHC,WB
Clone number:
X63
Antibody Isotype:
IgG1, kappa
Application Details:
Recommended for use as a control for Western Blotting, immunohistochemistry and FACS at a concentration equal to that of the test antibody. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
No staining has ever been identified with this immunoglobulin demonstrating its non-specific value as a control. N/A
Storage:
Store lyophilized antibody at 2-8°C. Keep reconstituted antibody at -20°C to -80°C for long-term storage. For short term keep at 2-8°C. We suggest that the customer aliquots the antibody into smaller lots to avoid repeated freezing and thawing.
Purification:
Immunoglobulin purified using Protein G column. Purity analysed using gel electrophoresis.
Stapledon CJM et al. (2019). Human osteocyte expression of Nerve Growth Factor: The effect of Pentosan Polysulphate Sodium (PPS) and implications for pain associated with knee osteoarthritis. PLoS One. 14(9):e0222602. Application: ICC/IF.
Specificity:
No staining has ever been identified with this immunoglobulin demonstrating its value as a control. N/A
Storage:
The antibody conjugate can be stored at 2-8ºC for up to 4 months with the addition of appropriate antibacterial agent. For long-term storage, aliquot and keep antibody at <-20°C in the dark. Avoid repeated freeze-thaw cycles.
Purification:
FITC-labelled X63 antibody was purified by gel filtration.
X63-saporin is an antibody conjugate comprising of the non-specific monoclonal IgG 1 antibody X63, chemically conjugated via a reducible disulfide bridge to the ribosome-inactivating protein saporin, purified from saponaria officinalis . Antibody clone X63 has no known binding ability, and thus can be used as negative control antibody. In combination with saporin, X63-saporin is a useful negative control for targeting IgG1-saporin conjugates such as MC192-saporin.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a 1 mg/mL solution containing PBS pH 7.2-7.6 without preservative.
Host Animal:
Mouse
Species Reactivity:
Non-Reactive (Negative Control)
Immunogen:
Unknown, naturally isolated IgG that has no known binding target in mammals
Applications:
Negative Control
Clone number:
X63
Antibody Isotype:
IgG1, kappa
Application Details:
Negative control for targeting IgG1-saporin conjugates., for instance MC192-saporin. X63-saporin should be used at a concentration equal to that of the test antibody-saporin conjugate.
Biological Activity:
None. Routinely tested for absence of killing of rat C6 cells in vitro. Note that the primary use of X63-saporin is for in vivo applications.
Biosensis Brand:
Biosensis®
Conjugate:
Saporin
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
No staining has ever been identified with this immunoglobulin demonstrating its non-specific value as a control.
Storage:
Lyophilized product is shipped at ambient room temperature. Upon receipt, pulse-centrifuge the vial to collect solid that may be entrapped in the lid. After reconstitution, immediately prepare aliquots and keep the undiluted stock at -80°C for long-term storage. Avoid repeated thaw-freezing. For short-term storage, keep at 2-8°C for up to 2 weeks. it is recommended to handle this product under sterile conditions.
Purification:
Conjugate was purified by ion-exchange chromatography. Purity > 90% by non-reducing SDS-PAGE
X63-saporin is an antibody conjugate comprising of the non-specific monoclonal IgG 1 antibody X63, chemically conjugated via a reducible disulfide bridge to the ribosome-inactivating protein saporin, purified from saponaria officinalis . Antibody clone X63 has no known binding ability, and thus can be used as negative control antibody. In combination with saporin, X63-saporin is a useful negative control for targeting IgG 1 -saporin conjugates such as MC192-saporin.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a 1 mg/mL solution containing PBS pH 7.2-7.6 without preservative.
Host Animal:
Mouse
Species Reactivity:
Non-Reactive (Negative Control)
Immunogen:
Unknown, naturally isolated IgG that has no known binding target in mammals
Applications:
Negative Control
Clone number:
X63
Antibody Isotype:
IgG1, kappa
Application Details:
Negative control for targeting IgG1-saporin conjugates., for instance MC192-saporin. X63-saporin should be used at a concentration equal to that of the test antibody-saporin conjugate.
Biological Activity:
None. Routinely tested for absence of killing of rat C6 cells in vitro. Note that the primary use of X63-saporin is for in vivo applications.
Biosensis Brand:
Biosensis®
Conjugate:
Saporin
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
No staining has ever been identified with this immunoglobulin demonstrating its non-specific value as a control.
Storage:
Lyophilized product is shipped at ambient room temperature. Upon receipt, pulse-centrifuge the vial to collect solid that may be entrapped in the lid. After reconstitution, immediately prepare aliquots and keep the undiluted stock at -80°C for long-term storage. Avoid repeated thaw-freezing. For short-term storage, keep at 2-8°C for up to 2 weeks. it is recommended to handle this product under sterile conditions.
Purification:
Conjugate was purified by ion-exchange chromatography. Purity > 90% by non-reducing SDS-PAGE
X63-saporin is an antibody conjugate comprising of the non-specific monoclonal IgG1 antibody X63, chemically conjugated via a reducible disulfide bridge to the ribosome-inactivating protein saporin, purified from saponaria officinalis . Antibody clone X63 has no known binding ability, and thus can be used as negative control antibody. In combination with saporin, X63-saporin is a useful negative control for targeting IgG 1 -saporin conjugates such as MC192-saporin.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a 1 mg/mL solution containing PBS pH 7.2-7.6 without preservative.
Host Animal:
Mouse
Species Reactivity:
Non-Reactive (Negative Control)
Immunogen:
Unknown, naturally isolated IgG that has no known binding target in mammals
Applications:
Negative Control
Clone number:
X63
Antibody Isotype:
IgG1, kappa
Application Details:
Negative control for targeting IgG1-saporin conjugates., for instance MC192-saporin. X63-saporin should be used at a concentration equal to that of the test antibody-saporin conjugate.
Biological Activity:
None. Routinely tested for absence of killing of rat C6 cells in vitro. Note that the primary use of X63-saporin is for in vivo applications.
Biosensis Brand:
Biosensis®
Conjugate:
Saporin
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
No staining has ever been identified with this immunoglobulin demonstrating its non-specific value as a control.
Storage:
Lyophilized product is shipped at ambient room temperature. Upon receipt, pulse-centrifuge the vial to collect solid that may be entrapped in the lid. After reconstitution, immediately prepare aliquots and keep the undiluted stock at -80°C for long-term storage. Avoid repeated thaw-freezing. For short-term storage, keep at 2-8°C for up to 2 weeks. it is recommended to handle this product under sterile conditions.
Purification:
Conjugate was purified by ion-exchange chromatography. Purity > 90% by non-reducing SDS-PAGE
The BrightDiluents universal IHC diluent is specially formulated to stabilize antibodies and eliminate backgrounds encountered in immunohistochemistry staining procedures. The diluent contains complex proteins and non-protein mixtures which eliminate histostaining background by blocking Fc receptors and prevents non-specific protein-protein interactions. It can also be used as blocking applied before primary antibodies. If primary antibodies are diluted in this diluent, a blocking step before primary antibodies can generally be omitted. The blocking /diluent solution is supplied in Ready-to-Use format. It should not be diluted to be effective. The diluent contains no azide, therefore, it can be used to dilute and stabilize HRP-conjugates as well as any other solution that need and stabilizing carrier protein, such as Blocking and Poly-AP conjugates. This product should be interpreted by a qualified pathologist with relevant clinical information, morphological and histological studies and with proper controls. The ready-to-use antibody diluent is available in different colors: MON-APP917 (Transparant/colorless), MON-APP917B (Blue), MON-APP917Y (Yellow), MON-APP917G (green), MON-APP917R (Red)
Principle of method:
Antibody diluent
Reagents provided:
125 ml BrightDiluent, normal antibody diluent (ready-to-use)
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Bovine Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Bovine Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C. For storage at 2-8 C, add a preservative to prevent growth of bacteria.This product is used as a blocking reagent or control for
Purified serum, lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2.
Special application note:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 C. Centrifuge reconstituted serum to remove any precipitates.This product is used as a blocking reagent or control for most immunoassay applications.
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C. For storage at 2-8 C, add a preservative to prevent growth of bacteria.This product is used as a blocking reagent or control for
Purified serum, lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2.
Special application note:
Rehydrate with 2.2 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 C. Centrifuge reconstituted serum to remove any precipitates.This product is used as a blocking reagent or control for most immunoassay applications.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Dog Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Dog Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Chicken Serum (unspecified gender) was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Chicken Serum (unspecified gender) was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Donkey serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Donkey serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Cross Reactivity:
Serum may may contain anti-feline calicivirus antibodies. Not suitable as negative control within calicivirus assay.
Country Of Origin:
Normal Cat Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Cross Reactivity:
Serum may may contain anti-feline calicivirus antibodies. Not suitable as negative control within calicivirus assay.
Country Of Origin:
Normal Cat Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Goat Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Goat Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Guinea Pig Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 5.5 ml of deionized water. (Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Guinea Pig Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Horse Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Horse Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Human Serum/Plasma was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Human Serum/Plasma was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Country Of Origin:
Normal Llama Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
Non-immune
Country Of Origin:
Normal Llama Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 5.5 ml of deionized water. (Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
Non-immune Ku-Ming (KM) Mouse Strain
Country Of Origin:
Normal Mouse Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
Non-immune Ku-Ming (KM) Mouse Strain
Country Of Origin:
Normal Mouse Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Pig Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Pig Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Rat Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 5.5 ml of deionized water. (Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Rat Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Normal sheep IgG from non-immunized animal, Sheep Polyclonal Antibody
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4, without preservatives.
Host Animal:
Sheep
Species Reactivity:
Non-Reactive (Negative Control)
Immunogen:
None. Sheep IgG is obtained from non-immunized animals.
Applications:
Negative Control
Antibody Isotype:
IgG
Application Details:
Use as negative control for IgG-purified sheep primary antibodies and at matching concentration.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Uncharacterized serum control
Storage:
Store lyophilized sheep IgG at -20°C to -80°C protected from moisture. After reconstitution divide IgG into useful aliquots and keep aliquots at -20°C to -80°C for a higher stability. Working aliquots can be kept at 2-8°C for up to 1 month. Avoid repetitive freeze/thaw cycles.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Sheep Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Sheep Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Normal sheep serum from non-immunized animal, Sheep Polyclonal Antibody
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Sheep
Species Reactivity:
Non-Reactive (Negative Control)
Immunogen:
None. Sheep serum is obtained from non-immunized animals.
Applications:
Negative Control
Antibody Isotype:
Mixed
Application Details:
Use as negative control for IgG-purified sheep primary antibodies and at matching concentration.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Uncharacterized serum control
Storage:
Store lyophilized sheep whole serum at -20°C to -80°C protected from moisture. After reconstitution, divide whole serum nto useful aliquots and keep aliquots at -20°C to -80°C for a higher stability. Working aliquots can be kept at 2-8°C for up to 1 month. Avoid repetitive freeze/thaw cycles.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Syrian Hamster Serum was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 5.5 ml of deionized water. (Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Syrian Hamster Serum was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Novel Juice is a non-mutagenic fluorescent reagent that produces instant visualization of DNA bands upon Blue Light or UV illumination of agarose gels. Supplied in GeneDireXs 6X DNA Loading Buffer, Novel Juice can be used to prepare DNA markers and samples for loading on agarose or polyacrylamide gels. We believe Novel Juice is the most sensitive stain available for detecting double-stranded DNA (dsDNA). It also contains three tracking dyes (Bromophenol Blue, Xylene Cyanol FF, and Orange G) for visually tracking the DNA migration on your gel without illumination. It is a safe , non-hazardous alternative to Ethidum Bromide, having been independently tested.
Background Info:
[APPLICATION] (1) Vortex Novel Juice for 10 seconds prior to use. (2) Dilute 1 part Novel Juice with 5 parts DNA sample or ladder and mix. (3) Load sample and run according to your standard lab procedures. (4) After electrophoresis, remove the gel and place it on UV or a visible-light transilluminator to visualize the bands. (5) Gels can also be post-stained with Ethidium Bromide if desired.
Gel Stain, Ethidium Bromide Alternative, DNA stain, nucleic acid dye, nucleic acid stain, DNA dye
Additional Info:
Contains Tracking Dyes: Bromophenol Blue, Xylene Cyanol FF, and Orange G. Store at room temperature or at 4°C up to 12 months. For longer periods, store at -20°C. Novel Juice Dye is light sensitive and should be stored protected from light.
Novel Juice is a non-mutagenic fluorescent reagent that produces instant visualization of DNA bands upon Blue Light or UV illumination of agarose gels. Supplied in GeneDireXs 6X DNA Loading Buffer, Novel Juice can be used to prepare DNA markers and samples for loading on agarose or polyacrylamide gels. We believe Novel Juice is the most sensitive stain available for detecting double-stranded DNA (dsDNA). It also contains three tracking dyes (Bromophenol Blue, Xylene Cyanol FF, and Orange G) for visually tracking the DNA migration on your gel without illumination. It is a safe , non-hazardous alternative to Ethidum Bromide, having been independently tested.
Background Info:
[APPLICATION] (1) Vortex Novel Juice for 10 seconds prior to use. (2) Dilute 1 part Novel Juice with 5 parts DNA sample or ladder and mix. (3) Load sample and run according to your standard lab procedures. (4) After electrophoresis, remove the gel and place it on UV or a visible-light transilluminator to visualize the bands. (5) Gels can also be post-stained with Ethidium Bromide if desired.
Gel Stain, Ethidium Bromide Alternative, DNA stain, nucleic acid dye, nucleic acid stain, DNA dye
Additional Info:
Contains Tracking Dyes: Bromophenol Blue, Xylene Cyanol FF, and Orange G. Store at room temperature or at 4°C up to 12 months. For longer periods, store at -20°C. Novel Juice Dye is light sensitive and should be stored protected from light.
Novel Juice is a non-mutagenic fluorescent reagent that produces instant visualization of DNA bands upon Blue Light or UV illumination of agarose gels. Supplied in GeneDireXs 6X DNA Loading Buffer, Novel Juice can be used to prepare DNA markers and samples for loading on agarose or polyacrylamide gels. We believe Novel Juice is the most sensitive stain available for detecting double-stranded DNA (dsDNA). It also contains three tracking dyes (Bromophenol Blue, Xylene Cyanol FF, and Orange G) for visually tracking the DNA migration on your gel without illumination. It is a safe , non-hazardous alternative to Ethidum Bromide, having been independently tested.
Background Info:
[APPLICATION] (1) Vortex Novel Juice for 10 seconds prior to use. (2) Dilute 1 part Novel Juice with 5 parts DNA sample or ladder and mix. (3) Load sample and run according to your standard lab procedures. (4) After electrophoresis, remove the gel and place it on UV or a visible-light transilluminator to visualize the bands. (5) Gels can also be post-stained with Ethidium Bromide if desired.
Gel Stain, Ethidium Bromide Alternative, DNA stain, nucleic acid dye, nucleic acid stain, DNA dye
Additional Info:
Contains Tracking Dyes: Bromophenol Blue, Xylene Cyanol FF, and Orange G. Store at room temperature or at 4°C up to 12 months. For longer periods, store at -20°C. Novel Juice Dye is light sensitive and should be stored protected from light.
Rabbit anti-Noxa Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
The Bcl-2 family of proteins which regulate apoptosis share identical sequences called Bcl-2 Homology domains (BH1-4). The BH3 proteins, including BID, NOXA, PUMA, BIK, BIM and BAD are all pro-apoptotic and share sequence identity within the amphipathic alpha-helical BH3 region, which is essential for their apoptotic function. NOXA is highly expressed in adult T-cell leukemia cell line.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Mouse
Immunogen:
A synthetic peptide (CAQLRR IGDKVNLRQK) as part of mouse Noxa (aa: 75-90) conjugated to diphtheria toxoid
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:1000 to 1:2000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
PMAIP1; phorbol-12-myristate-13-acetate-induced protein 1; adult T cell leukemia-derived PMA-responsive; Immediate-early-response protein APR; PMA-induced protein 1; Pmaip1; Noxa
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Western blot analysis of cells infected with Noxa adenoviruses and BAF indicates a high level of specificity for this antiserum. This antiserum cross-reacts with mouse. Not yet tested in other species.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Noxa Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
The Bcl-2 family of proteins which regulate apoptosis share identical sequences called Bcl-2 Homology domains (BH1-4). The BH3 proteins, including BID, NOXA, PUMA, BIK, BIM and BAD are all pro-apoptotic and share sequence identity within the amphipathic alpha-helical BH3 region, which is essential for their apoptotic function. NOXA is highly expressed in adult T-cell leukemia cell line.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Mouse
Immunogen:
A synthetic peptide (MPGRKARRNA PVNPTR) as part of mouse Noxa (aa: 1-16) conjugated to diphtheria toxoid
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:1000 to 1:2000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
PMAIP1; phorbol-12-myristate-13-acetate-induced protein 1; adult T cell leukemia-derived PMA-responsive; Immediate-early-response protein APR; PMA-induced protein 1; Pmaip1; Noxa
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Western blot analysis of cells infected with Noxa adenoviruses and BAF indicates a high level of specificity for this antiserum. This antiserum cross-reacts with mouse. Not yet tested in other species.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Halorhodopsin (HR) is a hyperpolarizing light-driven ion pump from the halophilic archaea bacterium Natronomonas pharaonis. HR uses the energy of yellow light (excitation maximum near 580 nm) to mediate primarily chloride but also bromide, iodide, and nitrate import into the cell against their electrochemical gradients.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Natronomonas pharaonis
Expected Species:
Natronomonas pharaonis Species of your interest not listed? Contact us
Immunofluorescence was performed on mouse brain slices (data not shown)
Application Details:
1 : 200 (IF), 1 : 1000-1 : 20 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
30,9 | 30 kDa
Not reactive in:
Halobacterium salinarum (HsHR and HsBR)
Selected references:
Alfonsa et al. (2015) The contribution of raised intraneuronal chloride to epileptic network activity. J Neurosci. 2015 May 20;35(20):7715-26. doi: 10.1523/JNEUROSCI.4105-14.2015.
NPR1 (regulatory protein NPR1) is a key positive regulator of the SA-dependent signaling pathway that negatively regulates JA-dependent signaling pathway. Controls the onset of systemic acquired resistance (SAR). Subcellular localization: cytoplasm, nucleaus (following induction by salicylic acid treatment or after pathogen infection. Alternative names: BTB/POZ domain-containing protein NPR1, Non-inducible immunity protein 1, Nim1, Salicylic acid insensitive 1, Sai1, ATNPR1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles,Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabidopsis thaliana
Immunogen:
KLH-conjugated peptide, chosen from NPR1 sequence of Arabidopsis thaliana, TAIR: AT1G64280, UniProt: P93002
Please note that depending upon detection system you are using, longer exposure time may be required with this antibody, Chemiluminescent detection reagent in extreme femtogram range is necessary
Arenas-Alfonseca et al. (2021) Arabidopsis beta-cyanoalanine synthase mutation overcomes NADPH oxidase action in response to pathogens. J Exp Bot. 2021 Mar 26:erab137. doi: 10.1093/jxb/erab137. Epub ahead of print. PMID: 33770168.Nomoto et al. (2021) Suppression of MYC transcription activators by the immune cofactor NPR1 fine-tunes plant immune responses. Cell Rep. 2021 Dec 14;37(11):110125. doi: 10.1016/j.celrep.2021.110125. PMID: 34910911.Lei et al. (2020). Construction of gold-siRNANPR1 nanoparticles for effective and quick silencing of NPR1 in Arabidopsis thaliana. DOI: 10.1039/D0RA02156C (Paper) RSC Adv., 2020, 10, 19300-19308
Special application note:
For successful detection using NPR1 antibody please follow protocol suggested below. NPR1 protein readily oligomerizes, in addition to any naturally occurring oligomer, during extraction. Therefore 50 mM DTT has to be used as well as denaturation at 75 C for 15 minutes. Engogenous NPR1 level is very low, thereofre SA treatment is absolutely necessary for good detection.This antibody is recognizing NPR1-GFP in the 35S overexpression line.
NPR1 (regulatory protein NPR1) is a key positive regulator of the SA-dependent signaling pathway that negatively regulates JA-dependent signaling pathway. Controls the onset of systemic acquired resistance (SAR). Subcellular localization: cytoplasm, nucleaus (following induction by salicylic acid treatment or after pathogen infection. Alternative names: BTB/POZ domain-containing protein NPR1, Non-inducible immunity protein 1, Nim1, Salicylic acid insensitive 1, Sai1, ATNPR1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles,Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabidopsis thaliana
Immunogen:
KLH-conjugated peptide, chosen from NPR1 sequence of Arabidopsis thaliana, TAIR: AT1G64280, UniProt: P93002
For successful detection using NPR1 antibody please follow protocol suggested below. NPR1 protein readily oligomerizes, in addition to any naturally occurring oligomer, during extraction. Therefore 50 mM DTT has to be used as well as denaturation at 75 C for 15 minutes. Engogenous NPR1 level is very low, thereofre SA treatment is absolutely necessary for good detection.This antibody is recognizing NPR1-GFP in the 35S overexpression line.
Assimilatory nitrate reductase (NR), (EC.1.6.6.1) catalyses the reduction of nitrate to nitrite in the cytoplasm. Plants contain 2 forms of NR: NADH-NR (most common form in plants and algae, predominantly found in green tissues) and NAD(P)H-NR (uses NADH or NADPH as the electron donor, constitutively expressed in plants at a low level). NADH-NR is a homodimer of two identical subunits (100-115 kDa each, hold together by a Mo-cofactor) each of them coded by up to three genes (NR1-3, NIA1-NIA3).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
KLH-conjugated synthetic peptide derived from conserved domain in NADH-NR protein sequences including A.thaliana NR1 P11832, At1g77760 and NR2 P11035, At1g37130
In Chlamydmonas reinhardtii anti-NR antibody is also reacting with L-Aminoacid Oxidase (a nitrogen scavenging enzyme induced during nitrogen starvation).Using this antibody genome editing in Chlorella vulgaris UTEX395 by CRISPR-Cas9 system has been demonstrated as described in Kim et al. (2021)Chemiluminescent detection is advised for NR detection using this antibody.
Costa-Broseta et al. (2021). Post-Translational Modifications of Nitrate Reductases Autoregulates Nitric Oxide Biosynthesis in Arabidopsis. Int J Mol Sci. 2021 Jan 7;22(2):E549. doi: 10.3390/ijms22020549. PMID: 33430433.Kim et al. (2021). Establishment of a Genome Editing Tool Using CRISPR-Cas9 in Chlorella vulgaris UTEX395. Int J Mol Sci. 2021 Jan 6;22(2):E480. doi: 10.3390/ijms22020480. PMID: 33418923.Prinsi et al. (2021). Biochemical and Proteomic Changes in the Roots of M4 Grapevine Rootstock in Response to Nitrate Availability. Plants 10, no. 4: 792. https://doi.org/10.3390/plants10040792Maresca et al. (2021) Biological responses to heavy metal stress in the moss Leptodictyum riparium (Hedw.) Warnst. Ecotoxicol Environ Saf. 2022 Jan 1;229:113078. doi: 10.1016/j.ecoenv.2021.113078. Epub 2021 Dec 17. PMID: 34929502.Zhang et al. (2020). Hydrogen sulfide and rhizobia synergistically regulate nitrogen (N) assimilation and remobilization during N deficiency-induced senescence in soybean. Plant Cell Environ. 2020 Feb 3. doi: 10.1111/pce.13736.
NRT1.1 (nitrate transporter 1.1) is a dual-affinity nitrate transporter which acts also as a nitrate sensor. High-affinity nitrate transporter when phosphorylated and low-affinity transported when dephosphorylated. Low nitrogen concentration stimulates phosphorylation. Expressed in lateral roots. Alternative names: AtNRT1, Nitrate/chlorate transporter, protein CHLORINA 1, AtNPF6.3.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica napusSpecies of your interest not listed? Contact us
Medici et al. (2015). AtNIGT1/HRS1 integrates nitrate and phosphate signals at the Arabidopsis root tip. Nat Commun. 2015 Feb 27;6:6274. doi: 10.1038/ncomms7274
NRT2.1 is a high affinity nitrate transporter which is up-regulated by nitrate. Functions as a repressor of lateral root initiation independently of nitrate uptake. Synonymes: Protein ACH1, Protein LATERAL ROOT INITIATION 1, ACH1, ATNRT2.1, ATNRT2:1,, LIN1, NITRATE TRANSPORTER 2, NITRATE TRANSPORTER 2.1, NITRATE TRANSPORTER 2:1, NRT2, NRT2.1, NRT2:1, NRT2;1AT
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica juncea, Brassica napus, Brassuca rapa, Ricinus communisSpecies of your interest not listed? Contact us
Microsomal fraction is recommended to be used as it will have higher amount of NRT2,1 protein, If a total protein extract is used SDS should be applied from the beginning in extraction buffer as well as protease inhibitor coctail
Application Details:
1 : 5000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
57,7 | 45 kDa
Not reactive in:
Alexandrium pacificum, Solanum tuberosum
Selected references:
Zou et al. (2019). Phosphorylation at Ser28 stabilizes the Arabidopsis nitrate transporter NRT2.1 in response to nitrate limitation. J Integr Plant Biol. 2019 Jul 24. doi: 10.1111/jipb.12858.
The fragments in our 100bp ladder range from 100-1,500 base pairs, with the 500 and 1,500 base pair bands having increased intensity to act as key reference points. There are 11 bands in total.
The expected mass of DNA in each band (based on a total of 0.5 ug in a 5ul load) is provided for approximating the mass of DNA in sample bands of a similar size.
Our DNA ladders are a combination of a plasmid digested DNA and PCR products, providing precise fragments.
PLEASE E-MAIL US TO REQUEST A FREE SAMPLE. .
Arrange for our DNA ladders to be in your stores and receive 5 vials of any of our DNA ladders for free. Email us for more details - tech@nktscientific.com.
Background Info:
Our 100bp ladder is provided ready to use with orange G & xylene cyanol FF included as tracking dyes.
Product Type:
NS Reagents DNA Ladder
Format:
Buffer: 10mM Tris-HCl (pH 8.0) and 10mM EDTA
Storage Temp:
Store at 25°C, for 6 months or 4°C for a year. For long-term storage, store at -20°C.
The fragments in our 100bp ladder range from 100-1,500 base pairs, with the 500 and 1,500 base pair bands having increased intensity to act as key reference points. There are 11 bands in total.
The expected mass of DNA in each band (based on a total of 0.5 ug in a 5ul load) is provided for approximating the mass of DNA in sample bands of a similar size.
Our DNA ladders are a combination of a plasmid digested DNA and PCR products, providing precise fragments.
PLEASE E-MAIL US TO REQUEST A FREE SAMPLE.
Arrange for our DNA ladders to be in your stores and receive 5 vials of any of our DNA ladders for free. Email us for more details - tech@nktscientific.com.
Background Info:
Our 100bp ladder is provided ready to use with orange G & xylene cyanol FF included as tracking dyes.
Product Type:
NS Reagents DNA Ladder
Format:
Buffer: 10mM Tris-HCl (pH 8.0) and 10mM EDTA
Storage Temp:
Store at 25°C, for 6 months or 4°C for a year. For long-term storage, store at -20°C.
The fragments in our 1Kbp ladder range from 250-10,000 base pairs, with the 1K and 3K base pair bands having increased intensity to act as key reference points. There are 13 bands in total.
The expected mass of DNA in each band (based on a total of 0.5 ug in a 5ul load) is provided for approximating the mass of DNA in sample bands of a similar size.
Our DNA ladders are a combination of a plasmid digested DNA and PCR products, providing precise fragments.
PLEASE E-MAIL US TO REQUEST A FREE SAMPLE. .
Arrange for our DNA ladders to be in your stores and receive 5 vials of any of our DNA ladders for free. Email us for more details - tech@nktscientific.com.
Background Info:
Our 1Kbp ladder is provided ready to use with bromophenol blue & xylene cyanol FF included as tracking dyes.
Product Type:
NS Reagents DNA Ladder
Format:
Buffer: 10mM Tris-HCl (pH 8.0) and 10mM EDTA
Storage Temp:
Store at 25°C, for 6 months or 4°C for a year. For long-term storage, store at -20°C.
The fragments in our 1Kbp ladder range from 250-10,000 base pairs, with the 1K and 3K base pair bands having increased intensity to act as key reference points. There are 13 bands in total.
The expected mass of DNA in each band (based on a total of 0.5 ug in a 5ul load) is provided for approximating the mass of DNA in sample bands of a similar size.
Our DNA ladders are a combination of a plasmid digested DNA and PCR products, providing precise fragments.
PLEASE E-MAIL US TO REQUEST A FREE SAMPLE.
Arrange for our DNA ladders to be in your stores and receive 5 vials of any of our DNA ladders for free. Email us for more details - tech@nktscientific.com.
Background Info:
Our 1Kbp ladder is provided ready to use with bromophenol blue & xylene cyanol FF included as tracking dyes.
Product Type:
NS Reagents DNA Ladder
Format:
Buffer: 10mM Tris-HCl (pH 8.0) and 10mM EDTA
Storage Temp:
Store at 25°C, for 6 months or 4°C for a year. For long-term storage, store at -20°C.
The fragments in our 50bp ladder range from 50-1,500 base pairs, with the 200, 500 and 1,200 base pair bands having increased intensity to act as key reference points. There are 17 bands in total.
The expected mass of DNA in each band (based on a total of 0.56 ug in a 5ul load) is provided for approximating the mass of DNA in sample bands of a similar size.
Our DNA ladders are a combination of a plasmid digested DNA and PCR products, providing precise fragments.
PLEASE E-MAIL US TO REQUEST A FREE SAMPLE. .
Arrange for our DNA ladders to be in your stores and receive 5 vials of any of our DNA ladders for free. Email us for more details - tech@nktscientific.com.
Background Info:
Our 50bp ladder is provided ready to use with orange G as the tracking dye.
Product Type:
NS Reagents DNA Ladder
Format:
Buffer: 10mM Tris-HCl (pH 8.0) and 10mM EDTA
Storage Temp:
Store at 25°C, for 6 months or 4°C for a year. For long-term storage, store at -20°C.
The fragments in our 50bp ladder range from 50-1,500 base pairs, with the 200, 500 and 1,200 base pair bands having increased intensity to act as key reference points. There are 17 bands in total.
The expected mass of DNA in each band (based on a total of 0.56 ug in a 5ul load) is provided for approximating the mass of DNA in sample bands of a similar size.
Our DNA ladders are a combination of a plasmid digested DNA and PCR products, providing precise fragments.
PLEASE E-MAIL US TO REQUEST A FREE SAMPLE. .
Arrange for our DNA ladders to be in your stores and receive 5 vials of any of our DNA ladders for free. Email us for more details - tech@nktscientific.com.
Background Info:
Our 50bp ladder is provided ready to use with orange G as the tracking dye.
Product Type:
NS Reagents DNA Ladder
Format:
Buffer: 10mM Tris-HCl (pH 8.0) and 10mM EDTA
Storage Temp:
Store at 25°C, for 6 months or 4°C for a year. For long-term storage, store at -20°C.
Neuron-Specific Enolase (NSE), also known as Enolase 2 (ENO2), is one of three enolase enzymes found in mammals, and acts as a phosphopyruvate hydratase. This mammalian glycolytic isoenzyme is located specifically in neurons of neuroendocrine cells, as well as tumours associated with those neurons. However, it has also been detected immunohistochemically in non-neoplastic cells of the pituitary, peptide-secreting tissues, pinealocytes, neuroendocrine cells of the lung, thyroid, parafollicular cells, adrenal medulla, islets of Langerhans, Merkel cells of the skin, and melanocytes. NSE is a useful marker for identifying normal striated muscle, hepatocytes, and peripheral nerves. Anti-NSE may detect for neuroendocrine differentiation, only when used in a panel of antibodies including more specific markers such as synaptophysin, chromogranin, and neurofilament.
Neuron-Specific Enolase (NSE), also known as Enolase 2 (ENO2), is one of three enolase enzymes found in mammals, and acts as a phosphopyruvate hydratase. This mammalian glycolytic isoenzyme is located specifically in neurons of neuroendocrine cells, as well as tumours associated with those neurons. However, it has also been detected immunohistochemically in non-neoplastic cells of the pituitary, peptide-secreting tissues, pinealocytes, neuroendocrine cells of the lung, thyroid, parafollicular cells, adrenal medulla, islets of Langerhans, Merkel cells of the skin, and melanocytes. NSE is a useful marker for identifying normal striated muscle, hepatocytes, and peripheral nerves. Anti-NSE may detect for neuroendocrine differentiation, only when used in a panel of antibodies including more specific markers such as synaptophysin, chromogranin, and neurofilament.
Neuron-Specific Enolase (NSE), also known as Enolase 2 (ENO2), is one of three enolase enzymes found in mammals, and acts as a phosphopyruvate hydratase. This mammalian glycolytic isoenzyme is located specifically in neurons of neuroendocrine cells, as well as tumours associated with those neurons. However, it has also been detected immunohistochemically in non-neoplastic cells of the pituitary, peptide-secreting tissues, pinealocytes, neuroendocrine cells of the lung, thyroid, parafollicular cells, adrenal medulla, islets of Langerhans, Merkel cells of the skin, and melanocytes. NSE is a useful marker for identifying normal striated muscle, hepatocytes, and peripheral nerves. Anti-NSE may detect for neuroendocrine differentiation, only when used in a panel of antibodies including more specific markers such as synaptophysin, chromogranin, and neurofilament.
The NSR Prestained Protein Ladder is a three colour protein standard with 13 prestained proteins covering molecular weights from 3.5 to 245 kilodaltons. It has been designed for use in most general applications for a protein ladder with a broad range of protein sizes, key reference bands and excellent Western transfer efficiency (tested with PVDF, nylon and nitrocellulose membranes).
Background Info:
Most of the proteins are covalently coupled with a blue chromophore apart from two reference bands, one stained red at 75 kDa and one stained green at 25 kDa for easy reading of the ladder and to aid in the monitoring of protein separation.
The NSR Prestained Protein Ladder is supplied ready to use in gel loading buffer.
PLEASE E-MAIL US TO REQUEST A FREE SAMPLE.
Arrange for our Protein ladder to be in your stores and receive a free vial. Email us for more details - tech@nktscientific.com.
Product Type:
NS Reagents Protein Ladder
Format:
Buffer: 20 mM Tris-phosphate, pH 7.5, 2% SDS, 0.2 mM Dithiothreitol, 3.6 M Urea, 15 % (v/v) Glycerol.
Storage Temp:
Store at 25°C, for 2 weeks or 4°C for 3 months. For long-term storage, store at -20°C.
The shelf life is 1 year from receipt when stored frozen, however the NSR Prestained Protein Ladder should be stable for many years if stored frozen and excessive freeze thaw cycles are avoided.
NTAL (non-T cell activation linker), also known as LAB (linker for activation of B cells), is a 30 kDa double-palmitoylated transmembrane adaptor protein expressed by B cells, NK cells, mast cells and macrophages. It is a negative regulator of early stages of BCR-dependent B cell signaling and serves as a negative regulator also in mast cells. However, in mast cells, NTAL also contributes to some activation processes, partially overlapping with LAT function.
Product Type:
Antibodies Primary
Antibody Type:
polyclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant mouse NTAL (aa 30-203).
Applications:
WB,ICC
Additional Info:
The polyclonal antibody reacts with intracellular part of Non-T cell Activation Linker (NTAL), also known as LAB (linker of activated B cells), a 25 kDa transmembrane adaptor protein present in membrane microdomains (rafts) of B cells, NK cells and myeloid cells.
NTAL (non-T cell activation linker), also known as LAB (linker for activation of B cells), is a 30 kDa double-palmitoylated transmembrane adaptor protein expressed by B cells, NK cells, mast cells and macrophages. It is a negative regulator of early stages of BCR-dependent B cell signaling and serves as a negative regulator also in mast cells. However, in mast cells, NTAL also contributes to some activation processes, partially overlapping with LAT function.
Product Type:
Antibodies Primary
Antibody Type:
polyclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant cytoplasmic domain (aa 91-243) of human NTAL.
Applications:
WB,IHC
Additional Info:
The polyclonal antibody recognizes a defined intracellular region (aa 91-243) of human Non-T cell Activation Linker (NTAL), also known as LAB (linker of activated B cells), a 30 kDa transmembrane adaptor protein present in membrane microdomains (rafts) of B cells, NK cells and myeloid cells.
Clone number:
PAb (485)
Application Details:
Western blotting: Recommended dilution: 1 ?g/ml; positive control: RAMOS human lymphoma cell line, THP-1 human monocytic leukemia cell line; negative control: JURKAT human T cell leukemia cell line; non-reducing conditions, 15% separating SDS-PAGE gel. Immunohistochemistry (paraffin sections): Recommended dilution:10 ?g/ml; positive tissue: spleen.
NtcA acts as a transcriptional activator of genes subjected to nitrogen control.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Synechocystis sp. PCC6803
Expected Species:
Anabaena sp., Gleobacter sp., marine Synechococcus strains, Trichodesmium sp. Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from known cyanobacterial NtcA protein sequences including UniProt: P33779
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Ge at al. (2017). Translating Divergent Environmental Stresses into a Common Proteome Response through the Histidine Kinase 33 (Hik33) in a Model Cyanobacterium. Mol Cell Proteomics. 2017 Jul;16(7):1258-1274. doi: 10.1074/mcp.M116.068080.
Thioredoxin Reductase (TR, TrxR) is the only known enzyme (EC 1.8.1.9) which is reducing thoredoxin (Trx). Activity of thoredoxin is essential for growth and survival of the cell. There seem to be one isoform of NtrC protein in Arabidopsis which includes an N-terminal reductase domain and a C-terminal domain related to thioredoxin proteins. Arabidopsis thaliana and Chlmydomonas reinhardtii NtrC proteins are ca. 568 amino acids long, but include ca. 80 amino acid signal peptides, for mature protein size of ca. 488 amino acids.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Expected Species:
Chlamydia sp., Marchantia polymorpha, Nannochloropsis gaditana, Ostreococcus luminarius, Physcomitrium patens, Synechococcus sp.Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from N-terminal domain of NtrC of Chlamydomonas reinhardtii A8HNQ7
Antibody will react with long NtrC of Chlamydomonas reinhardtii proteins and shorter NtrA-type rpoteins, which would be distinguished by migration size.
Application Details:
1 : 500 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 100 l of sterile water
Molecular Weight:
55,3 | 49 kDa (following processing)
Not reactive in:
Arabidopsis thaliana
Special application note:
Peptide target chosen from the N-terminal domain, nearly fully conserved within 3-4 NtrA-related proteins from Arabidopsis thalina and with NtrC related proteins from Chlamydomonas reinhardtii and Synechococcus sp. 7942 and other cyanobacteria
Thioredoxin Reductase (TR, TrxR) is the only known enzyme (EC 1.8.1.9) which is reducing thoredoxin (Trx) Involved in chloroplast protection against oxidative damage. Activity of thoredoxin is essential for growth and survival of the cell. There seem to be one isoform of NtrC protein in Arabidopsis thaliana, which includes an N-terminal reductase domain and a C-terminal domain related to thioredoxin proteins. Arabidopsis thaliana and Chlmydomonas reinhardtii NtrC proteins are ca. 568 amino acids long, but include ca. 80 amino acid signal peptides, for mature protein size of ca. 488 amino acids.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
KLH-conjugated peptide derived from N-terminal domain of NtrC of Chlamydomonas reinhardtii A8HNQ7The peptide is perfectly conserved in Arabidopsis thaliana NTRC, UniProt: , TAIR: AT2G41680
55.3 kDa (Chlamydomonas reinhardtii), 57.9 kDa (Arabidopsis thaliana), further processed into the matured form
Special application note:
Peptide target chosen from the N-terminal domain, nearly fully conserved within 3-4 NtrA-related proteins from Arabidopsis thalina and with NtrC related proteins from Chlamydomonas reinhardtii and Synechococcus sp. 7942 and other cyanobacteria
Neurotrophic tyrosine kinase receptor (NTRK) is a family of 3 proto-oncogenes including NTRK1, NTRK2, and NTRK3. NTRK gene fusions have been reported in a variety of tumor types, which are involved in biological processes such as neuronal survival, differentiation, and plasticity under physiological circumstances. Recently, FDA has approved ENtrectinib for patients with NTRK fusions, thus testing for NTRK fusions identifies patients who may be candidates for NTRK inhibitor therapy.
Neurotrophic tyrosine kinase receptor (NTRK) is a family of 3 proto-oncogenes including NTRK1, NTRK2, and NTRK3. NTRK gene fusions have been reported in a variety of tumor types, which are involved in biological processes such as neuronal survival, differentiation, and plasticity under physiological circumstances. Recently, FDA has approved ENtrectinib for patients with NTRK fusions, thus testing for NTRK fusions identifies patients who may be candidates for NTRK inhibitor therapy.
Neurotrophic tyrosine kinase receptor (NTRK) is a family of 3 proto-oncogenes including NTRK1, NTRK2, and NTRK3. NTRK gene fusions have been reported in a variety of tumor types, which are involved in biological processes such as neuronal survival, differentiation, and plasticity under physiological circumstances. Recently, FDA has approved ENtrectinib for patients with NTRK fusions, thus testing for NTRK fusions identifies patients who may be candidates for NTRK inhibitor therapy.
Nuclear Fast Red nuclear counterstain solution is a rapid staining procedure which is a popular alternative to hematoxylin and typically stains nuclei in five minutes. IHC related
Nuclear Fast Red nuclear counterstain solution is a rapid staining procedure which is a popular alternative to hematoxylin and typically stains nuclei in five minutes. IHC related
Mouse anti-Nuclear pore complex protein Nup107 Monoclonal Antibody (Unconjugated), suitable for ICC.
Background Info:
The Nuclear Core Complex (NPC) acts as a gateway for macromolecular traffic between the cytoplasm and the nucleus.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Mouse
Species Reactivity:
Human,Mouse,Rat,Yeast
Immunogen:
Yeast nuclear preparation
Applications:
ICC
Clone number:
39C7
Antibody Isotype:
IgG1
Application Details:
Immunocytochemistry (ICC). A dilution of 1:50-1:500 is recommended for IC. This antibody does not work well for Western Blotting. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Nuclease from Staphylococcus aureus is an enzyme secreted by these bacteria to degrade neutrophil extracellular trap of a host.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Staphylococcus aureus
Expected Species:
Species of your interest not listed?Contact us
Immunogen:
Nuclease isolated and purified from Staphylococcus aureus
Applications:
Dot blot (Dot), ELISA (ELISA), Indirect immunofluorescence (indirect IF), Western blot (WB)
Nuclease from Staphylococcus aureus is an enzyme secreted by these bacteria to degrade neutrophil extracellular trap of a host.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Staphylococcus aureus
Expected Species:
Species of your interest not listed?Contact us
Immunogen:
Nuclease isolated and purified from Staphylococcus aureus
Applications:
Dot blot (Dot), ELISA (ELISA), Indirect immunofluorescence (indirect IF),Western blot (WB)
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Guilardia theta
Expected Species:
Algae, Cryptophyte Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from N-terminal sequence of nucleomorph protein.
This antibody can be used as a marker of nucleomorph in fractionation studies
Application Details:
1 : 1000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
13 kDa
Selected references:
Funk et al. (2011). High light stress and the one-helix LHC-like proteins of the cryptophyte Guillardia theta. Biochim Biophys Acta. 2011 Jul;1807(7):841-6. doi: 10.1016/j.bbabio.2011.03.011.
Nucleaoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) plays a fundamental role during virion assembly through packaging of the positive strand viral genome RNA into a helical ribonucleocapsid (RNP).Alternative names: NC, Protein N, Nucleocapsid protein
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at -20 °C or -80°C. Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Mouse
Species Reactivity:
Human Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV
Immunogen:
Recombinant Human Novel Coronavirus Nucleoprotein (N) (1-419aa), UniProt: P0DTC9
Affinity chrompatography purified in 10 mM PBS, pH 7.4, 50 % glycerol, 0.03% Proclin 300.
Molecular Weight:
48 | 55 kDa
Special application note:
This product is a capture antibody, which can be combined with Detection antibody: AS21 4577 | Anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human), monoclonal antibodiesand Positive control: AS20 4388 | Human Novel Coronavirus Nucleoprotein(N)
Nucleaoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) plays a fundamental role during virion assembly through packaging of the positive strand viral genome RNA into a helical ribonucleocapsid (RNP).Alternative names: NC, Protein N, Nucleocapsid protein
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at -20 °C or -80°C. Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Mouse
Species Reactivity:
Human Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV
Immunogen:
Recombinant Human Novel Coronavirus Nucleoprotein (N) (1-419aa), UniProt: P0DTC9
Affinity chrompatography purified in 10 mM PBS, pH 7.4, 50 % glycerol, 0.03% Proclin 300.
Molecular Weight:
48 | 55 kDa
Special application note:
This is a detection antibody, which can be combined with Capture antibody:AS21 4576 | Anti-Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human), monoclonal antibodies and Positive control: AS20 4388 | Human Novel Coronavirus Nucleoprotein(N)
Nucleaoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) plays a fundamental role during virion assembly through packaging of the positive strand viral genome RNA into a helical ribonucleocapsid (RNP).Alternative names: NC, Protein N, Nucleocapsid protein
Product Type:
Antibody
Antibody Type:
Monoclonal recombinant (clone 1A6)
Format:
Liquid
Storage Temp:
Store at -20 °C or -80 C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Mouse
Species Reactivity:
Human Nucleoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV
Immunogen:
Recombinant Human Novel Coronavirus Nucleoprotein (N) (1-419aa), UniProt: P0DTC9
Recombinant anti-SARS-CoV-2 Nucleoprotein Mouse ScFv were expressed in 293 cells (HEK293) with a human IgG1 Fc tag on C-terminal. Therefore, anti-human IgG1 Fc, secondary antibody has to be used: AS10 791 | Anti-Human IgG Fc, HRP conjugated, goat antibodiesAS10 797 | Anti-Human IgG Fc, HRP conjugated, min. cross-reactivity bovine/mouse/rabbit serum, goat antibodiesAS10 787 | Anti-Human IgG Fc, ALP conjugated, goat antibodies AS10 793 | Anti-Human IgG Fc, ALP conjugated, min. cross-reactivity to bovine/mouse/rabbit serum, goat antibodies
YFP (Yellow Fluorescent Protein) is a genetic mutant of green fluorescent protein (GFP). YFP has an excitation peak at 514 nm and emission peak at 527 nm.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
N-YFP tagged proteins from Arabidopsis thaliana, Escherichia coli, Nicotiana tabacum
Immunogen:
KLH-conjugated synthetic peptide derived from N-terminal of YFP protein.
YFP molecular weight is 27 kDa, however detected band is going to have MW increased by a fused protein
Application Details:
1 : 2000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Li et al. (2021) Two ubiquitin-associated ER proteins interact with COPT copper transporters and modulate their accumulation, Plant Physiology, 2021;, kiab381, https://doi.org/10.1093/plphys/kiab381Lung et al. (2021) Oxylipin signaling in salt-stressed soybean is modulated by ligand-dependent interaction of Class II acyl-CoA-binding proteins with lipoxygenase. Plant Cell. 2021 Dec 17:koab306. doi: 10.1093/plcell/koab306. Epub ahead of print. PMID: 34919703.Schultz-Larsen et al. (2018). The AMSH3 ESCRT-III-Associated Deubiquitinase Is Essential for Plant Immunity. Cell Rep. 2018 Nov 27;25(9):2329-2338.e5. doi: 10.1016/j.celrep.2018.11.011.
Chicken anti-Obestatin Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
Obestatin is generated from the proteolytic cleavage of Ghrelin.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Mouse,Rat
Immunogen:
Obestatin peptide (76-98 aa) from mouse ghrelin precursor.
Applications:
ELISA
Antibody Isotype:
IgY
Application Details:
ELISA . Suggested dilution at 1:500 to 1:2,000 in coating buffer as coating antibody in competitive ELISA testing. Biosensis recommends that the optimal working dilution should be determined by the end user.
Ochratoxin A, a toxin produced by Aspergillus ochraceus and Penicillium verrucosum, is one of the most abundant food-contaminating mycotoxins in the world. The toxin has been found in the tissues and organs of animals, including human blood and breast milk. Ochratoxin A can cause immunosuppression and immunotoxicity in animals.
Octamer-Binding Transcription Factor 4 (Oct-4), also known as POU5F1 (POU Domain, Class 5, Transcription Factor 1), is a member of the POU homeodomain family of transcription factors and is involved in the maintenance and regulation of pluripotency in embryonic stem and germ cells. Anti-Oct-4 is highly useful and sensitive for seminomas, germinoma, dysgerminoma, embryonal carcinoma, and gonadoblastoma. Oct-4 may be associated with tumourigenesis, and can have an effect on some aspects of tumour behavior, including tumour recurrence or resistance to therapies.
Octamer-Binding Transcription Factor 4 (Oct-4), also known as POU5F1 (POU Domain, Class 5, Transcription Factor 1), is a member of the POU homeodomain family of transcription factors and is involved in the maintenance and regulation of pluripotency in embryonic stem and germ cells. Anti-Oct-4 is highly useful and sensitive for seminomas, germinoma, dysgerminoma, embryonal carcinoma, and gonadoblastoma. Oct-4 may be associated with tumourigenesis, and can have an effect on some aspects of tumour behavior, including tumour recurrence or resistance to therapies.
Octamer-Binding Transcription Factor 4 (Oct-4), also known as POU5F1 (POU Domain, Class 5, Transcription Factor 1), is a member of the POU homeodomain family of transcription factors and is involved in the maintenance and regulation of pluripotency in embryonic stem and germ cells. Anti-Oct-4 is highly useful and sensitive for seminomas, germinoma, dysgerminoma, embryonal carcinoma, and gonadoblastoma. Oct-4 may be associated with tumourigenesis, and can have an effect on some aspects of tumour behavior, including tumour recurrence or resistance to therapies.
Oleosins may have a structural role to stabilize the lipid body during desiccation of the seed by preventing coalescence of the oil. Probably interacts with both lipid and phospholipid moieties of lipid bodies. May also provide recognition signals for specific lipase anchorage in lipolysis during seedling growth. Oleosins also increase the viability of over-wintering oilseeds by preventing abnormal fusion of oil bodies during imbibition in the spring. Cellular localisation: surface of oil bodies.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid at 2 mg/ml.
Storage Temp:
Store at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica oleracea, Raphanus sativusSpecies of your interest not listed? Contact us
Total IgG. Protein A purified in PBS, 50% glycerol. Filter sterilized.
Molecular Weight:
18,5 | 17 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Shimada et al. (2010). A rapid and non-destructive screenable marker, FAST, for identifying transformed seeds of Arabidopsis thaliana. (Immunolocalisation)Shimada et al. (2008). A novel role for oleosins in freezing tolerance of oilseeds in Arabidopsis thaliana. Plant J. 2008 Sep;55(5):798-809. doi: 10.1111/j.1365-313X.2008.03553.x. (Western blot)
Oleosins may have a structural role to stabilize the lipid body during desiccation of the seed by preventing coalescence of the oil. Probably interacts with both lipid and phospholipid moieties of lipid bodies. May also provide recognition signals for specific lipase anchorage in lipolysis during seedling growth. Oleosins also increase the viability of over-wintering oilseeds by preventing abnormal fusion of oil bodies during imbibition in the spring. Cellular localisation: surface of oil bodies.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid at 2 mg/ml.
Storage Temp:
Store at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Camelina sativa, Capsella rubella, utrema salsugineum. Raphanus sativus Species of your interest not listed? Contact us
Total IgG. Protein A purified in PBS, 50% glycerol. Filter sterilized.
Molecular Weight:
21 | 19 kDa
Not reactive in:
Glycine max
Selected references:
Shimada et al. (2008). A novel role for oleosins in freezing tolerance of oilseeds in Arabidopsis thaliana. Plant J. 2008 Sep;55(5):798-809. doi: 10.1111/j.1365-313X.2008.03553.x.
OLE9 | Major pollen allergen Ole e 9 is an enzyme (EC 3.2.1.39), which is catalyzing Hydrolysis of (1->3)-beta-D-glucosidic linkages in (1->3)-beta-D-glucans.Alternative names: Glucan endo-1,3-beta-D-glucosidase (Major pollen allergen Ole e 9) (allergen Ole e 9), OLE9
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at -20 °C or -80 C, avoid repeated freeze-thaw cycles. Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
The oligomeric form of Amyloid Beta peptide (A?, 1-42) has been closely linked to Alzheimer's Disease. Several ELISAs targeting A? have been developed; however, these ELISAs are known to cross-react with Amyloid Beta precursor protein (APP) and are poorly characterized against monomeric and oligomeric forms of the peptide. The Biosensis MOAB-2 antibody, developed by LaDu and co-workers (Youmans K. et al. , 2012) , has been shown to specifically detect A?, but not the precursor molecule APP. When utilized in ELISAs, the oligomeric form of A? peptide (o-A?) can be assayed independently of the other forms of the molecule when assayed with the MOAB-2 monoclonal antibody. The Biosensis oligomeric A? ELISA kit is a sandwich ELISA that allows the preferential quantification of oligomeric A? peptides. This kit is exclusive to Biosensis and consists of a pre-coated mouse monoclonal anti-A? capture antibody (MOAB-2), a biotinylated MOAB-2 detection antibody and horseradish peroxidase (HRP)-conjugated streptavidin. The addition of a substrate (3,3',5,5'-tetramethylbenzidine, TMB) yields a colored reaction product which is directly proportional to the concentration of o-A? present in samples and protein standards. The purpose of this kit is the in vitro qualitative measurement of oligomeric A? peptide levels in brain extracts and CSF samples from both transgenic mice and humans relative to a known o-A? standard. The inclusion of a highly validated oligomeric standard results in a unique, ready-to-use ELISA kit. This kit has been configured for research use only and is not to be used in diagnostic or clinical procedures.
Product Type:
ELISA Assay
Species Reactivity:
Human,Rat
Immunogen:
The standard in this ELISA is synthetically manufactured beta-amyloid peptide, amino acids 1-42 of human, HFIP treated and dried.The stabilized oligomeric beta amyloid 1-42 control complex is also constructed from the same synthetic peptide standard material. No animal systems were used for their manufacture.
Applications:
ELISA
Application Details:
ELISA. For the quantification of Oligomeric Amyloid-beta in CSF, Tissue Homogenates. Please download the detailed product insert for complete instructions for the successful use of this ELISA. Use only as directed.
The ELISA kit box contains 96-well pre-coated strip plate(s), protein standards, QC sample, detection reagents, wash and sample buffers, substrate buffer and detailed protocols.
Product references:
Kasus-Jacobi A et al. (2022) "Selecting Multitarget Peptides for Alzheimers Disease" Biomolecules. 12, 1386 Application: Human, A?142 oligomers. Eid A et al. (2022) "Effects of DDT on Amyloid Precursor Protein Levels and Amyloid Beta Pathology: Mechanistic Links to Alzheimer's Disease Risk" Environ Health Perspect. [Epub ahead of print] Application: Mouse, brain tissue homogenate. Kasus-Jacobi A et al. (2021) "Neutrophil Granule Proteins Inhibit Amyloid Beta Aggregation and Neurotoxicity." Curr Alzheimer Res. 18(5):414-427 Application: Mouse in-vitro assay, cell culture supernatant. Hark TJ et al. (2020) "Pulse-Chase Proteomics of the App Knockin Mouse Models of Alzheimer s Disease Reveals that Synaptic Dysfunction Originates in Presynaptic Terminals." Cell Syst. [Epub ahead of print] Application: Mouse cortical homogenates. Xiao L et al. (2020) "Enzyme-digested Colla Corii Asini (E'jiao) prevents hydrogen peroxide-induced cell death and accelerates amyloid beta clearance in neuronal-like PC12 cells." Neural Regen Res. 15(12): 2270-2 Application: Rat PC12 RIPA cell extract. Hrynchak MV et al. (2020) "Chronic Presence of Oligomeric A? Differentially Modulates Spine Parameters in the Hippocampus and Cortex of Mice With Low APP Transgene Expression." Front Synaptic Neurosci. Apr 24;12:16 Application: Mouse lysate. El-Sayed NA et al. (2019) "Design, synthesis, in vitro and in vivo evaluation of novel pyrrolizine-based compounds with potential activity as cholinesterase inhibitors and anti-Alzheimer's agents." Bioorg Chem. [Epub ahead of print] Application: Human. In-vitro screening of drug candidates. Oh Joo Kweon, Young Chul Youn, Yong Kwan Lim, Mi-Kyung Lee, Hye Ryoun Kim (2019) "Clinical utility of serum hepcidin and iron profile measurements in Alzheimer's disease." J Neurol Sci. [In press] Application: Human serum. Pacheco-Quinto J, Clausen D, Perez-Gonzalez R, Peng H, Meszaros A, Eckman CB, Levy E, Eckman EA (2018) "Intracellular metalloprotease activity controls intraneuronal A? aggregation and limits secretion of A? via exosomes." FASEB J. [Epub ahead of print] Application: Human cell line, mouse brain and organotypic brain slice cultures. Oh SB, Kim MS, Park S, Son H, Kim SY, Kim MS, Jo DG, Tak E, Lee JY (2018) "Clusterin contributes to early stage of Alzheimer's disease pathogenesis." Brain Pathol. [Epub ahead of print] Application: Transgenic mouse brain homogenates. S Liu, S Park, G Allington, F Prelli, Y Sun, M Marta-Ariza, H Scholtzova, G Biswas, B Brown, PB Verghese, PD Mehta, Y-U Kwon and T Wisniewski (2017) "Targeting Apolipoprotein E/Amyloid _ Binding by Peptoid CPO_A?17-21 P Ameliorates Alzheimer's Disease Related Pathology and Cognitive Decline." Sci Rep. 7(1):8009 Application: Transgenic mouse brain homogenates. M Cacciottolo, X Wang, I Driscoll, N Woodward, A Saffari, J Reyes, M L Serre, W Vizuete, C Sioutas, T E Morgan, M Gatz, H C Chui, S A Shumaker, S M Resnick, M A Espeland, C E Finch and J C Chen (2017) "Particulate air pollutants, APOE alleles and their contributions to cognitive impairment in older women and to amyloidogenesis in experimental models." Transl Psychiatry. Jan 31;7(1):e1022. Application: Extracts of E3FAD and E4FAD transgenic mouse brains. Riya Thomas, Paulina Zuchowska, Alan W. J. Morris, Felecia M. Marottoli, Sangeeta Sunny, Ryan Deaton, Peter H. Gann, Leon M. Tai (2016) "Epidermal growth factor prevents APOE4 and amyloid-beta-induced cognitive and cerebrovascular deficits in female mice." Acta Neuropathol Commun. 4(1):111 Application: Tris-extracts of EFAD transgenic mouse brains. Nor Faeizah Ibrahim, Daijiro Yanagisawa, Lina Wati Durani, Hamizah Shahirah Hamezah, Hanafi Ahmad Damanhuri, Wan Zurinah Wan Ngah, Mayumi Tsuji, Yuji Kiuchi, Kenjiro Ono, Ikuo Tooyama (2016) "Tocotrienol-Rich Fraction Modulates Amyloid Pathology and Improves Cognitive Function in A?PP/PS1 Mice." J Alzheimers Dis. [Epub ahead of print]. Application: Tris-extracts of mouse brain homogenates. Jia Luo, Sue H. Lee, Lawren VandeVrede, Zhihui Qin, Manel Ben Aissa, John Larson, Andrew F. Teich, Ottavio Arancio, Yohan D'Souza, Ahmed Elharram, Kevin Koster, Leon M. Tai, Mary Jo LaDu, Brian M. Bennett and Gregory R. J. Thatcher (2016) "A multifunctional therapeutic approach to disease modification in multiple familial mouse models and a novel sporadic model of Alzheimer's disease." Molecular Neurodegeneration 2016 11:35. Application: Tris-extracts of EFAD transgenic mouse brains. Weiguo Peng, Thiyagarajan M. Achariyar, Baoman Li, Yonghong Liao, Humberto Mestre, Emi Hitomi, Sean Regan, Tristan Kasper, Sisi Peng, Fengfei Ding, Helene Benveniste, Maiken Nedergaard, Rashid Dean (2016) "Suppression of glymphatic fluid transport in a mouse model of Alzheimer's disease." Neurobiology of Disease. Vol. 93, Pages 215-225 Application: TBSX-extracts of mouse cerebral cortex. Mafalda Cacciottolo, Amy Christensen, Alexandra Moser, Jiahui Liu, Christian J. Pike, Conor Smith, Mary Jo LaDu, Patrick M. Sullivan, Todd E. Morgan, Egor Dolzhenko, Andreas Charidimou, Lars-Olof Wahlund, Maria Kristofferson Wiberg, Sara Shams, Gloria Chia-Yi Chiang (2016) "The APOE4 allele shows opposite sex bias in microbleeds and Alzheimer's disease of humans and mice." Neurobiology of Aging. Volume 37, January 2016, Pages 47-57 Application: Tris-extracts of E3FAD and E4FAD transgenic mouse brains. Combes M, Poindron P, Callizot N.(2015) "Glutamate protects neuromuscular junctions from deleterious effects of ?-amyloid peptide and conversely: An in vitro study in a nerve-muscle coculture." J Neurosci. Res. 93(4):633-43 Application: Native Rat neurites & human muscle cell co-culture supernatants. Seo, Dong Han, et al. (2015) "Plasma-enabled sustainable elemental lifecycles: honeycomb-derived graphenes for next-generation biosensors and supercapacitors." Green Chem. 17:2164-2171. Application: Synthetic constructs. Tai, LM (2014) "Amyloid-_ Pathology and APOE Genotype Modulate Retinoid X Receptor Agonist Activity in vivo." J Biol Chem. 289(44):30538-55 Application: EFAD-Tg mice. Liu Y, Liu X, Hao W, Decker Y, Schomburg R, Fulop L, Pasparakis M, Menger MD, Fassbender K. (2014) "IKKbeta Deficiency in Myeloid Cells Ameliorates Alzheimer's Disease-Related Symptoms and Pathology." (2014) J Neurosci. Sep 24;34(39):12982-99 Application: Transgenic Mouse brain lysates, supernatants.
Specificity:
Human. MOAB-2 (mouse IgG2b) is a pan-specific, high-titer antibody to A? residues 1-4 and is highly specific just to amyloid beta peptide.The Biosensis o-A? Elisa detects A? oligomers as validated and described by Youmans KL et al (2012) and Rat by Combes M et al (2015). Rat.
The oligomeric form of Amyloid Beta peptide (A?, 1-42) has been closely linked to Alzheimer's Disease. Several ELISAs targeting A? have been developed; however, these ELISAs are known to cross-react with Amyloid Beta precursor protein (APP) and are poorly characterized against monomeric and oligomeric forms of the peptide. The Biosensis MOAB-2 antibody, developed by LaDu and co-workers (Youmans K. et al. , 2012) , has been shown to specifically detect A?, but not the precursor molecule APP. When utilized in ELISAs, the oligomeric form of A? peptide (o-A?) can be assayed independently of the other forms of the molecule when assayed with the MOAB-2 monoclonal antibody. The Biosensis oligomeric A? ELISA kit is a sandwich ELISA that allows the preferential quantification of oligomeric A? peptides. This kit is exclusive to Biosensis and consists of a pre-coated mouse monoclonal anti-A? capture antibody (MOAB-2), a biotinylated MOAB-2 detection antibody and horseradish peroxidase (HRP)-conjugated streptavidin. The addition of a substrate (3,3',5,5'-tetramethylbenzidine, TMB) yields a colored reaction product which is directly proportional to the concentration of o-A? present in samples and protein standards. The purpose of this kit is the in vitro qualitative measurement of oligomeric A? peptide levels in brain extracts and CSF samples from both transgenic mice and humans relative to a known o-A? standard. The inclusion of a highly validated oligomeric standard results in a unique, ready-to-use ELISA kit. This kit has been configured for research use only and is not to be used in diagnostic or clinical procedures.
Product Type:
ELISA Assay
Species Reactivity:
Human,Rat
Immunogen:
The standard in this ELISA is synthetically manufactured beta-amyloid peptide, amino acids 1-42 of human, HFIP treated and dried.The stabilized oligomeric beta amyloid 1-42 control complex is also constructed from the same synthetic peptide standard material. No animal systems were used for their manufacture.
Applications:
ELISA
Application Details:
ELISA. For the quantification of Oligomeric Amyloid-beta in CSF, Tissue Homogenates. Please download the detailed product insert for complete instructions for the successful use of this ELISA. Use only as directed.
The ELISA kit box contains 96-well pre-coated strip plate(s), protein standards, QC sample, detection reagents, wash and sample buffers, substrate buffer and detailed protocols.
Product references:
Kasus-Jacobi A et al. (2022) "Selecting Multitarget Peptides for Alzheimers Disease" Biomolecules. 12, 1386 Application: Human, A?142 oligomers. Eid A et al. (2022) "Effects of DDT on Amyloid Precursor Protein Levels and Amyloid Beta Pathology: Mechanistic Links to Alzheimer's Disease Risk" Environ Health Perspect. [Epub ahead of print] Application: Mouse, brain tissue homogenate. Kasus-Jacobi A et al. (2021) "Neutrophil Granule Proteins Inhibit Amyloid Beta Aggregation and Neurotoxicity." Curr Alzheimer Res. 18(5):414-427 Application: Mouse in-vitro assay, cell culture supernatant. Hark TJ et al. (2020) "Pulse-Chase Proteomics of the App Knockin Mouse Models of Alzheimer s Disease Reveals that Synaptic Dysfunction Originates in Presynaptic Terminals." Cell Syst. [Epub ahead of print] Application: Mouse cortical homogenates. Xiao L et al. (2020) "Enzyme-digested Colla Corii Asini (E'jiao) prevents hydrogen peroxide-induced cell death and accelerates amyloid beta clearance in neuronal-like PC12 cells." Neural Regen Res. 15(12): 2270-2 Application: Rat PC12 RIPA cell extract. Hrynchak MV et al. (2020) "Chronic Presence of Oligomeric A? Differentially Modulates Spine Parameters in the Hippocampus and Cortex of Mice With Low APP Transgene Expression." Front Synaptic Neurosci. Apr 24;12:16 Application: Mouse lysate. El-Sayed NA et al. (2019) "Design, synthesis, in vitro and in vivo evaluation of novel pyrrolizine-based compounds with potential activity as cholinesterase inhibitors and anti-Alzheimer's agents." Bioorg Chem. [Epub ahead of print] Application: Human. In-vitro screening of drug candidates. Oh Joo Kweon, Young Chul Youn, Yong Kwan Lim, Mi-Kyung Lee, Hye Ryoun Kim (2019) "Clinical utility of serum hepcidin and iron profile measurements in Alzheimer's disease." J Neurol Sci. [In press] Application: Human serum. Pacheco-Quinto J, Clausen D, Perez-Gonzalez R, Peng H, Meszaros A, Eckman CB, Levy E, Eckman EA (2018) "Intracellular metalloprotease activity controls intraneuronal A? aggregation and limits secretion of A? via exosomes." FASEB J. [Epub ahead of print] Application: Human cell line, mouse brain and organotypic brain slice cultures. Oh SB, Kim MS, Park S, Son H, Kim SY, Kim MS, Jo DG, Tak E, Lee JY (2018) "Clusterin contributes to early stage of Alzheimer's disease pathogenesis." Brain Pathol. [Epub ahead of print] Application: Transgenic mouse brain homogenates. S Liu, S Park, G Allington, F Prelli, Y Sun, M Marta-Ariza, H Scholtzova, G Biswas, B Brown, PB Verghese, PD Mehta, Y-U Kwon and T Wisniewski (2017) "Targeting Apolipoprotein E/Amyloid _ Binding by Peptoid CPO_A?17-21 P Ameliorates Alzheimer's Disease Related Pathology and Cognitive Decline." Sci Rep. 7(1):8009 Application: Transgenic mouse brain homogenates. M Cacciottolo, X Wang, I Driscoll, N Woodward, A Saffari, J Reyes, M L Serre, W Vizuete, C Sioutas, T E Morgan, M Gatz, H C Chui, S A Shumaker, S M Resnick, M A Espeland, C E Finch and J C Chen (2017) "Particulate air pollutants, APOE alleles and their contributions to cognitive impairment in older women and to amyloidogenesis in experimental models." Transl Psychiatry. Jan 31;7(1):e1022. Application: Extracts of E3FAD and E4FAD transgenic mouse brains. Riya Thomas, Paulina Zuchowska, Alan W. J. Morris, Felecia M. Marottoli, Sangeeta Sunny, Ryan Deaton, Peter H. Gann, Leon M. Tai (2016) "Epidermal growth factor prevents APOE4 and amyloid-beta-induced cognitive and cerebrovascular deficits in female mice." Acta Neuropathol Commun. 4(1):111 Application: Tris-extracts of EFAD transgenic mouse brains. Nor Faeizah Ibrahim, Daijiro Yanagisawa, Lina Wati Durani, Hamizah Shahirah Hamezah, Hanafi Ahmad Damanhuri, Wan Zurinah Wan Ngah, Mayumi Tsuji, Yuji Kiuchi, Kenjiro Ono, Ikuo Tooyama (2016) "Tocotrienol-Rich Fraction Modulates Amyloid Pathology and Improves Cognitive Function in A?PP/PS1 Mice." J Alzheimers Dis. [Epub ahead of print]. Application: Tris-extracts of mouse brain homogenates. Jia Luo, Sue H. Lee, Lawren VandeVrede, Zhihui Qin, Manel Ben Aissa, John Larson, Andrew F. Teich, Ottavio Arancio, Yohan D'Souza, Ahmed Elharram, Kevin Koster, Leon M. Tai, Mary Jo LaDu, Brian M. Bennett and Gregory R. J. Thatcher (2016) "A multifunctional therapeutic approach to disease modification in multiple familial mouse models and a novel sporadic model of Alzheimer's disease." Molecular Neurodegeneration 2016 11:35. Application: Tris-extracts of EFAD transgenic mouse brains. Weiguo Peng, Thiyagarajan M. Achariyar, Baoman Li, Yonghong Liao, Humberto Mestre, Emi Hitomi, Sean Regan, Tristan Kasper, Sisi Peng, Fengfei Ding, Helene Benveniste, Maiken Nedergaard, Rashid Dean (2016) "Suppression of glymphatic fluid transport in a mouse model of Alzheimer's disease." Neurobiology of Disease. Vol. 93, Pages 215-225 Application: TBSX-extracts of mouse cerebral cortex. Mafalda Cacciottolo, Amy Christensen, Alexandra Moser, Jiahui Liu, Christian J. Pike, Conor Smith, Mary Jo LaDu, Patrick M. Sullivan, Todd E. Morgan, Egor Dolzhenko, Andreas Charidimou, Lars-Olof Wahlund, Maria Kristofferson Wiberg, Sara Shams, Gloria Chia-Yi Chiang (2016) "The APOE4 allele shows opposite sex bias in microbleeds and Alzheimer's disease of humans and mice." Neurobiology of Aging. Volume 37, January 2016, Pages 47-57 Application: Tris-extracts of E3FAD and E4FAD transgenic mouse brains. Combes M, Poindron P, Callizot N.(2015) "Glutamate protects neuromuscular junctions from deleterious effects of ?-amyloid peptide and conversely: An in vitro study in a nerve-muscle coculture." J Neurosci. Res. 93(4):633-43 Application: Native Rat neurites & human muscle cell co-culture supernatants. Seo, Dong Han, et al. (2015) "Plasma-enabled sustainable elemental lifecycles: honeycomb-derived graphenes for next-generation biosensors and supercapacitors." Green Chem. 17:2164-2171. Application: Synthetic constructs. Tai, LM (2014) "Amyloid-_ Pathology and APOE Genotype Modulate Retinoid X Receptor Agonist Activity in vivo." J Biol Chem. 289(44):30538-55 Application: EFAD-Tg mice. Liu Y, Liu X, Hao W, Decker Y, Schomburg R, Fulop L, Pasparakis M, Menger MD, Fassbender K. (2014) "IKKbeta Deficiency in Myeloid Cells Ameliorates Alzheimer's Disease-Related Symptoms and Pathology." (2014) J Neurosci. Sep 24;34(39):12982-99 Application: Transgenic Mouse brain lysates, supernatants.
Specificity:
Human. MOAB-2 (mouse IgG2b) is a pan-specific, high-titer antibody to A? residues 1-4 and is highly specific just to amyloid beta peptide. The Biosensis o-A? Elisa detects A? oligomers as validated and described by Youmans KL et al (2012) and Rat by Combes M et al (2015). Rat.
Omega-gliadin is wheat allergen. It is a water-insoluble component of gluten. Omega-gliadin is one of the three main types of gliadin to which body in intolerant in celiac disease.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at -20 °C or -80 C, avoid repeated freeze-thaw cycles. Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Triticum monococcum
Expected Species:
Aegilops tauschiiSpecies of your interest not listed? Contact us
The Mu Opioid Receptor antiserum was quality control tested using standard immunohistochemical methods. The antiserum demonstrates strongly positive labeling of rat caudate putamen and spinal cord (dorsal horn) using indirect immunofluorescent and biotin/avidin-HRP techniques. Recommended primary dilutions are 1/500 - 1/1000 in PBS/0.3% Triton X-100 - Cy3 Technique and 1/6000 - 1/10000 in PBS/0.3% Triton X-100 - Biotin/avidin-HRP Technique. Preadsorption with MOR peptide (384-398) at 10 µg/ml completely eliminates labeling. The specificity of the antiserum was determined by immunolabeling of transfected cells, Western Blot analysis and immunoisolation studies.
Pre-adsorption of Mu Opioid Receptor antiserum, diluted according to the antibody specification sheet, with 10 µg/ml Mu Opioid Receptor peptide immunogen following the instructions below provides complete blockage of Mu Opioid Receptor immunolabeling.
Chicken anti-Orexin A Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
FUNCTION: Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested. Orexin-A binds to both OX1R and OX2R with a high affinity, whereas orexin-B binds only to OX2R with a similar high affinity. SUBCELLULAR LOCATION: Endoplasmic reticulum; rough endoplasmic reticulum. Associated with perikaryal rough endoplasmic reticulum as well as cytoplasmic large granular vesicles at synapses. SIMILARITY: Belongs to the orexin family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A peptide from the N-terminus of human Orexin A (1-13 aa) .
Applications:
ELISA
Antibody Isotype:
IgY
Application Details:
ELISA . Suggested dilution at 1:2,000 to 1:5,000 as a detection antibody and 1:200 to 1:1,000 as a coating antibody in sandwich ELISA. Biosensis recommends that the optimal working dilution should be determined by the end user.
Rabbit anti-Orexin-A Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
FUNCTION: Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested. Orexin-A binds to both OX1R and OX2R with a high affinity, whereas orexin-B binds only to OX2R with a similar high affinity. SUBCELLULAR LOCATION: Endoplasmic reticulum; rough endoplasmic reticulum. Associated with perikaryal rough endoplasmic reticulum as well as cytoplasmic large granular vesicles at synapses. SIMILARITY: Belongs to the orexin family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Bovine,Rat
Immunogen:
A synthetic peptide (CRLYELLHGAGNHAAGILTL) as part of Bovine Orexin A (aa: 14-33) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. This is a superb antiserum for immunohistochemistry on Orexin A containing neurons exhibiting intense labelling of neurons with very low back ground. A dilution of 1:1000 to 1:2000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Orexin-A; Hypocretin-1; Hcrt1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Kruger J.L. et al (2010) Cellular location and major terminal networks of the orexinergic system in the brains of five microchiropteran species. J Chem Neuroanat. 2010 Nov;40(3):256-62. Gaykema R.P. et al (2009) Lipopolysaccharide challenge-induced suppression of Fos in hypothalamic orexin neurons: their potential role in sickness behavior. Brain Behav Immun. 2009 Oct;23(7):926-30. Lee H.S. et al (2005) Retrograde study of hypocretin-1 (orexin-A) projections to subdivisions of the dorsal raphe nucleus in the rat. Brain Res. 2005 Oct 12;1059(1):35-45. Yao S.T. et al (2005) Water deprivation increases the expression of neuronal nitric oxide synthase (nNOS) but not orexin-A in the lateral hypothalamic area of the rat. J Comp Neurol. 2005 Sep 19;490(2):180-93.
Specificity:
The specificity for this antiserum has been confirmed by immunohistochemistry on rat brain and the results reflect the current literature. This antibody is known to react with rat Orexin A.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Chicken anti-Orexin B Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
FUNCTION: Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested. Orexin-A binds to both OX1R and OX2R with a high affinity, whereas orexin-B binds only to OX2R with a similar high affinity. SUBCELLULAR LOCATION: Endoplasmic reticulum; rough endoplasmic reticulum. Associated with perikaryal rough endoplasmic reticulum as well as cytoplasmic large granular vesicles at synapses. SIMILARITY: Belongs to the orexin family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A peptide from the N-terminus of human Orexin B (1-14 aa).
Applications:
ELISA
Antibody Isotype:
IgY
Application Details:
ELISA . Suggested dilution at 1:2,000 to 1:5,000 as a detection antibody and 1:200 to 1:1,000 as a coating antibody in sandwich ELISA. Biosensis recommends that the optimal working dilution should be determined by the end user.
Osmotin protein (from thaumatin protein family), coded by a gene AP24. Known to inhibit the germination and growth of the fungus Phytophthora infestans. Protein is induced by: salt stress, ABA viral infection and wounding. Localised to vacuole.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at -20 °C or -80 C, avoid repeated freeze-thaw cycles. Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Nicotiana tabacum
Expected Species:
Capsicum annuum, Solanum lycopersicumSpecies of your interest not listed? Contact us
Immunogen:
Recombinant Osmotin derived from Nicotiana tabacum protein sequence, amino acids: 22-246. UniProt: P14170
>95%, Protein G purified to a total immunoglobulin G fraction.
Molecular Weight:
26 | 27 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Preservative: 0.03% Proclin 300. Preparation contains: 50% Glycerol, 10 mM PBS, pH 7.4Reactivity of this antibody on endogenous sample remains to be determined.
OX40 is a member of the tumor necrosis factor (TNF) receptor superfamily, which regulates T cell activity and immune response. OX40 is mainly activated by CD4 + and CD8 + T cells. It is expressed on cells, while OX40 ligands (OX40L, TNFSF4, CD252) are mainly expressed on activated antigen-presenting cells. Research shows that OX40 pathway is related to inflammation and autoimmune diseases. Other studies have shown that OX40 agonists can enhance the anti-tumor immunity of several cancer types.
OX40 is a member of the tumor necrosis factor (TNF) receptor superfamily, which regulates T cell activity and immune response. OX40 is mainly activated by CD4 + and CD8 + T cells. It is expressed on cells, while OX40 ligands (OX40L, TNFSF4, CD252) are mainly expressed on activated antigen-presenting cells. Research shows that OX40 pathway is related to inflammation and autoimmune diseases. Other studies have shown that OX40 agonists can enhance the anti-tumor immunity of several cancer types.
OX40 is a member of the tumor necrosis factor (TNF) receptor superfamily, which regulates T cell activity and immune response. OX40 is mainly activated by CD4 + and CD8 + T cells. It is expressed on cells, while OX40 ligands (OX40L, TNFSF4, CD252) are mainly expressed on activated antigen-presenting cells. Research shows that OX40 pathway is related to inflammation and autoimmune diseases. Other studies have shown that OX40 agonists can enhance the anti-tumor immunity of several cancer types.
OX40 is a member of the tumor necrosis factor (TNF) receptor superfamily, which regulates T cell activity and immune response. OX40 is mainly activated by CD4 + and CD8 + T cells. It is expressed on cells, while OX40 ligands (OX40L, TNFSF4, CD252) are mainly expressed on activated antigen-presenting cells. Research shows that OX40 pathway is related to inflammation and autoimmune diseases. Other studies have shown that OX40 agonists can enhance the anti-tumor immunity of several cancer types.
OX40 is a member of the tumor necrosis factor (TNF) receptor superfamily, which regulates T cell activity and immune response. OX40 is mainly activated by CD4 + and CD8 + T cells. It is expressed on cells, while OX40 ligands (OX40L, TNFSF4, CD252) are mainly expressed on activated antigen-presenting cells. Research shows that OX40 pathway is related to inflammation and autoimmune diseases. Other studies have shown that OX40 agonists can enhance the anti-tumor immunity of several cancer types.
OX40 is a member of the tumor necrosis factor (TNF) receptor superfamily, which regulates T cell activity and immune response. OX40 is mainly activated by CD4 + and CD8 + T cells. It is expressed on cells, while OX40 ligands (OX40L, TNFSF4, CD252) are mainly expressed on activated antigen-presenting cells. Research shows that OX40 pathway is related to inflammation and autoimmune diseases. Other studies have shown that OX40 agonists can enhance the anti-tumor immunity of several cancer types.
Oxalate oxidase (EC=1.2.3.4) belongs to the family of oxidoreductases, and acts on the aldehyde or oxo group of donor with oxygen as acceptor. Those reactions are specific forglyoxylate and dicarboxylate metabolism. Alternative names: oxygen oxidoreductase, aero-oxalo dehydrogenase, oxalic acid oxidase.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Hordeum vulgare
Expected Species:
Triticum aestivum, Oryza sativa Species of your interest not listed? Contact us
Immunogen:
native oxalate oxidase have been purified from barley seedlings
Applications:
ELISA (ELISA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western blot (WB)
Antibody potency and purity has been evaluated by immunoelectrophoresis, single radial immunodiffusion (Ouchterlony), ELISA,immunoblotting and enzyme inhibition
Application Details:
1 : 1000-1 : 4000 (ELISA), (IF), (IHC), (WB)
Purity:
Purified IgG in PBS, labelled with biotin.
Reconstitution:
For reconstitution please add 1 ml of sterile destilled water
Molecular Weight:
21 kDa
Not reactive in:
Arabidopsis thaliana
Special application note:
Biotin/IgG protein molar ratio (B/P) is approximately 6,6, No foreign proteins are added, Marker used for lebling is N-hydroxysuccinimidoBiotin
The Oxytocin antiserum was quality control tested using standard immunohistochemical methods. The antiserum demonstrates strongly positive labeling of rat hypothalamus using indirect immunofluorescent and biotin/avidin-HRP techniques. Recommended primary dilutions are 1/200 - 1/400 in PBS/0.3% Triton X-100 - FITC and 1/4,000 - 1/8,000 in PBS/0.3% Triton X-100 - Bn/Av-HRP. Staining is completely eliminated by pretreatment of 1 mL of the diluted antibody with 5 µg of Oxytocin. Pretreatment of 1 mL of the diluted antibody with as much as 100 µg of vasopressin does not diminish staining.
Guinea Pig anti-Oxytoxin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. It belongs to the vasopressin/oxytocin family. Oxytocin is secreted.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Guinea Pig
Species Reactivity:
Human,Sheep
Immunogen:
A synthetic peptide (CYIQNCPLG) corresponding to the amino acids 20-28 from human Oxytocin-neurophysin 1. This peptide was conjugated to carrier protein to enhance the immunological response.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A concentration of 1 in 2000 is recommended for IHC. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/mL of oxytocin. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
OT; OXT;OT-NPI; OT-NPI;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity was demonstrated by immunohistochemistry. This antibody is known to react with sheep. Other species have not yet been tested.
Storage:
It is recommended that a thawed sample is stored at 2-8°C for no longer than 2 weeks. Allocation of appropriate anti-bacterial agent can increase shelf life by several weeks. Diluted serum should be prepared as required. Long term stability requires storage, preferably in small aliquots at -20°C or lower. Glycerol (1:1) can be added to neat serum for additional stability if intended use does not prevent this.
p120 Catenin is a nucleolar protein belonging to the armadillo protein family, which is involved in cell-cell adhesion and signal transduction. p120 Catenin is associated with proliferation, and is found in the majority of human malignant tumours, while remaining absent from resting normal cells. Anti-p120 Catenin is useful in differentiating between ductal and lobular neoplasia in the breast, and strong staining with Anti-p120 Catenin is associated with discohesive infiltrative morphology in gastric and colonic carcinoma. Accumulation of p120 Catenin in the cytoplasm has been linked to lung cancer, pancreatic cancer, and gastric cancer, and is correlated to poor prognosis in colon cancer.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC120
Antibody Isotype:
IgG1
GMDN Code:
62843
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Lobular Breast Carcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
p120 Catenin is a nucleolar protein belonging to the armadillo protein family, which is involved in cell-cell adhesion and signal transduction. p120 Catenin is associated with proliferation, and is found in the majority of human malignant tumours, while remaining absent from resting normal cells. Anti-p120 Catenin is useful in differentiating between ductal and lobular neoplasia in the breast, and strong staining with Anti-p120 Catenin is associated with discohesive infiltrative morphology in gastric and colonic carcinoma. Accumulation of p120 Catenin in the cytoplasm has been linked to lung cancer, pancreatic cancer, and gastric cancer, and is correlated to poor prognosis in colon cancer.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC120
Antibody Isotype:
IgG1
GMDN Code:
62843
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Lobular Breast Carcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
p120 Catenin is a nucleolar protein belonging to the armadillo protein family, which is involved in cell-cell adhesion and signal transduction. p120 Catenin is associated with proliferation, and is found in the majority of human malignant tumours, while remaining absent from resting normal cells. Anti-p120 Catenin is useful in differentiating between ductal and lobular neoplasia in the breast, and strong staining with Anti-p120 Catenin is associated with discohesive infiltrative morphology in gastric and colonic carcinoma. Accumulation of p120 Catenin in the cytoplasm has been linked to lung cancer, pancreatic cancer, and gastric cancer, and is correlated to poor prognosis in colon cancer.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC120
Antibody Isotype:
IgG1
GMDN Code:
62843
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Lobular Breast Carcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
p15 [Peanut clump virus]
Immunogen:
Recombinant p15 [Peanut clump virus] Protein accession number: NP_620041.
The p16 (p16<sup>INK4A</sup>) protein is a cyclin-dependent kinase (CDK) inhibitor that plays an important regulatory role in the cell cycle. By controlling the transition between the G1 and S phases through regulation of retinoblastoma protein, p16 decelerates cellular differentiation and therefore acts as a tumor suppressor, making it the key marker in several human cancers including head and neck cancer, perianal lesions, melanomas, gliomas, lymphomas, and some types of leukemia. p16 is also clinically indicated in carcinomas of the esophagus, pancreas, lung, biliary tract, liver, colon, and urinary bladder.
The p16 (p16<sup>INK4A</sup>) protein is a cyclin-dependent kinase (CDK) inhibitor that plays an important regulatory role in the cell cycle. By controlling the transition between the G1 and S phases through regulation of retinoblastoma protein, p16 decelerates cellular differentiation and therefore acts as a tumor suppressor, making it the key marker in several human cancers including head and neck cancer, perianal lesions, melanomas, gliomas, lymphomas, and some types of leukemia. p16 is also clinically indicated in carcinomas of the esophagus, pancreas, lung, biliary tract, liver, colon, and urinary bladder.
The p16 (p16<sup>INK4A</sup>) protein is a cyclin-dependent kinase (CDK) inhibitor that plays an important regulatory role in the cell cycle. By controlling the transition between the G1 and S phases through regulation of retinoblastoma protein, p16 decelerates cellular differentiation and therefore acts as a tumor suppressor, making it the key marker in several human cancers including head and neck cancer, perianal lesions, melanomas, gliomas, lymphomas, and some types of leukemia. p16 is also clinically indicated in carcinomas of the esophagus, pancreas, lung, biliary tract, liver, colon, and urinary bladder.
The p16 (p16<sup>INK4A</sup>) protein is a cyclin-dependent kinase (CDK) inhibitor that plays an important regulatory role in the cell cycle. By controlling the transition between the G1 and S phases through regulation of retinoblastoma protein, p16 decelerates cellular differentiation and therefore acts as a tumor suppressor, making it the key marker in several human cancers including head and neck cancer, perianal lesions, melanomas, gliomas, lymphomas, and some types of leukemia. p16 is also clinically indicated in carcinomas of the esophagus, pancreas, lung, biliary tract, liver, colon, and urinary bladder.
The p16 (p16<sup>INK4A</sup>) protein is a cyclin-dependent kinase (CDK) inhibitor that plays an important regulatory role in the cell cycle. By controlling the transition between the G1 and S phases through regulation of retinoblastoma protein, p16 decelerates cellular differentiation and therefore acts as a tumor suppressor, making it the key marker in several human cancers including head and neck cancer, perianal lesions, melanomas, gliomas, lymphomas, and some types of leukemia. p16 is also clinically indicated in carcinomas of the esophagus, pancreas, lung, biliary tract, liver, colon, and urinary bladder.
The p16 (p16<sup>INK4A</sup>) protein is a cyclin-dependent kinase (CDK) inhibitor that plays an important regulatory role in the cell cycle. By controlling the transition between the G1 and S phases through regulation of retinoblastoma protein, p16 decelerates cellular differentiation and therefore acts as a tumor suppressor, making it the key marker in several human cancers including head and neck cancer, perianal lesions, melanomas, gliomas, lymphomas, and some types of leukemia. p16 is also clinically indicated in carcinomas of the esophagus, pancreas, lung, biliary tract, liver, colon, and urinary bladder.
p21, also known as p21^ Cip1 ^ , p21^ Waf1 ^, Cyclin-Dependent Kinase Inhibitor 1, or CDK-Interacting Protein 1, functions to regulate cell cycle progression at G1 by inhibiting the activity of Cyclin-CDK2 or -CDK4 complexes. This cyclin-dependent kinase inhibitor is expressed in all adult human tissues, and decreased expression of p21 is linked to poor prognosis in a number of carcinomas including gastric carcinoma, non-small cell lung carcinoma, and thyroid carcinoma. p21 is also associated with favourable prognosis in several tumours.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC021
Antibody Isotype:
IgG1, kappa
GMDN Code:
57493
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Tonsil
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
p21, also known as p21^ Cip1 ^ , p21^ Waf1 ^, Cyclin-Dependent Kinase Inhibitor 1, or CDK-Interacting Protein 1, functions to regulate cell cycle progression at G1 by inhibiting the activity of Cyclin-CDK2 or -CDK4 complexes. This cyclin-dependent kinase inhibitor is expressed in all adult human tissues, and decreased expression of p21 is linked to poor prognosis in a number of carcinomas including gastric carcinoma, non-small cell lung carcinoma, and thyroid carcinoma. p21 is also associated with favourable prognosis in several tumours.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC021
Antibody Isotype:
IgG1, kappa
GMDN Code:
57493
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Tonsil
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
p21, also known as p21^ Cip1 ^ , p21^ Waf1 ^, Cyclin-Dependent Kinase Inhibitor 1, or CDK-Interacting Protein 1, functions to regulate cell cycle progression at G1 by inhibiting the activity of Cyclin-CDK2 or -CDK4 complexes. This cyclin-dependent kinase inhibitor is expressed in all adult human tissues, and decreased expression of p21 is linked to poor prognosis in a number of carcinomas including gastric carcinoma, non-small cell lung carcinoma, and thyroid carcinoma. p21 is also associated with favourable prognosis in several tumours.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC021
GMDN Code:
57493
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Tonsil
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
p27, also known as p27<sup>Kip1</sup>, is a cyclin-dependent kinase inhibitor that binds to and inhibits cyclin-dependent kinases, thereby regulating progression from G1 to S phase. Decreased expression of p27 is linked to poor prognosis in renal-cell carcinoma, colon carcinoma, small breast carcinomas, non-small-cell lung carcinoma, hepatocellular carcinoma, multiple myeloma, lymph node metastases in papillary carcinoma of the thyroid, and is associated with a more aggressive phenotype of carcinoma in the cervix.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC128
GMDN Code:
57500
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Tonsil
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
p27, also known as p27<sup>Kip1</sup>, is a cyclin-dependent kinase inhibitor that binds to and inhibits cyclin-dependent kinases, thereby regulating progression from G1 to S phase. Decreased expression of p27 is linked to poor prognosis in renal-cell carcinoma, colon carcinoma, small breast carcinomas, non-small-cell lung carcinoma, hepatocellular carcinoma, multiple myeloma, lymph node metastases in papillary carcinoma of the thyroid, and is associated with a more aggressive phenotype of carcinoma in the cervix.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC128
GMDN Code:
57500
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Tonsil
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
p27, also known as p27<sup>Kip1</sup>, is a cyclin-dependent kinase inhibitor that binds to and inhibits cyclin-dependent kinases, thereby regulating progression from G1 to S phase. Decreased expression of p27 is linked to poor prognosis in renal-cell carcinoma, colon carcinoma, small breast carcinomas, non-small-cell lung carcinoma, hepatocellular carcinoma, multiple myeloma, lymph node metastases in papillary carcinoma of the thyroid, and is associated with a more aggressive phenotype of carcinoma in the cervix.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC128
GMDN Code:
57500
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Tonsil
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Anti-p40 recognizes squamous and basal cells, the shortest variant of p53, and ΔNp63 (an isoform of p63). p40 has been indicated as an alternative to p63 for the detection of Squamous Cell Carcinoma (SqCC), offering the advantage of eliminating potential misinterpretation of a positive adenocarcinoma as a SqCC.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC058
Antibody Isotype:
IgG1
GMDN Code:
64957
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Squamous Cell Carcinoma of Lung
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Anti-p40 recognizes squamous and basal cells, the shortest variant of p53, and ΔNp63 (an isoform of p63). p40 has been indicated as an alternative to p63 for the detection of Squamous Cell Carcinoma (SqCC), offering the advantage of eliminating potential misinterpretation of a positive adenocarcinoma as a SqCC.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC058
Antibody Isotype:
IgG1
GMDN Code:
64957
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Squamous Cell Carcinoma of Lung
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Anti-p40 recognizes squamous and basal cells, the shortest variant of p53, and ΔNp63 (an isoform of p63). p40 has been indicated as an alternative to p63 for the detection of Squamous Cell Carcinoma (SqCC), offering the advantage of eliminating potential misinterpretation of a positive adenocarcinoma as a SqCC.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC058
Antibody Isotype:
IgG1
GMDN Code:
64957
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Squamous Cell Carcinoma of Lung
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
p504s, also known as ?-Methylacyl Coenzyme A Racemase (AMACR), is an enzyme localized in the peroxisome and mitochondria that functions in ?-oxidation of branched chain fatty acids, as well as bile synthesis. AMACR has been clinically indicated as a tissue biomarker for prostate cancer and colorectal cancer, as well as high-grade prostatic intraepithelial neoplasia, a precursor lesion of prostate cancer. p504s overexpression has also been detected in a number of other cancers including ovarian, breast, bladder, lung, and renal cell carcinomas, lymphoma, and melanoma.
p504s, also known as ?-Methylacyl Coenzyme A Racemase (AMACR), is an enzyme localized in the peroxisome and mitochondria that functions in ?-oxidation of branched chain fatty acids, as well as bile synthesis. AMACR has been clinically indicated as a tissue biomarker for prostate cancer and colorectal cancer, as well as high-grade prostatic intraepithelial neoplasia, a precursor lesion of prostate cancer. p504s overexpression has also been detected in a number of other cancers including ovarian, breast, bladder, lung, and renal cell carcinomas, lymphoma, and melanoma.
p504s, also known as ?-Methylacyl Coenzyme A Racemase (AMACR), is an enzyme localized in the peroxisome and mitochondria that functions in ?-oxidation of branched chain fatty acids, as well as bile synthesis. AMACR has been clinically indicated as a tissue biomarker for prostate cancer and colorectal cancer, as well as high-grade prostatic intraepithelial neoplasia, a precursor lesion of prostate cancer. p504s overexpression has also been detected in a number of other cancers including ovarian, breast, bladder, lung, and renal cell carcinomas, lymphoma, and melanoma.
p53, also known as Tumour Protein 53 or TP53, is a tumour suppressor and transcription factor that functions in a number of anti-cancer activities including DNA repair, cell-cycle arrest, and apoptosis in response to DNA damage or other stressors. Mutations in p53 are linked to a number of malignant tumours, including those of the breast, ovary, bladder, colon, lung, and melanoma. Anti-p53 staining has been used to detect intratubular germ cell neoplasia, and also to distinguish between uterine serous carcinoma and endometrioid carcinoma.
p53, also known as Tumour Protein 53 or TP53, is a tumour suppressor and transcription factor that functions in a number of anti-cancer activities including DNA repair, cell-cycle arrest, and apoptosis in response to DNA damage or other stressors. Mutations in p53 are linked to a number of malignant tumours, including those of the breast, ovary, bladder, colon, lung, and melanoma. Anti-p53 staining has been used to detect intratubular germ cell neoplasia, and also to distinguish between uterine serous carcinoma and endometrioid carcinoma.
p53, also known as Tumour Protein 53 or TP53, is a tumour suppressor and transcription factor that functions in a number of anti-cancer activities including DNA repair, cell-cycle arrest, and apoptosis in response to DNA damage or other stressors. Mutations in p53 are linked to a number of malignant tumours, including those of the breast, ovary, bladder, colon, lung, and melanoma. Anti-p53 staining has been used to detect intratubular germ cell neoplasia, and also to distinguish between uterine serous carcinoma and endometrioid carcinoma.
p57<sup>Kip2</sup>, also known as p57, is a tumour suppressor protein that causes cell cycle arrest at G1 by binding to G1 cyclin-CDK complexes. The p57<sup>Kip2</sup> gene is a potential tumour suppressor target as the gene is located in a chromosomal region implicated in sporadic cancers, Wilms' tumour, and Beckwith Wiedemann syndrome. Anti-p57<sup>Kip2</sup> labels many cytotrophoblast nuclei and stromal cells in normal placenta, and is useful in differentiating between complete hydatidiform mole and partial hydatidiform mole or hydropic abortion.
p57<sup>Kip2</sup>, also known as p57, is a tumour suppressor protein that causes cell cycle arrest at G1 by binding to G1 cyclin-CDK complexes. The p57<sup>Kip2</sup> gene is a potential tumour suppressor target as the gene is located in a chromosomal region implicated in sporadic cancers, Wilms' tumour, and Beckwith Wiedemann syndrome. Anti-p57<sup>Kip2</sup> labels many cytotrophoblast nuclei and stromal cells in normal placenta, and is useful in differentiating between complete hydatidiform mole and partial hydatidiform mole or hydropic abortion.
p57<sup>Kip2</sup>, also known as p57, is a tumour suppressor protein that causes cell cycle arrest at G1 by binding to G1 cyclin-CDK complexes. The p57<sup>Kip2</sup> gene is a potential tumour suppressor target as the gene is located in a chromosomal region implicated in sporadic cancers, Wilms' tumour, and Beckwith Wiedemann syndrome. Anti-p57<sup>Kip2</sup> labels many cytotrophoblast nuclei and stromal cells in normal placenta, and is useful in differentiating between complete hydatidiform mole and partial hydatidiform mole or hydropic abortion.
p63 is a tumour suppressor protein that is very similar to p53 in structure and function, while being homologous to p73. p63 is important in development and differentiation, and has been identified as a useful marker for distinguishing between lung squamous cell carcinomas and adenocarcinomas. Anti-p63 is also used to differentiate between benign and malignant prostate and breast lesions, due to its labeling of the nuclei of myoepithelial cells in both tissue types.
p63 is a tumour suppressor protein that is very similar to p53 in structure and function, while being homologous to p73. p63 is important in development and differentiation, and has been identified as a useful marker for distinguishing between lung squamous cell carcinomas and adenocarcinomas. Anti-p63 is also used to differentiate between benign and malignant prostate and breast lesions, due to its labeling of the nuclei of myoepithelial cells in both tissue types.
p63 is a tumour suppressor protein that is very similar to p53 in structure and function, while being homologous to p73. p63 is important in development and differentiation, and has been identified as a useful marker for distinguishing between lung squamous cell carcinomas and adenocarcinomas. Anti-p63 is also used to differentiate between benign and malignant prostate and breast lesions, due to its labeling of the nuclei of myoepithelial cells in both tissue types.
PA200 (Proteasome activator PA200) is an associated component of the proteasome that specifically recognizes acetylated histones and promotes ATP- and ubiquitin-independent degradation of core histones during DNA damage response. It also recognizes and binds acetylated histones via its bromodomain-like (BRDL) region and activates the proteasome by opening the gated channel for substrate entry. Binds to the core proteasome via its C-terminus, which occupies the same binding sites as the proteasomal ATPases, opening the closed structure of the proteasome via an active gating mechanism. involved in DNA damage response: binds to acetylated histones and promotes degradation of histones. Protein levels increase upon exposure of seedlings to MG132, a specific, potent, reversible, and cell-permeable proteasome inhibitor. Alternative names: Proteasome activator subunit 4, Proteasome activating protein 200.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C (short tem, months) or at -80°C(long term, years) ; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Immunogen:
PA200 antibodies were generated against a partial fragment encompassing residues 840 –1140 Arabidopsis thaliana protein sequence UniProt:F4JC97-1, TAIR: At3g13330
Recommended protein load is 20 g/well, primary antibody dilution: 1: 1000 ON/4 C and optimisation based on obtained result regarding signal/noise ratio,
Application Details:
1 : 500 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l, of sterile water
Molecular Weight:
202,9 | ca, 200 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Book et al. (2010). Affinity purification of the Arabidopsis 26 S proteasome reveals a diverse array of plant proteolytic complexes. J Biol Chem. 2010 Aug 13;285(33):25554-69. doi: 10.1074/jbc.M110.136622.
PAB (protein in chloroplast atpase biogenesis) acts as an assembly chaperone that functions downstream of chaperonin 60 in the assembly of chloroplast ATP synthase coupling factor 1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidiopsis thaliana, Zea mays
Expected Species:
Brachypodium distachyon, Gossypium raimondii, Hordeum vulgare, Oryza sp., Saccharum hybrid cultivar R570, Setaria italica, Sorghum bicolor, Theobroma cacao, Triticum aestivum Species of your interest not listed? Contact us
PAC1 (20S Proteasome alpha subunit C1) is a component of proteasome complex which has ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The process is ATP-dependent. Alternative names: Proteasome subunit alpha type-4-A, 20S proteasome alpha subunit C-1, Proteasome 27 kDa subunit, Proteasome component 9, Proteasome subunit alpha type-3
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C (short tem, months) or at -80°C(long term, years) ; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Immunogen:
Recombinant PAC1 of Arabidopsis thaliana, UniProt: O81148-1, TAIR: At3g22110 , overexpressed in E.coli, purified from a gel piece
Recommended western blot conditions: SDS-PAGE, transfer to nitrocellulose, blocking 10% non-fat milk. Diluent for both primary and secondary antibodies PBS containing 0.2% Tween 20 and 1% BSA.For an image of western blot detection, refer to: Smalle et al. (2002).
Application Details:
1 : 3000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l, of sterile water
Molecular Weight:
27,4 | 26 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Smalle et al. (2002). Cytokinin growth responses in Arabidopsis involve the 26S proteasome subunit RPN12. Plant Cell 14, 17-32.
PAG1 (20S Proteasome alpha subunit G1) is a component of the 20S core complex of the 26S proteasome. The 26S proteasome is composed of a core protease (CP), known as the 20S proteasome, capped at one or both ends by the 19S regulatory particle (RP/PA700). The 20S proteasome core is composed of 28 subunits that are arranged in four stacked rings, resulting in a barrel-shaped structure. The two end rings are each formed by seven alpha subunits, and the two central rings are each formed by seven beta subunits. Alternative name: 20S proteasome alpha subunit G-1, DiDi 17A-2a, Proteasome component 8, Proteasome subunit alpha type-7.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C (short tem, months) or at -80°C(long term, years) ; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Immunogen:
Recombinant, full length PAG1 of Arabidopsis thaliana, UniProt: O23715-1, TAIR: At2g27020 overexpressed in E.coli, purified from a gel piece
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Book et al. (2010). Affinity purification of the Arabidopsis 26 S proteasome reveals a diverse array of plant proteolytic complexes. J Biol Chem. 2010 Aug 13;285(33):25554-69. doi: 10.1074/jbc.M110.136622.
This is a key enzyme of plant metabolism catalyzing the first reaction in the biosynthesis from L-phenylalanine of a wide variety of natural products based on the phenylpropane skeleton.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes.
Host Animal:
Rabbit
Species Reactivity:
Nicotiana benthamiana
Expected Species:
Arabidopsis thaliana, Hibiscus syriacus, Lotus corniculatus, Solanum dulcamara, Solanum lycopersicum,Vigna unguiculata, Species of your interest not listed? Contact us
Sheep anti-Pan-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Detects human alpha-, beta-, and gamma synuclein proteins. A family of homologous proteins known as alpha-, beta-, and gamma-synuclein are abundantly expressed in brain, especially in the presynaptic terminal of neurons. Although the precise function of these proteins remains unknown, alpha-synuclein has been implicated in synaptic plasticity associated with avian song learning as well as in the pathogenesis of Parkinson's disease (PD), dementia with LBs (DLB), some forms of Alzheimer's disease (AD), and multiple system atrophy (MSA).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (AKEGVVAAAEKTKQGV) as a consensus part of human alpha-, beta-, and gamma synuclein proteins conjugated to diphteria toxoid has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, WB. A concentration of 3 µg/mL is recommended for immunohistochemistry (frozen & paraffin embedded sections) and 1 µg/mL for western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Overlap specific immunohistochemical staining of alpha-, beta- and gamma synucleins This antiserum recognises human and rat alpha-, beta- and gamma synucleins.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified and dialysed against PBS. Contains 0.02% sodium azide.
FUNCTION: This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by g proteins which activate adenylyl cyclase. PTHR2 may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTHR2 presence in neurons indicates that it may function as a neurotransmitter receptor. SUBUNIT: Binds to TIPF39/TIP39. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein. TISSUE SPECIFICITY: Abundantly expressed in brain, arterial and cardiac endothelium. Found as well in sperm, in the head of the epididymis. Lower expression is found in vascular smooth muscle, exocrine pancreas, testis and placenta. SIMILARITY: Belongs to the G-protein coupled receptor 2 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Rat
Immunogen:
A synthetic peptide (RQIDSHVTLPGYVWSSSEQDC) of rat Parathyroid hormone receptor protein (aa: 481-501) conjugated to KLH has been used as the immunogen.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:500 to 1:1000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity has been shown by western blot. A band of 63 kDa corresponding to the theoretical molecular weight of Parathyroid hormone receptor is easily detectable by WB. Absorption of the antiserum with the immunising peptide abolished the binding of the antibody to the target hence detectability of the band. This antibody is known to react with rat Parathyroid hormone receptor.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Parathyroid Hormone (PTH), also known as Parathormone or Parathyrin, is a hormone secreted by the parathyroid glands that functions to increase the concentration of calcium in the blood. Anti-Parathyroid Hormone (PTH) is useful for differentiating parathyroid hyperplasia/neoplasms from thyroid and metastatic neoplasms, and is also used in the consideration of parathyroid carcinomas located primarily in the anterior mediastinum.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC645
Antibody Isotype:
IgM
GMDN Code:
63169
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Parathyroid Tissue
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Parathyroid Hormone (PTH), also known as Parathormone or Parathyrin, is a hormone secreted by the parathyroid glands that functions to increase the concentration of calcium in the blood. Anti-Parathyroid Hormone (PTH) is useful for differentiating parathyroid hyperplasia/neoplasms from thyroid and metastatic neoplasms, and is also used in the consideration of parathyroid carcinomas located primarily in the anterior mediastinum.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC645
Antibody Isotype:
IgM
GMDN Code:
63169
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Parathyroid Tissue
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Parathyroid Hormone (PTH), also known as Parathormone or Parathyrin, is a hormone secreted by the parathyroid glands that functions to increase the concentration of calcium in the blood. Anti-Parathyroid Hormone (PTH) is useful for differentiating parathyroid hyperplasia/neoplasms from thyroid and metastatic neoplasms, and is also used in the consideration of parathyroid carcinomas located primarily in the anterior mediastinum.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC645
Antibody Isotype:
IgM
GMDN Code:
63169
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Parathyroid Tissue
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
This peptide may be used to block binding activity of antibody to Parkin (# R-113-100).
Product Type:
Peptide
Format:
Lyophilized
Applications:
Block
Application Details:
Control peptide. This peptide may be used to block binding activity of antibody to Parkin (# R-113-100). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Ubiquitin E3 ligase PRKN; Parkinson juvenile disease protein 2; Parkinson disease protein 2; PARK2; PRKN
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
After reconstitution keep at -20°C. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Parkinson disease protein 2 (Parkin) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, ELISA.
Background Info:
FUNCTION: Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. These substrates include SYT11, CCNE1, GPR37, STUB1, a 22 kDa O-linked glycosylated isoform of SNCAIP and SEPT5. May play a more general role in the ubiquitin proteasomal pathway by participating in the removal and/or detoxification of abnormally folded or damaged protein. Loss of this ubiquitin ligase activity appears to be the mechanism underlying pathogenesis of PARK2. May protect neurons against alpha synuclein toxicity, proteasomal dysfunction, GPR37 accumulation, and kainate-induced excitotoxicity. May play a role in controlling neurotransmitter trafficking at the presynaptic terminal and in calcium-dependent exocytosis. Regulates cyclin E during neuronal apoptosis. May represent a tumor suppressor gene. SUBCELLULAR LOCATION: Cytoplasm. Co-localizes with STY11 in neutrites. Co-localizes with SNCAIP in brainstem Lewy bodies. TISSUE SPECIFICITY: Highly expressed in the brain including the substantia nigra. Expressed in heart, testis and skeletal muscle. Expression is down-regulated or absent in tumor biopsies, and absent in the brain of PARK2 patients. Overexpression protects dopamine neurons from kainate-mediated apoptosis.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Guinea Pig,Human,Rat
Immunogen:
A synthetic peptide (RILGEEQYNRYQQYGAEEC) as part of human Parkin conjugated to diphtheria toxoid has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, immunoblot, 1-site ELISA. A dilution of 1:500 to 1:2000 is recommended for these applications. This antiserum stains trigeminal motor neurons in rat brain stem. A 50 kDa band was identified in rat brain extract using western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Ubiquitin E3 ligase PRKN; Parkinson juvenile disease protein 2; Parkinson disease protein 2; PARK2; PRKN
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Francelin C et al (2021) BACE1 Inhibition Increases Susceptibility to Oxidative Stress by Promoting Mitochondrial Damage. Antioxidants (Basel). 10(10):1539. E. Rubio de la Torre et al (2009) Combined kinase inhibition modulates parkin inactivation. Hum Mol Genet. 2009 Mar 1;18(5):809-23. D'Agata V. et al (2009) Parkin expression profile in dopamine d3 receptor knock-out mice brains. Neurochem Res. 2009 Feb;34(2):327-32. Tamo W. et al (2007) Parkin is expressed in vascular endothelial cells. Neurosci Lett. 2007 Jun 4;419(3):199-201. Trimmer P.A. et al (2004) Parkinson's disease transgenic mitochondrial cybrids generate Lewy inclusion bodies. J Neurochem. 2004 Feb;88(4):800-12. Denison S.R. et al (2004) Alterations in the common fragile site gene Parkin in ovarian and other cancers. Oncogene. 2003 Nov 13;22(51):8370-8. Pawlyk A.C. et al (2003) Novel monoclonal antibodies demonstrate biochemical variation of brain parkin with age. J Biol Chem. 2003 Nov 28;278(48):48120-8. Horowitz J.M. et al (2001) Spatial distribution, cellular integration and stage development of Parkin protein in Xenopus brain. Brain Res Dev Brain Res. 2001 Jan 31;126(1):31-41.
Specificity:
This antiserum is known to specifically recognise Parkin shown by IHC and WB. This antibody is known to react with Parkin of guinea pig and rat.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Parkinson disease protein 2 (Parkin) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. These substrates include SYT11, CCNE1, GPR37, STUB1, a 22 kDa O-linked glycosylated isoform of SNCAIP and SEPT5. May play a more general role in the ubiquitin proteasomal pathway by participating in the removal and/or detoxification of abnormally folded or damaged protein. Loss of this ubiquitin ligase activity appears to be the mechanism underlying pathogenesis of PARK2. May protect neurons against alpha synuclein toxicity, proteasomal dysfunction, GPR37 accumulation, and kainate-induced excitotoxicity. May play a role in controlling neurotransmitter trafficking at the presynaptic terminal and in calcium-dependent exocytosis. Regulates cyclin E during neuronal apoptosis. May represent a tumor suppressor gene. SUBCELLULAR LOCATION: Cytoplasm. Co-localizes with STY11 in neutrites. Co-localizes with SNCAIP in brainstem Lewy bodies. TISSUE SPECIFICITY: Highly expressed in the brain including the substantia nigra. Expressed in heart, testis and skeletal muscle. Expression is down-regulated or absent in tumor biopsies, and absent in the brain of PARK2 patients. Overexpression protects dopamine neurons from kainate-mediated apoptosis.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (NSLIKELHHFRILGEEQ) as part of human Parkin conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1:1000 is recommended for immunohistochemistry and 1:2000 for western blot. Nice staining is achieved in neuronal and cytoplasmic granules sections treated with citrate buffer for antigen retrieval. Few inclusions are stained but these were not positively identified as Lewy bodies. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Ubiquitin E3 ligase PRKN; Parkinson juvenile disease protein 2; Parkinson disease protein 2; PARK2; PRKN
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Song Y. J. C. et al (2009). Degeneration in different parkinsonian syndromes relates to astrocyte type and astrocyte protein expression. J. Neuropathol. Exp. Neurol. Oct 2009;68(10):1073-1083 Huang Y. et al (2008). LRRK2 and parkin immunoreactivity in multiple system atrophy inclusions. Acta Neuropathol. 2008 Dec;116(6):639-46.
Specificity:
This antiserum is known to be highly specific for Parkin shown by IHC and WB. This antibody is known to react with rat and human Parkin.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Mouse anti-Parkinson disease protein 7 (PARK7) Monoclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Protein DJ-1 has many roles including protecting cells against oxidative stress and cell death (Ref: SwissProt). Mutations in the DJ-1 gene have been associated with rare forms of autosomal recessive early-onset Parkinson's disease.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Full length recombinant human DJ-1 expressed in and purified from E. coli.
Applications:
ICC,WB
Clone number:
4H4
Antibody Isotype:
IgG1, kappa
Application Details:
WB, ICC. Suggested dilution of at least 1:500 for ICC. Dilutions of 1:5,000 or lower is recommended for WB. This antibody reveals a prominent ~21 kDa band and stains mainly in cytoplasm of tissue culture cells. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Oncogene DJ1; Parkinson disease protein 7; PARK7; DJ-1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The antibody reacts with a 21 kDa band by Western blot on whole HeLa cell lysate. It has also been used successfully for immunocytochemistry. Does not react with rat and mouse DJ-1 protein on western blots.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
PARP (EC=2.4.2.30) is a protein involved in the base excision repair pathway (BER) and is catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. PARP is a marker of a single-strand breaks (SSBs), Rybaczek and Kowalewicz-Kulbat (2013).Alternative names: ADPRT 2, NAD(+) ADP-ribosyltransferase 2, Poly[ADP-ribose] synthetase 2.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
The antiserum was quality control tested using standard immunohistochemical methods. The antiserum demonstrates strongly positive labeling of rat thalamus, cortex, and hippocampus. The antiserum has been characterized as specific to parvalbumin; please see reference listed below. Recommended primary dilutions are 1/400 - 1/800 in PBS/0.3% Triton X-100 - Cy3 Technique and 1/5,000 - 1/8,000 in PBS/0.3% Triton X-100 - biotin/avidin-HRP Technique.
Chicken anti-Parvalbumin Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions. Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Full-length recombinant human protein
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgY
Application Details:
Western blotting (1:1,000-1:5,000) and Immunohistochemistry (1:1,000-1:5,000). Note that this antibody does not recognize parvalbumin in rat or mouse brain homogenates on western blots. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
PVALB; Parvalbumin;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human, reacts with Human, Rat, Mouse. Antibody is specific for parvalbumin and does not recognize closely related proteins calretinin and calbindin as determined by Western Blotting.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Mouse anti-Parvalbumin Monoclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions. Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Mouse
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Full-length recombinant human protein
Applications:
IHC-Frozen,WB
Clone number:
3C9
Antibody Isotype:
IgG1
Application Details:
Western blotting (1:1,000-1:5,000) and Immunohistochemistry (1:1,000-1:5,000). Note that this antibody does not recognize parvalbumin in rat or mouse brain homogenates on western blots. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Parvalbumin alpha
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human, Rat, Mouse. Antibody is specific for parvalbumin and does not recognize closely related proteins calretinin and calbindin as determined by Western Blotting.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Patatin is the most abundant protein in potato (Solanum tuberosum L.) tubers, about 60 % of a total protein. It serves as a storage protein. Mature tuber patatin variants are dimers of 40-42 kDa subunits without disulphide bridges.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Solanum tuberosum
Expected Species:
Solanum tuberosum
Immunogen:
KLH-conjugated synthetic peptide derived from a C-terminal part of 36 known isoforms of patatin from Solanum tuberosum including: Q3YJS9, Q3YJT0, Q42502, Q3YJT2
Applications:
Immunoprecipitation (IP), Immunolocalization (IL), Western blot (WB)
Patatin is the most abundant protein in potato (Solanum tuberosum L.) tubers, about 60 % of a total protein. It serves as a storage protein. Mature tuber patatin variants are dimers of 40-42 kDa subunits without disulphide bridges.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Solanum tuberosum
Expected Species:
Solanum tuberosum
Immunogen:
KLH-conjugated synthetic peptide derived from a C-terminal part of 36 known isoforms of patatin from Solanum tuberosum including: Q3YJS9, Q3YJT0, Q42502, Q3YJT2
Applications:
Immunoprecipitation (IP), Immunolocalization (IL), Western blot (WB)
PAX2 is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and mllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region, which encodes a DNA-binding domain, enabling PAX proteins to bind the promoters of specific genes to transcriptionally regulate their expression. PAX2 is specifically expressed in the developing central nervous system, eye, ear, and urogenital tract, and is essential for the development of these organs. In normal adult tissues PAX2 was mainly detected in the urogenital system, including kidney, ureteric epithelium, fallopian tube epithelium, ovary and uterus. In tumors, PAX2 has been detected in renal cell carcinomas, Wilms' tumors, nephrogenic adenomas and papillary serous carcinoma of the ovary. PAX2 has been used as a marker for the identification of renal cell carcinoma and ovarian carcinoma by immunohistochemistry.
Monosan Range:
MONOSAN
Clone:
EP235
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Gnarra JR, et al. Cancer Res. 1995; 55:4092-8
References 2:
Mazal PR, et al. Mod Pathol. 2005; 4:535-40
References 3:
Chivukula M, et al. Int J Gynecol Pathol. 2009; 28:570-8
PAX5 is a member of the paired box (PAX) family of transcription factors, which are key regulators in early development. The PAX5 gene encodes the B-cell lineage specific activator protein (BSAP), whose expression is limited to early stages of B-cell differentiation. Anti-PAX5 is useful in differentiating between classic Hodgkin's lymphoma versus multiple myeloma and solitary plasmacytoma, as the protein is expressed in mature and precursor B-cell non-Hodgkin's lymphomas/leukemias while being absent from the other two conditions. Diffuse large B-cell lymphomas are positive for PAX5, with the exception of those with terminal B-cell differentiation, and T-cell neoplasms do not stain with Anti-PAX5.
PAX5 is a member of the paired box (PAX) family of transcription factors, which are key regulators in early development. The PAX5 gene encodes the B-cell lineage specific activator protein (BSAP), whose expression is limited to early stages of B-cell differentiation. Anti-PAX5 is useful in differentiating between classic Hodgkin's lymphoma versus multiple myeloma and solitary plasmacytoma, as the protein is expressed in mature and precursor B-cell non-Hodgkin's lymphomas/leukemias while being absent from the other two conditions. Diffuse large B-cell lymphomas are positive for PAX5, with the exception of those with terminal B-cell differentiation, and T-cell neoplasms do not stain with Anti-PAX5.
PAX5 is a member of the paired box (PAX) family of transcription factors, which are key regulators in early development. The PAX5 gene encodes the B-cell lineage specific activator protein (BSAP), whose expression is limited to early stages of B-cell differentiation. Anti-PAX5 is useful in differentiating between classic Hodgkin's lymphoma versus multiple myeloma and solitary plasmacytoma, as the protein is expressed in mature and precursor B-cell non-Hodgkin's lymphomas/leukemias while being absent from the other two conditions. Diffuse large B-cell lymphomas are positive for PAX5, with the exception of those with terminal B-cell differentiation, and T-cell neoplasms do not stain with Anti-PAX5.
PAX-8 is a transcription factor expressed during embryonic development of Müllerian organs, kidney, and thyroid, with continued expression in some epithelial cell types of these mature tissues.1 It can be useful for marking several types of carcinoma including ovarian serous carcinoma, clear cell renal cell carcinoma, and papillary thyroid carcinoma.1-5 Additionally, PAX-8 is not found in the epithelial cells of the breast, lung, mesothelium, stomach, colon, pancreas and other sites.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN Ready To Use
Clone:
MRQ-50
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Ozcan A, et al. Mod Pathol. 2011; 24:751-64
References 2:
Laury AR, et al. Am J Surg Pathol. 2011; 35:816-26
References 3:
Nonaka, D et al. Am J Surg Pathol. 2008; 32:1566-71
PAX8 is expressed in simple ovarian inclusion cysts and non-ciliated mucosal cells of the fallopian tubes, but is absent from normal ovarian surface epithelial cells. Mutations in the PAX8 gene are linked to thyroid follicular carcinomas, atypical thyroid adenomas, and thyroid dysgenesis. Reports have associated PAX8 expression with renal carcinoma, nephroblastoma, and seminoma, and have indicated PAX8 as a useful marker for renal epithelial tumours, ovarian cancer, and for differential diagnoses in lung and neck tumours. Anti-PAX8 can be useful in determining the primary site of invasive micropapillary carcinomas of ovary from bladder, lung, and breast, when used in adjunct with a panel of organ-specific markers such as uroplakin, mammaglobin, and TTF-1.
PAX8 is expressed in simple ovarian inclusion cysts and non-ciliated mucosal cells of the fallopian tubes, but is absent from normal ovarian surface epithelial cells. Mutations in the PAX8 gene are linked to thyroid follicular carcinomas, atypical thyroid adenomas, and thyroid dysgenesis. Reports have associated PAX8 expression with renal carcinoma, nephroblastoma, and seminoma, and have indicated PAX8 as a useful marker for renal epithelial tumours, ovarian cancer, and for differential diagnoses in lung and neck tumours. Anti-PAX8 can be useful in determining the primary site of invasive micropapillary carcinomas of ovary from bladder, lung, and breast, when used in adjunct with a panel of organ-specific markers such as uroplakin, mammaglobin, and TTF-1.
PAX8 is expressed in simple ovarian inclusion cysts and non-ciliated mucosal cells of the fallopian tubes, but is absent from normal ovarian surface epithelial cells. Mutations in the PAX8 gene are linked to thyroid follicular carcinomas, atypical thyroid adenomas, and thyroid dysgenesis. Reports have associated PAX8 expression with renal carcinoma, nephroblastoma, and seminoma, and have indicated PAX8 as a useful marker for renal epithelial tumours, ovarian cancer, and for differential diagnoses in lung and neck tumours. Anti-PAX8 can be useful in determining the primary site of invasive micropapillary carcinomas of ovary from bladder, lung, and breast, when used in adjunct with a panel of organ-specific markers such as uroplakin, mammaglobin, and TTF-1.
PAX8 is expressed in simple ovarian inclusion cysts and non-ciliated mucosal cells of the fallopian tubes, but is absent from normal ovarian surface epithelial cells. Mutations in the PAX8 gene are linked to thyroid follicular carcinomas, atypical thyroid adenomas, and thyroid dysgenesis. Reports have associated PAX8 expression with renal carcinoma, nephroblastoma, and seminoma, and have indicated PAX8 as a useful marker for renal epithelial tumours, ovarian cancer, and for differential diagnoses in lung and neck tumours. Anti-PAX8 can be useful in determining the primary site of invasive micropapillary carcinomas of ovary from bladder, lung, and breast, when used in adjunct with a panel of organ-specific markers such as uroplakin, mammaglobin, and TTF-1.
PAX8 is expressed in simple ovarian inclusion cysts and non-ciliated mucosal cells of the fallopian tubes, but is absent from normal ovarian surface epithelial cells. Mutations in the PAX8 gene are linked to thyroid follicular carcinomas, atypical thyroid adenomas, and thyroid dysgenesis. Reports have associated PAX8 expression with renal carcinoma, nephroblastoma, and seminoma, and have indicated PAX8 as a useful marker for renal epithelial tumours, ovarian cancer, and for differential diagnoses in lung and neck tumours. Anti-PAX8 can be useful in determining the primary site of invasive micropapillary carcinomas of ovary from bladder, lung, and breast, when used in adjunct with a panel of organ-specific markers such as uroplakin, mammaglobin, and TTF-1.
PAX8 is expressed in simple ovarian inclusion cysts and non-ciliated mucosal cells of the fallopian tubes, but is absent from normal ovarian surface epithelial cells. Mutations in the PAX8 gene are linked to thyroid follicular carcinomas, atypical thyroid adenomas, and thyroid dysgenesis. Reports have associated PAX8 expression with renal carcinoma, nephroblastoma, and seminoma, and have indicated PAX8 as a useful marker for renal epithelial tumours, ovarian cancer, and for differential diagnoses in lung and neck tumours. Anti-PAX8 can be useful in determining the primary site of invasive micropapillary carcinomas of ovary from bladder, lung, and breast, when used in adjunct with a panel of organ-specific markers such as uroplakin, mammaglobin, and TTF-1.
PBA1 (20S proteasome beta subunit A1) is a subunit of proteasome, multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. Alternative name: Proteasome subunit beta.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C (short tem, months) or at -80°C(long term, years) ; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Boussardon, Bag, Juvany, et al. (2022) The RPN12a proteasome subunit is essential for the multiple hormonal homeostasis controlling the progression of leaf senescence. Commun Biol. 2022;5(1):1043. Published 2022 Sep 30. doi:10.1038/s42003-022-03998-2Smalle et al. (2002). Cytokinin growth responses in Arabidopsis involve the 26S proteasome subunit RPN12. Plant Cell 14, 17-32.
PBF1 (20S proteasome beta subunit F-1) is a subunit of proteasome, multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. Alternative names: Proteasome subunit beta type-1, Proteasome component 5 Proteasome subunit beta type-6, TAS-F22/FAFP98, TAS-G39.20.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C (short tem, months) or at -80°C(long term, years) ; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
PBP1 (PYK10-binding protein 1) is inhibitor-type lectin that may regulate the correct polymerization of BGLU23/PYK10 upon tissue damage. Activates BGLU21, BGLU22 and BGLU23. PBP1 is localised to cytoplasm.Alternative names: Jacalin-related lectin 30, Jasmonic acid-induced protein.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid at 2 mg/ml.
Storage Temp:
Store at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Species of your interest not listed? Contact us
Immunogen:
Conjugated peptide, derived from C-terminus of Arabidopsis thaliana PBP1, UniProt: O04314, TAIR: At3g16420
Total IgG. Protein A purified in PBS, 50% glycerol. Filter sterilized.
Molecular Weight:
32 | 35 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Nagano et al. (2005). Activation of an ER-body-localized beta-glucosidase via a cytosolic binding partner in damaged tissues of Arabidopsis thaliana. Plant Cell Physiol. 2005 Jul;46(7):1140-8. doi: 10.1093/pcp/pci126. (Immunofluorescence, Western Blot, Arabidopsis thaliana)
PBP1 (PYK10-binding protein 1) is inhibitor-type lectin that may regulate the correct polymerization of BGLU23/PYK10 upon tissue damage. Activates BGLU21, BGLU22 and BGLU23. PBP1 is localised to cytoplasm.Alternative names: Jacalin-related lectin 30, Jasmonic acid-induced protein.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid at 2 mg/ml.
Storage Temp:
Store at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica rapa, Raphanus sativusSpecies of your interest not listed? Contact us
Immunogen:
Conjugated peptide, derived from N-terminus of Arabidopsis thaliana PBP1, UniProt: O04314, TAIR: At3g16420
Total IgG. Protein A purified in PBS, 50% glycerol. Filter sterilized.
Molecular Weight:
32 | 35 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Nagano et al. (2005). Activation of an ER-body-localized beta-glucosidase via a cytosolic binding partner in damaged tissues of Arabidopsis thaliana. Plant Cell Physiol. 2005 Jul;46(7):1140-8. doi: 10.1093/pcp/pci126. (Immunofluorescence, Western blot, Arabidopsis thaliana)Matsushima et al. (2004). NAI1 gene encodes a basic-helix-loop-helix-type putative transcription factor that regulates the formation of an endoplasmic reticulum-derived structure, the ER body. Plant Cell. 2004 Jun;16(6):1536-49. doi: 10.1105/tpc.021154. (Western blot, Arabidopsis thaliana)
The PCNA [IHC711] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
The PCNA [IHC711] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
The PCNA [IHC711] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's accessibility during elongation of the leading strand. Involved in DNA repair and recombination.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at -20 °C and avoid temperature below -25°C; make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Saccharomyces cerevisiae
Expected Species:
Species of your interest not listed? Contact us
Immunogen:
Recombinant PCNA protein from Saccharomyces cerevisiae, UniProt: P15873
Applications:
Chromatin immunoprecipitation (ChIP), Inmunoprecipitation (IP), Western blot (WB)
Plastocyanin (PC) is a small Cu protein and a mobile electron carrier in the lumen of the thylkoids. PC interacts with the B/F complex and Photosystem I. Alternative name: DNA-damage-repair/toleration protein DRT112.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Catalpa bungei, Dicots, Chlamydomonas reinhardtii, Nicotiana benthamiana, Physcomitrium patens, Ricinus communis, Solanum lycopersicumSpecies of your interest not listed? Contact us
Immunogen:
Purified native plastocyanin from Spinacia oleracea UniProt: P00289
Plastocyanin runs abberant due to negative charge at 12-19 kDa on SDS-PAGE depending upon the system used. in 15 % gel the protein will run closer to its true MW than in 12 % gel. In some cases PC can be very acidic and run at twice of its MW.PC1 runs closer to 14 kDa while PC2 runs closer to 19 kDa. For good resolution adding fresh DTT to the sample buffer is recommended. PC2 is generally more abundant and it increases with Cu feeding. PC1 is expressed first after etiolated seedlings are placed in the light.
Application Details:
1 : 100 (IG), 1 : 2000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
10 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Tokarz et al. (2021). Stem Photosynthesis-A Key Element of Grass Pea (Lathyrus sativus L.) Acclimatisation to Salinity. Int J Mol Sci. 2021 Jan 12;22(2):685. doi: 10.3390/ijms22020685. PMID: 33445673; PMCID: PMC7828162.Viola et al. (2021) In vivo electron donation from plastocyanin and cytochrome c6 to PSI in Synechocystis sp. PCC6803. Biochim Biophys Acta Bioenerg. 2021 May 15;1862(9):148449. doi: 10.1016/j.bbabio.2021.148449. Epub ahead of print. PMID: 34004195.Furutani et al. (2021) The difficulty of estimating the electron transport rate at photosystem I. J Plant Res. 2021 Nov 15. doi: 10.1007/s10265-021-01357-6. Epub ahead of print. PMID: 34778922.Wang et al. (2020) Rerouting of ribosomal proteins into splicing in plant organelles. BioRxiv, DOI: 10.1101/2020.03.03.974766 .Galvis et al. (2020). H+ transport by K+ EXCHANGE ANTIPORTER3 promotes photosynthesis and growth in chloroplast ATP synthase mutants. Plant Physiol. pp.01561.2019. doi: 10.1104/pp.19.01561.
Special application note:
Cellular [compartment marker] of chloroplast thylakoid lumenThis product can be sold containing ProClin if requested.
Programmed Death 1 (PD-1) is a member of the CD28/CTLA-4 family of T-cell regulators, expressed as a co-receptor on the surface of activated T-cells, B-cells, and macrophages. New studies have suggested that the PD-1/PD-L1 signaling pathway may be linked to anti-tumour immunity, as PD-L1 has been shown to induce apoptosis of activated T-cells or inhibit activity of cytotoxic T-cells. In comparison to CD10 and Bcl-6, PD-1 is expressed by fewer B-cells and has therefore been considered a more specific and useful diagnostic marker for angioimmunoblastic T-cell lymphoma. Therapies targeted toward the PD-1 receptor have shown remarkable clinical responses in patients with various types of cancer, including non-small-cell lung cancer, melanoma, and renal-cell cancer.
Programmed Death 1 (PD-1) is a member of the CD28/CTLA-4 family of T-cell regulators, expressed as a co-receptor on the surface of activated T-cells, B-cells, and macrophages. New studies have suggested that the PD-1/PD-L1 signaling pathway may be linked to anti-tumour immunity, as PD-L1 has been shown to induce apoptosis of activated T-cells or inhibit activity of cytotoxic T-cells. In comparison to CD10 and Bcl-6, PD-1 is expressed by fewer B-cells and has therefore been considered a more specific and useful diagnostic marker for angioimmunoblastic T-cell lymphoma. Therapies targeted toward the PD-1 receptor have shown remarkable clinical responses in patients with various types of cancer, including non-small-cell lung cancer, melanoma, and renal-cell cancer.
Programmed Death 1 (PD-1) is a member of the CD28/CTLA-4 family of T-cell regulators, expressed as a co-receptor on the surface of activated T-cells, B-cells, and macrophages. New studies have suggested that the PD-1/PD-L1 signaling pathway may be linked to anti-tumour immunity, as PD-L1 has been shown to induce apoptosis of activated T-cells or inhibit activity of cytotoxic T-cells. In comparison to CD10 and Bcl-6, PD-1 is expressed by fewer B-cells and has therefore been considered a more specific and useful diagnostic marker for angioimmunoblastic T-cell lymphoma. Therapies targeted toward the PD-1 receptor have shown remarkable clinical responses in patients with various types of cancer, including non-small-cell lung cancer, melanoma, and renal-cell cancer.
Pyruvate decarboxylase (PDC) is a homotetrameric enzyme (E.C.4.1.1.1) that catalyses the decarboxylation of pyruvic acid to acetaldehyde carbon dioxide in the cytoplasm. It is also called 2-oxo-acid carboxylase, and pyruvic decarboxylase. In anaerobic conditions, this enzyme is part of the fermentation process that occurs in yeast, especially the Saccharomyces genus, to produce ethanol by fermentation. Pyruvate decarboxylase starts this process by converting pyruvate into acetaldehyde and carbon dioxide. Pyruvate decarboxylase depends on cofactors thiamine pyrophosphate (TPP) and magnesium. This enzyme should not be mistaken for the unrelated enzyme pyruvate dehydrogenase, an oxidoreductase (EC 1.2.4.1), that catalyzes the oxidative decarboxylation of pyruvate to acetyl-CoA.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
PDF1 (Plant defensin 1) provides broad-spectrum resistance to pathogens and possesses antifungal activity. Alternative names: Anther-specific protein S18 homolog,Cysteine-rich antifungal protein 1, AFP1,Low-molecular-weight cysteine-rich protein 67, Protein LCR67.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Solanim lycopersicum
Expected Species:
Arabidopsis thaliana, Brassica rapa, Camelina sativa, Eutrema salsugineum, Capsella rubella, Sorghum sp.Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from Arabidopsis thaliana PDF1.1 UniProt: P30224-1, TAIR: At1g75830The peptide sequence, it is perfectly conserved in following Arabidopsis thaliana isoforms: PDF1.2c, PDF1.2b, PDF1.2A, PDF1.3. PDF2 isoform sequence did not come in the blast.
Nikoloudakis et al. (2020). Structural Diversity and Highly Specific Host-Pathogen Transcriptional Regulation of Defensin Genes Is Revealed in Tomato. Int J Mol Sci. 2020 Dec 9;21(24):9380. doi: 10.3390/ijms21249380. PMID: 33317090; PMCID: PMC7764197.
PDK1 (3-phosphoinositide-dependent kinase 1), also known as PDPK1, is a key mediator of biological responses downstream of insulin and other tyrosine kinase receptors, regulating cell survival, cell cycle control, protein translation, and glucose metabolism. PDK1, containing a C-terminal pleckstrin homology domain, is activated in a phosphatidyl inositol 3,4,5-trisphosphate-dependent manner and phosphorylates multiple signaling molecules, including PKB/Akt, PKC, p70S6 kinase, serum and glucocorticoid-induced kinase. In T cells, nucleation of TCR-induced signaling complex for NFkappaB activation pathway is another crucial role of PDK1. Subcellular localization of PDK1 depends on conditions and has not been completely understood.
Product Type:
Antibodies Primary
Antibody Type:
polyclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on the label.
Immunogen:
Peptide corresponding to the amino acids CIQEVWRQRYQSHPDAAVQ of human PDK1
Applications:
WB
Additional Info:
The rabbit polyclonal antibody recognizes PDK1, a serine/threonine proteinkinase of 63 kDa, which is a central activator of multiple signaling pathways coupled to a large number of growth-promoting stimuli.
Programmed Death-Ligand 1 (PD-L1), CD274, or B7 Homolog 1 (B7-H1), is a transmembrane protein involved in suppressing the immune system and rendering tumour cells resistant to lysis through binding of the Programmed Death-1 (PD-1) receptor. Overexpression of PD-L1 may allow cancer cells to evade the actions of the host immune system. In renal cell carcinoma, upregulation of PD-L1 has been linked to increased tumour aggressiveness and risk of death. When considered in adjunct with CD8+ tumour-infiltrating lymphocyte density, expression levels of PD-L1 may be a useful predictor of multiple cancer types, including stage III non-small-cell lung cancer, hormone receptor negative breast cancer, and sentinel lymph node melanoma.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC411
Antibody Isotype:
IgG
GMDN Code:
62046
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Tonsil, Lung Adenocarcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Programmed Death-Ligand 1 (PD-L1), CD274, or B7 Homolog 1 (B7-H1), is a transmembrane protein involved in suppressing the immune system and rendering tumour cells resistant to lysis through binding of the Programmed Death-1 (PD-1) receptor. Overexpression of PD-L1 may allow cancer cells to evade the actions of the host immune system. In renal cell carcinoma, upregulation of PD-L1 has been linked to increased tumour aggressiveness and risk of death. When considered in adjunct with CD8+ tumour-infiltrating lymphocyte density, expression levels of PD-L1 may be a useful predictor of multiple cancer types, including stage III non-small-cell lung cancer, hormone receptor negative breast cancer, and sentinel lymph node melanoma.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC411
Antibody Isotype:
IgG
GMDN Code:
62046
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Tonsil, Lung Adenocarcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Programmed Death-Ligand 1 (PD-L1), CD274, or B7 Homolog 1 (B7-H1), is a transmembrane protein involved in suppressing the immune system and rendering tumour cells resistant to lysis through binding of the Programmed Death-1 (PD-1) receptor. Overexpression of PD-L1 may allow cancer cells to evade the actions of the host immune system. In renal cell carcinoma, upregulation of PD-L1 has been linked to increased tumour aggressiveness and risk of death. When considered in adjunct with CD8+ tumour-infiltrating lymphocyte density, expression levels of PD-L1 may be a useful predictor of multiple cancer types, including stage III non-small-cell lung cancer, hormone receptor negative breast cancer, and sentinel lymph node melanoma.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC441
Antibody Isotype:
IgG1, kappa
GMDN Code:
62046
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Tonsil, Lung Adenocarcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Programmed Death-Ligand 1 (PD-L1), CD274, or B7 Homolog 1 (B7-H1), is a transmembrane protein involved in suppressing the immune system and rendering tumour cells resistant to lysis through binding of the Programmed Death-1 (PD-1) receptor. Overexpression of PD-L1 may allow cancer cells to evade the actions of the host immune system. In renal cell carcinoma, upregulation of PD-L1 has been linked to increased tumour aggressiveness and risk of death. When considered in adjunct with CD8+ tumour-infiltrating lymphocyte density, expression levels of PD-L1 may be a useful predictor of multiple cancer types, including stage III non-small-cell lung cancer, hormone receptor negative breast cancer, and sentinel lymph node melanoma.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC441
Antibody Isotype:
IgG1, kappa
GMDN Code:
62046
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Tonsil, Lung Adenocarcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
The PD-L1-IMF [IHC461] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissue within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Applications:
IHC
Clone number:
IHC461
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Tonsil, Lung Adenocarcinoma
Buffer:
Tris Buffer, pH 7.3 - 7.7, with 1% BSA and <0.1% Sodium Azide
The PD-L1-IMF [IHC461] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissue within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Applications:
IHC
Clone number:
IHC461
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Tonsil, Lung Adenocarcinoma
Buffer:
Tris Buffer, pH 7.3 - 7.7, with 1% BSA and <0.1% Sodium Azide
The PD-L1-IMF [IHC461] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissue within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Applications:
IHC
Clone number:
IHC461
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Tonsil, Lung Adenocarcinoma
Buffer:
Tris Buffer, pH 7.3 - 7.7, with 1% BSA and <0.1% Sodium Azide
Programmed Death-Ligand 1 (PD-L1), CD274, or B7 Homolog 1 (B7-H1), is a transmembrane protein involved in suppressing the immune system and rendering tumour cells resistant to lysis through binding of the Programmed Death-1 (PD-1) receptor. Overexpression of PD-L1 may allow cancer cells to evade the actions of the host immune system. In renal cell carcinoma, upregulation of PD-L1 has been linked to increased tumour aggressiveness and risk of death. When considered in adjunct with CD8+ tumour-infiltrating lymphocyte density, expression levels of PD-L1 may be a useful predictor of multiple cancer types, including stage III non-small-cell lung cancer, hormone receptor negative breast cancer, and sentinel lymph node melanoma.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC441
Antibody Isotype:
IgG1, kappa
GMDN Code:
62046
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Tonsil, Lung Adenocarcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Programmed Death-Ligand 1 (PD-L1), CD274, or B7 Homolog 1 (B7-H1), is a transmembrane protein involved in suppressing the immune system and rendering tumour cells resistant to lysis through binding of the Programmed Death-1 (PD-1) receptor. Overexpression of PD-L1 may allow cancer cells to evade the actions of the host immune system. In renal cell carcinoma, upregulation of PD-L1 has been linked to increased tumour aggressiveness and risk of death. When considered in adjunct with CD8+ tumour-infiltrating lymphocyte density, expression levels of PD-L1 may be a useful predictor of multiple cancer types, including stage III non-small-cell lung cancer, hormone receptor negative breast cancer, and sentinel lymph node melanoma.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC411
Antibody Isotype:
IgG
GMDN Code:
62046
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Tonsil, Lung Adenocarcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
The PD-L1-TEC [IHC451] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissue within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Applications:
IHC
Clone number:
IHC451
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Tonsil, Lung Adenocarcinoma
Buffer:
Tris Buffer, pH 7.3 - 7.7, with 1% BSA and <0.1% Sodium Azide
The PD-L1-TEC [IHC451] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissue within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Applications:
IHC
Clone number:
IHC451
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Tonsil, Lung Adenocarcinoma
Buffer:
Tris Buffer, pH 7.3 - 7.7, with 1% BSA and <0.1% Sodium Azide
The PD-L1-TEC [IHC451] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissue within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Applications:
IHC
Clone number:
IHC451
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Tonsil, Lung Adenocarcinoma
Buffer:
Tris Buffer, pH 7.3 - 7.7, with 1% BSA and <0.1% Sodium Azide
PDLP1 (Plasmodesmata-located protein 1) mediates callose deposit during fungal infection and is required for systemic acquired resistance (SAR), mediated by azelaic acid (AzA), glycerol-3-phosphate (G3P), and salicylic acid (SA). Alternative names: PD-located protein 1,Cysteine-rich repeat secretory protein 56, Plasmodesmata localizing protein 1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes.
PDR8 protein is a key factor which controls the extent of cell death in defense response. Alternative names: ABC transporter ABCG.36, AtABCG36, pleiotropic drug resistance protein 8, protein PENETRATION 3
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Camelina sativa, Eutrema salsugineumSpecies of your interest not listed? Contact us
Peanut (Arachis hypogaea) belongs to the legume family. Dietary substances from peanuts can be a cause of allergi reaction in estimated 0.4-0.6% of population.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at -20 °C; make aliquots to avoid working with a stock. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
The two Arabidopsis POLLUX-like homologs PEC1 and PEC2 represent plastid envelope membrane cation channels with K + conductivity that are required for the stress triggered Ca 2+ release into the stroma.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Camelina sativa, Capsella rubella, Nicotiana benthamiana, Noccaea caerulescens, Pisum sativum, Raphanus sativus, Species of your interest not listed? Contact us
Immunogen:
The soluble domain 466 (M244 until stop codon, ≈ 64 kDa) was cloned into pET16b and transformed into BLR 21 for 467 expression in Escherichia coli UniProt: Q8VZM7-1, TAIR: At5g02940
V lkner et al (2021) Two plastid POLLUX ion channel-like proteins are required for stress-triggered stromal Ca2+release, Plant Physiology, Volume 187, Issue 4, December 2021, Pages 2110–2125, https://doi.org/10.1093/plphys/kiab424
Special application note:
This antibody is recognizing PEC1, but not PEC2 or DMI1
The plant cell wall surrounds the plant cell as a complex network of polysaccharides classed as: cellulose, hemicelluloses and pectic polysaccharides and glycoproteins. Anchored to or embedded into plant cell wall are other polymers, like: lignin, suberin or cutin. Pectins are the major polysaccharides that build pectic matrix of plant primary cell walls.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at +4°C(short term) and at -20 °C (long term). Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from any material adhering to the cap or sides of the tube.
Host Animal:
Rat
Species Reactivity:
Higher plants, ferns and mosses
Immunogen:
Pectic polysaccharide, alpha-1,5-arabinan, This antibody was isolated from a high throughput screen of many antibodies generated by immunization with a pectic fraction,
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Verhertbruggen et al. (2009). Developmental complexity of arabinan polysaccharides and their processing in plant cell walls. Plant J. 2009 Aug;59(3):413-25.doi: 0.1111/j.1365-313X.2009.03876.x. Moller et al. (2008). High-throughput screening of monoclonal antibodies against plant cell wall glycans by hierarchical clustering of their carbohydrate microarray. inding profiles Glycoconj J. 2008 Jan;25(1):37-48. doi: 10.1007/s10719-007-9059-7.
Special application note:
Contains 0.05% Sodium Azide.Antibody recognition of arabinans increases with arabinofuranosidase action. Binds to a specific subset of pectic arabinans, and to longer stretches of 1,5-linked arabinosyl residues that are likely to be more abundant in unbranched arabinans.
The plant cell wall surrounds the plant cell as a complex network of polysaccharides classed as: cellulose, hemicelluloses and pectic polysaccharides and glycoproteins. Anchored to or embedded into plant cell wall are other polymers, like: lignin, suberin or cutin. Pectins are the major polysaccharides that build pectic matrix of plant primary cell walls.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at +4°C(short term) and at -20 °C (long term). Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from any material adhering to the cap or sides of the tube.
Verhertbruggen et al. (2009). Developmental complexity of arabinan polysaccharides and their processing in plant cell walls. Plant J. 2009 Aug;59(3):413-25.doi: 0.1111/j.1365-313X.2009.03876.x.
Special application note:
Contains 0.05% Sodium AzideNo cross-reactivity with gum arabic. The antibody recognises a linear pentasaccharide in (1-5)-α-L-arabinans. I many species it can also recognise pectic polysaccharides.In some species this antibody could recognize arabinogalactan-proteins (AGPs).In competitive inhibition ELISAs, antibody is binding to: (1-5)-α-L-arabinan was inhibited (50%) by 40 ng/ml (1-5)-α-L-arabinopentaose and 19 ng/ml (1-5)-α-L-arabinohexaose.
The plant cell wall surrounds the plant cell as a complex network of polysaccharides classed as: cellulose, hemicelluloses and pectic polysaccharides and glycoproteins. Anchored to or embedded into plant cell wall are other polymers, like: lignin, suberin or cutin. Pectins are the major polysaccharides that build pectic matrix of plant primary cell walls.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at +4°C(short term) and at -20 °C (long term). Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from any material adhering to the cap or sides of the tube.
Host Animal:
Rat
Species Reactivity:
Higher plants, ferns and mosses
Immunogen:
Pectic polysaccharide (alpha-1,5-arabinan). This antibody was isolated from a high throughput screen of many antibodies generated by immunization with a pectic fraction.
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Contains 0.05% Sodium Azide.This antibody is recognizing a (1-5)-alpha-L-arabinan in a similar manner as an antibody to Pectic polysaccharide, alpha-1,5-arabinan (monoclonal, clone LM6). This antibody is an IgM isotype.
The plant cell wall surrounds the plant cell as a complex network of polysaccharides classed as: cellulose, hemicelluloses and pectic polysaccharides and glycoproteins. Anchored to or embedded into plant cell wall are other polymers, like: lignin, suberin or cutin. Homogalacturonan is a pectic polysaccharide of alpha-1,4 linked galacturonic acid residues. Pectin contains a complex set of polysaccharides that can be found in many primary cell walls.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at +4°C(short term) and at -20 °C (long term). Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from any material adhering to the cap or sides of the tube.
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Andersen et al. (2016). Characterization of the LM5 pectic galactan epitope with synthetic analogues of -1,4-d-galactotetraose. Carbohydr Res. 2016 Dec ;436:36-40.doi: 10.1016/j.carres.2016.10.012. Jones et al. (1997). Development and validation of an in vitro model system to study peripheral sensory neuron development and injury. Sci Rep. 2018 Oct 29;8(1):15961. doi: 10.1038/s41598-018-34280-3.
Special application note:
Contains 0.05% Sodium Azide.No cross-reactivity with (1-3)-beta-D-galactans or (1-6)-beta-D-galactans.It recognizes a linear tetrasaccharide in (1-4)-beta-D-galactans.In ELISA (competitive inhibition), antibody is binding to: (1-4)-beta-D-galactan was inhibited (50%) by 58 g/ml (1-4)-beta-D-galactotetraose and by 0.7 g/ml lupin (1-4)-beta-D-galactan.
The plant cell wall surrounds the plant cell as a complex network of polysaccharides classed as: cellulose, hemicelluloses and pectic polysaccharides and glycoproteins. Anchored to or embedded into plant cell wall are other polymers, like: lignin, suberin or cutin. This antibody, directed to branched galactan, is now a cell wall marker that can facilitate the study of vascular development across a range of different angiosperms.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at -20 °C. Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from any material adhering to the cap or sides of the tube.
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Torode, O Neill, Marcus et al. (2018) Branched Pectic Galactan in Phloem-Sieve-Element Cell Walls: Implications for Cell Mechanics. Plant Physiol. 2018;176(2):1547-1558. doi:10.1104/pp.17.01568
The plant cell wall surrounds the plant cell as a complex network of polysaccharides classed as: cellulose, hemicelluloses and pectic polysaccharides and glycoproteins. Anchored to or embedded into plant cell wall are other polymers, like: lignin, suberin or cutin. Homogalacturonan is a pectic polysaccharide of alpha-1,4 linked galacturonic acid residues. Pectin contains a complex set of polysaccharides that can be found in many primary cell walls.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at +4°C(short term) and at -20 °C (long term). Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from any material adhering to the cap or sides of the tube.
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Yu et al. (2023) Reduction of pectin may decrease the embryogenicity of grapevine (Vitis vinifera) pro-embryonic masses after 10 years of in vitro culture, Scientia Horticulturae,Volume 309,2023,111690,ISSN 0304-4238,https://doi.org/10.1016/j.scienta.2022.111690.
Special application note:
Contains 0.05% Sodium AzideHas no known cross-reactivity with other polymers.Binds to paritally methyl esterified homogalacturonan and can also bind to un-esterified homogalacturonan.
The plant cell wall surrounds the plant cell as a complex network of polysaccharides classed as: cellulose, hemicelluloses and pectic polysaccharides and glycoproteins. Anchored to or embedded into plant cell wall are other polymers, like: lignin, suberin or cutin. Homogalacturonan is a pectic polysaccharide of alpha-1,4 linked galacturonic acid residues. Pectin contains a complex set of polysaccharides that can be found in many primary cell walls.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at +4°C(short term) and at -20 °C (long term). Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from any material adhering to the cap or sides of the tube.
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Clausen et al. (2003). Synthetic methyl hexagalacturonate hapten inhibitors of anti-homogalacturonan monoclonal antibodies LM7, JIM5 and JIM7. Carbohydr Res. 003 Aug 12;338(17):1797-800.doi: 10.1016/s0008-6215(03)00272-6. Knox et al. (1990). Pectin esterification is spatially regulated both within cell walls and between developing tissues of root apices. Planta. 1990 Jul;181(4):512-21.doi: 0.1007/BF00193004.
Special application note:
Contains 0.05% Sodium AzideHas no known cross-reactivity with other polymers.Binds to methyl esterified homogalacturonan.Does not bind to un-esterified homogalacturonan.This antibody is a good marker for pectic homogalacturonan.
The plant cell wall surrounds the plant cell as a complex network of polysaccharides classed as: cellulose, hemicelluloses and pectic polysaccharides and glycoproteins. Anchored to or embedded into plant cell wall are other polymers, like: lignin, suberin or cutin. Homogalacturonan is a pectic polysaccharide of alpha-1,4 linked galacturonic acid residues. Pectin contains a complex set of polysaccharides that can be found in many primary cell walls.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at +4°C(short term) and at -20 °C (long term). Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from any material adhering to the cap or sides of the tube.
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Verhertbruggen et al. (2009). An extended set of monoclonal antibodies to pectic homogalacturonan. Carbohydr Res. 2009 Sep 28;344(14):1858-62.doi: 10.1016/j.carres.2008.11.010.
Special application note:
Contains 0.05% Sodium Azide.No known cross-reactivity with other polymers.Binds to partially methyl esterified homogalacturonan but can also bind to un-esterified homogalacturonan
The plant cell wall surrounds the plant cell as a complex network of polysaccharides classed as: cellulose, hemicelluloses and pectic polysaccharides and glycoproteins. Anchored to or embedded into plant cell wall are other polymers, like: lignin, suberin or cutin. Homogalacturonan is a pectic polysaccharide of alpha-1,4 linked galacturonic acid residues. Pectin contains a complex set of polysaccharides that can be found in many primary cell walls.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at +4°C(short term) and at -20 °C (long term). Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from any material adhering to the cap or sides of the tube.
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Pan, Li, Liu, Qi et al. (2023) Multi-microscopy techniques combined with FT-IR spectroscopy reveals the histological and biochemical causes leading to fruit texture difference in oriental melon (Cucumis melo var. Makuwa Makino), Food Chemistry,Volume 402, 2023,134229, ISSN 0308-8146, https://doi.org/10.1016/j.foodchem.2022.134229.(https://www.sciencedirect.com/science/article/pii/S0308814622021914)Marcus et al. (2010). Restricted access of proteins to mannan polysaccharides in intact plant cell walls. Plant J. 2010 Oct;64(2):191-203.doi: 0.1111/j.1365-313X.2010.04319.x.Verhertbruggen et al. (2009). An extended set of monoclonal antibodies to pectic homogalacturonan. Carbohydr Res. 2009 Sep 28;344(14):1858-62.doi: 10.1016/j.carres.2008.11.010.
Special application note:
Contains 0.05% Sodium Azide.Has no known cross-reactivity with other polymers.Binds to unesterified homogalacturonan.The antibody recognizes a range of homogalacturonan samples but binds strongly to un-esterified homogalacturonan.
The plant cell wall surrounds the plant cell as a complex network of polysaccharides classed as: cellulose, hemicelluloses and pectic polysaccharides and glycoproteins. Anchored to or embedded into plant cell wall are other polymers, like: lignin, suberin or cutin. Homogalacturonan is a pectic polysaccharide of alpha-1,4 linked galacturonic acid residues. Pectin contains a complex set of polysaccharides that can be found in many primary cell walls.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Cell Culture Supernatant
Storage Temp:
Store at +4°C(short term) and at -20 °C (long term). Make aliquots to avoid repeated freeze-thaw cycles. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from any material adhering to the cap or sides of the tubes.
No confirmed exceptions from predicted reactivity known at the moment.
Selected references:
Pan, Li, Liu, Qi et al. (2023) Multi-microscopy techniques combined with FT-IR spectroscopy reveals the histological and biochemical causes leading to fruit texture difference in oriental melon (Cucumis melo var. Makuwa Makino), Food Chemistry,Volume 402, 2023,134229, ISSN 0308-8146, https://doi.org/10.1016/j.foodchem.2022.134229.(https://www.sciencedirect.com/science/article/pii/S0308814622021914)Verhertbruggen et al. (2009). An extended set of monoclonal antibodies to pectic homogalacturonan. Carbohydr Res. 2009 Sep 28;344(14):1858-62.doi: 10.1016/j.carres.2008.11.010.
Special application note:
Contains 0.05% Sodium AzideHas no known cross-reactivity with other polymers.Binds to methyl esterified homogalacturonan.Does not bind to un-esterified homogalacturonanl.
The plant cell wall surrounds the plant cell as a complex network of polysaccharides classed as: cellulose, hemicelluloses and pectic polysaccharides and glycoproteins. Anchored to or embedded into plant cell wall are other polymers, like: lignin, suberin or cutin. Homogalacturonan is a pectic polysaccharide of alpha-1,4 linked galacturonic acid residues. Pectin contains a complex set of polysaccharides that can be found in many primary cell walls
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at +4°C(short term) and at -20 °C (long term). Make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from any material adhering to the cap or sides of the tube.
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Zhang et al. (2022) Mutation of CESA1 phosphorylation site influences pectin synthesis and methylesterification with a role in seed development, Journal of Plant Physiology, 2022, 153631, ISSN 0176-1617, https://doi.org/10.1016/j.jplph.2022.153631.
Special application note:
Contains 0.05% Sodium AzideThe antibody recognizes a partially methyl-estrified epitope of HG which results from non-blockwise de-estrification processes. The antibody does not bind to un-estrified homogalacuronan.
The plant cell wall surrounds the plant cell as a complex network of polysaccharides classed as: cellulose, hemicelluloses and pectic polysaccharides and glycoproteins. Anchored to or embedded into plant cell wall are other polymers, like: lignin, suberin or cutin. Pectins are the major polysaccharides that build pectic matrix of plant primary cell walls.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at +4°C(short term) and at -20 °C (long term).
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Verhertbruggen et al. (2009). Developmental complexity of arabinan polysaccharides and their processing in plant cell walls. Plant J. 2009 Aug;59(3):413-25.doi: 0.1111/j.1365-313X.2009.03876.x.
Special application note:
Contains 0.05% Sodium Azide.Reacts with polysaccharide, rhamnogalacturonan-I (RG-I) The binding could be sensitive to galactosidase action and the epitope could involve galactosyl residue(s) on the rhamnogalacturonan backbones.Recognizes a epitope associated with arabinans and can be generated by arabinofuranosidase action and the loss of arabinosyl residues.
The plant cell wall surrounds the plant cell as a complex network of polysaccharides classed as: cellulose, hemicelluloses and pectic polysaccharides and glycoproteins. Anchored to or embedded into plant cell wall are other polymers, like: lignin, suberin or cutin. Pectins are the major polysaccharides that build pectic matrix of plant primary cell walls.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at +4°C(short term) and at -20 °C (long term).
Willam et al. (2004). A xylogalacturonan epitope is specifically associated with plant cell detachment. Planta. 2004 Feb;218(4):673-81.doi: 0.1007/s00425-003-1147-8.
Special application note:
Contains 0.05% Sodium Azide.No known cross-reactivity with other polymers.Does not bind to all xylogalacturonans
PEL1 (Pelota) is required for normal chromosome segregation during cell division and genomic stability. Synonymes: Eukaryotic release factor 1 (ERF1) family protein, Putative pelota (PEL1) protein
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Oryza sativa, Ostreococcus tauri, Ricinus communis, Populus canadensis, Vitis vinifera Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from known plant Pelota sequences including Arabidopsis thaliana UniProt: Q9ZT87 TAIR: At4g27650
Protein pelota homolog is involved in the mechanism for releasing non-functional ribosomes and degrading damaged mRNA. This protein belongs to the eukaryotic release factor 1 (ERF1) family, and the Pelota subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Phosphoenolpyruvate carboxykinase (PEPCK, PEP carboxykinase) is an enzyme that catalyses the conversion of oxaloacetate and ATP to phosphoenelpyruvate, carbon dioxide and ADP. PEPCK is encoded by two genes in plants: pck1 and pck2.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Due to the MW of this protein we suggest to use a gradient gel for protein separation and a longer transfer time. Higher protein load 10-20 g is adviced when working with this antibody.Antibody can be also used following 2D gel electrophoresis.This product can be sold containing ProClin if requested.
Application Details:
1 : 1000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 200 l of sterile water
Molecular Weight:
73 | 78 kDa
Not reactive in:
Arabidopsis thaliana, Pinus yunnanensis
Selected references:
Wei et al. (2019). Transcriptomic and proteomic responses to very low CO 2 suggest multiple carbon concentrating mechanisms in Nannochloropsis oceanica. Biotechnol Biofuels 12: 168.Shen et al. (2016). The existence of C4-bundle-sheath-like photosynthesis in the mid-vein of C3 rice. Rice (N Y). 2016 Dec;9(1):20. doi: 10.1186/s12284-016-0094-5. Epub 2016 May 10.Aragón et al. (2013). The physiology of ex vitro pineapple (Ananas comosus L. Merr. var MD-2) as CAM or C3 is regulated by the environmental conditions: proteomic and transcriptomic profiles. Plant Cell Rep. Aug 20. (Ananas comosus, western blot detection following 2D gel electrophoresis)
PEPC (phosphoenolpyruvate carboxylase), EC=4.1.1.31, belongs to an enzyme family of carboxy-lyases that is catalyzing adding fo carbon dioxide to phosphoenolpyruvate (PEP) to form oxaloacetate. Alternative names: PEPCase 1, PEPCase 3, PEPC 1, PEPC 3
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube. Please do not re-use this primary antibody solution. In case of cyanobacterial samples there will be no signal in your second incubation.
KLH-conjugated synthetic peptide well conserved PEPC1 and sequences from different plant species including Arabidopsis thaliana Q9MAH0, At1g53310 (PEPC 1), Q84VW9, At3g14940 (PEPC 3). The peptide chosen to elicit this antibody is also perfectly conserved in bacterial type of this enzyme NP_177043.2 (PEPC 4). For Zea mays, the peptide is converved in PEP1 and PEP4 isoforms.
Antibody can be also used following 2D gel electrophoresis
Application Details:
1 : 500 (IL), 1: 1000 - : 10 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
110 | 105 kDa
Not reactive in:
Methanothermobacter thermautotrophicus
Selected references:
Durall et al. (2021). Production of succinate by engineered strains of Synechocystis PCC 6803 overexpressing phosphoenolpyruvate carboxylase and a glyoxylate shunt. Microb Cell Fact. 2021 Feb 8;20(1):39. doi: 10.1186/s12934-021-01529-y. PMID: 33557832; PMCID: PMC7871529.Wang et al. (2021). Brassinosteroids inhibit miRNA-mediated translational repression by decreasing AGO1 on the endoplasmic reticulum. J Integr Plant Biol. 2021 May 21. doi: 10.1111/jipb.13139. Epub ahead of print. PMID: 34020507.Rakhmankulova et al. (2021) Possible Activation of ?3 Photosynthesis in ?4 Halophyte Kochia prostrata Exposed to an Elevated Concentration of ??2. Russ J Plant Physiol 68, 1107–1114 (2021). https://doi.org/10.1134/S1021443721060169Durall et al. (2020). Increased ethylene production by overexpressing phosphoenolpyruvate carboxylase in the cyanobacterium Synechocystis PCC 6803. Biotechnol Biofuels. 2020 Jan 28;13:16. doi: 10.1186/s13068-020-1653-y. Kramer et al. (2020). N6?methyladenosine and RNA secondary structure affect transcript stability and protein abundance during systemic salt stress in Arabidopsis. Plant Direct . 2020 Jul 24;4(7):e00239.doi: 10.1002/pld3.239.
PEPC (phosphoenolpyruvate carboxylase), EC=4.1.1.31, belongs to an enzyme family of carboxy-lyases that is catalyzing adding fo carbon dioxide to phosphoenolpyruvate (PEP) to form oxaloacetate. Alternative names: PEPCase 1, PEPCase 3, PEPC 1, PEPC 3
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
KLH-conjugated synthetic peptide well conserved PEPC1 and sequences from different plant species including Arabidopsis thaliana Q9MAH0, At1g53310 (PEPC 1), Q84VW9, At3g14940 (PEPC 3). The peptide chosen to elicit this antibody is also perfectly conserved in bacterial type of this enzyme NP_177043.2 (PEPC 4)
PEPC (phosphoenolpyruvate carboxylase), EC=4.1.1.31, belongs to an enzyme family of carboxy-lyases that is catalyzing adding fo carbon dioxide to phosphoenolpyruvate (PEP) to form oxaloacetate. Alternative names: PEPCase 1, PEPCase 3, PEPC 1, PEPC 3
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
KLH-conjugated synthetic peptide well conserved PEPC1 and sequences from different plant species including Arabidopsis thaliana Q9MAH0, At1g53310 (PEPC 1), Q84VW9, At3g14940 (PEPC 3). The peptide chosen to elicit this antibody is also perfectly conserved in bacterial type of this enzyme NP_177043.2 (PEPC 4)
PEPC (phosphoenolpyruvate carboxylase), EC=4,1,1,31, belongs to an enzyme family of carboxy-lyases that is catalyzing adding fo carbon dioxide to phosphoenolpyruvate (PEP) to form oxaloacetate, Alternative names: PEPCase 1, PEPCase 3, PEPC 1, PEPC 3.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
KLH-conjugated synthetic peptide well conserved PEPC1 and sequences from different plant species including Arabidopsis thaliana Q9MAH0, At1g53310 (PEPC 1), Q84VW9, At3g14940 (PEPC 3). The peptide chosen to elicit this antibody is also perfectly conserved in bacterial type of this enzyme NP_177043.2 (PEPC 4). For Zea mays, the peptide is converved in PEP1 and PEP4 isoforms.
PEPC (phosphoenolpyruvate carboxylase), EC=4,1,1,31, belongs to an enzyme family of carboxy-lyases that is catalyzing adding fo carbon dioxide to phosphoenolpyruvate (PEP) to form oxaloacetate, Alternative names: PEPCase 1, PEPCase 3, PEPC 1, PEPC 3.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
KLH-conjugated synthetic peptide well conserved PEPC1 and sequences from different plant species including Arabidopsis thaliana Q9MAH0, At1g53310 (PEPC 1), Q84VW9, At3g14940 (PEPC 3). The peptide chosen to elicit this antibody is also perfectly conserved in bacterial type of this enzyme NP_177043.2 (PEPC 4). For Zea mays, the peptide is converved in PEP1 and PEP4 isoforms.
PEPC (phosphoenolpyruvate carboxylase), EC=4,1,1,31, belongs to an enzyme family of carboxy-lyases that is catalyzing adding fo carbon dioxide to phosphoenolpyruvate (PEP) to form oxaloacetate, Alternative names: PEPCase 1, PEPCase 3, PEPC 1, PEPC 3.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
KLH-conjugated synthetic peptide well conserved PEPC1 and sequences from different plant species including Arabidopsis thaliana Q9MAH0, At1g53310 (PEPC 1), Q84VW9, At3g14940 (PEPC 3). The peptide chosen to elicit this antibody is also perfectly conserved in bacterial type of this enzyme NP_177043.2 (PEPC 4). For Zea mays, the peptide is converved in PEP1 and PEP4 isoforms.
PEPC (phosphoenolpyruvate carboxylase), EC=4.1.1.31, belongs to an enzyme family of carboxy-lyases that is catalyzing adding fo carbon dioxide to phosphoenolpyruvate (PEP) to form oxaloacetate. Alternative names: PEPCase 1, PEPCase 3, PEPC 1, PEPC 3
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
KLH-conjugated synthetic peptide well conserved PEPC1 and sequences from different plant species including Arabidopsis thaliana Q9MAH0, At1g53310 (PEPC 1), Q84VW9, At3g14940 (PEPC 3). The peptide chosen to elicit this antibody is also perfectly conserved in bacterial type of this enzyme NP_177043.2 (PEPC 4)
Phosphoenolpyruvate carboxylase (PEPC; EC 4.1.1.31) serves as an important control element in the regulation of photosynthetic carbon metabolism in C4 and CAM plants. This is the first enzyme of the pathway, and PEPC enzymes are encoded by a small multigenic family. Several isoforms of PEPC have been characterised in maize, sorghum and sugarcane. These isoforms are involved in several functions such as the initial fixation of atmospheric CO2 (= C4 PEPC) and anaplerotic functions associated with nitrogen assimilation or amino acid biosynthesis (Lepiniec et al. 1994).
Product Type:
Antibody
Format:
Lyophilized in glycerol.
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Concentration: after re-constitution with sterile milliQ water final concentration of the standard is 0.15 pmoles/ lProtein standard buffer composition: Glycerol 10%, Tris Base 141 mM, Tris HCl 106 mM, LDS 2%, EDTA 0.51 mM, SERVA Blue G250 0.22 mM, Phenol Red 0.175 mM, pH 8.5, 0.1mg/ml PefaBloc protease inhibitor (Roche), 50 mM DTT.This standard is ready-to-load and does not require any additions or heating.This standard is stabilized and ready and does not require heating before loading on the gel. Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Application Details:
Standard curve: 3 loads are recommended (0.5, 2 and 4μl).For most applications a sample load of 0.2 μg of chlorophyll/well will give a RbcL signal in this range.Positive control: a 2 μl load per well is optimal for most chemiluminescent detection systems. Higher standard concentration needs to be used to allow detection by Coomasie stains. Such gels with higher standard concentration can not be used for quantitation using chemiluminescence.This standard is stabilized and ready and does not require heating before loading on the gel. Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Reconstitution:
For reconstitution add 60 l of steril water, Please notice that this product contains 10% glycerol and might appear as liquid but is provided lyophilized
Molecular Weight:
110 | 105 kDa
Special application note:
The PEPC protein standard can be used in a combination with Agrisera global PEPC antibiody to quantitate PEPC from a wide range of species. Global antibodies are raised against highly conserved amino acid sequence. Quantitative western blot: detailed method description, video tutorial
Chicken anti-Peptide YY (PYY) Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
Peptide YY (PYY) is secreted from endocrine cells in the lower small intestine, colon and pancreas. PYY inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility (Ref: SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A peptide from the C-terminus of human mature Peptide YY (24-36 aa) .
Applications:
ELISA
Antibody Isotype:
IgY
Application Details:
ELISA . Suggested dilution at 1:2,000 to 1:10,000 (detection antibody). Biosensis recommends that the optimal working dilution should be determined by the end user.
Chicken anti-Peptide YY (PYY) Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
Peptide YY (PYY) is secreted from endocrine cells in the lower small intestine, colon and pancreas. PYY inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility (Ref: SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A peptide from the C-terminus of human mature Peptide YY (24-36 aa) .
Applications:
ELISA
Antibody Isotype:
IgY
Application Details:
ELISA. Suggested dilution at 1:200 to 1:1,000 (coating antibody) and 1:2,000 to 1:5,000 (detection antibody). Biosensis recommends that the optimal working dilution should be determined by the end user.
Chicken anti-Peptide YY (PYY) Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
Peptide YY (PYY) is secreted from endocrine cells in the lower small intestine, colon and pancreas. PYY inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility (Ref: SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A peptide from the N-terminus of human mature Peptide YY (3-18 aa).
Applications:
ELISA
Antibody Isotype:
IgY
Application Details:
ELISA . Suggested dilution at 1:200 to 1:1,000 (coating antibody) and 1:2,000 to 1:5,000 (detection antibody) .
Chicken anti-Peptide YY (PYY) Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
Peptide YY (PYY) is secreted from endocrine cells in the lower small intestine, colon and pancreas. PYY inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility (Ref: SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A peptide from the N-terminus of human mature Peptide YY (3-18 aa).
Applications:
ELISA
Antibody Isotype:
IgY
Application Details:
ELISA . Suggested dilution at 1:2,000 to 1:10,000 (detection antibody). Biosensis recommends that the optimal working dilution should be determined by the end user.
The enzyme Peptidylprolyl isomerase (Pin1) is responsible for flipping the proline ring from the cis to trans conformation. This enzyme regulates mitosis presumably by interacting with NIMA and attenuating its mitosis-promoting activity (ref: SWISSPROT). Pin1 is concentrated in the nucleus in small punctate structures and is particularly obvious in tumor cells.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Chicken
Species Reactivity:
Cat,Human,Mouse,Other Mammals (Predicted),Rat
Immunogen:
Recombinant full length Peptidylprolyl isomerase (Pin1) purified from E.coli
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgY
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:500-1,000 is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB. This antibody detects ~21 kDa Pin1 protein. Human, Rat, Mouse and Feline. Predicted to react with other mammalian tissue.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Protein L is a 36 kDa immunoglobulin-binding protein isolated from the bacteria Peptostreptococcus magnus. Unlike Protein A and Protein G, which bind to the Fc region of immunoglobulins (antibodies), Protein L binds antibodies through light chain interactions. Protein L binds a wider range of antibody classes than Protein A or G. Protein L binds to representatives of all antibody classes, including IgG, IgM, IgA, IgE and IgD.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at -20 °C; make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Protein L is an immunoglobulin-binding protein isolated from the bacteria Peptostreptococcus magnus. Unlike Protein A and Protein G, which bind to the Fc region of immunoglobulins (antibodies), Protein L binds antibodies through light chain interactions. Protein L binds a wider range of antibody classes than Protein A or G. Protein L binds to representatives of all antibody classes, including IgG, IgM, IgA, IgE and IgD.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at -20 °C; make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Protein L is a 36 kDa immunoglobulin-binding protein isolated from the bacteria Peptostreptococcus magnus. Unlike Protein A and Protein G, which bind to the Fc region of immunoglobulins (antibodies), Protein L binds antibodies through light chain interactions. Protein L binds a wider range of antibody classes than Protein A or G. Protein L binds to representatives of all antibody classes, including IgG, IgM, IgA, IgE and IgD.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at -20 °C; make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Perforin, a pore-forming protein found in the granules of cytotoxic T-lymphocytes and natural killer cells, functions to enable granzymes to enter the target cells and activate apoptosis. Perforin expression is upregulated in activated CD8+ T-cells, and these cells have been identified to have a major influence in Th1-associated inflammatory skin diseases. It has been suggested that perforin plays a role in alloimmunity, being involved in both the cytolytic process of rejection as well as downregulation of the T-cell mediated responses associated with the alloimmune response. Perforin-mediated cytotoxicity has also been linked to a number of autoimmune diseases.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC646
Antibody Isotype:
IgG1
GMDN Code:
63737
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Spleen
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Perforin, a pore-forming protein found in the granules of cytotoxic T-lymphocytes and natural killer cells, functions to enable granzymes to enter the target cells and activate apoptosis. Perforin expression is upregulated in activated CD8+ T-cells, and these cells have been identified to have a major influence in Th1-associated inflammatory skin diseases. It has been suggested that perforin plays a role in alloimmunity, being involved in both the cytolytic process of rejection as well as downregulation of the T-cell mediated responses associated with the alloimmune response. Perforin-mediated cytotoxicity has also been linked to a number of autoimmune diseases.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC646
Antibody Isotype:
IgG1
GMDN Code:
63737
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Spleen
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Perforin, a pore-forming protein found in the granules of cytotoxic T-lymphocytes and natural killer cells, functions to enable granzymes to enter the target cells and activate apoptosis. Perforin expression is upregulated in activated CD8+ T-cells, and these cells have been identified to have a major influence in Th1-associated inflammatory skin diseases. It has been suggested that perforin plays a role in alloimmunity, being involved in both the cytolytic process of rejection as well as downregulation of the T-cell mediated responses associated with the alloimmune response. Perforin-mediated cytotoxicity has also been linked to a number of autoimmune diseases.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC646
Antibody Isotype:
IgG1
GMDN Code:
63737
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Spleen
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Peripherin is a class-III neuronal intermediate filament protein found in certain classes of neuron, most of which are located in the peripheral nervous system.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Chicken
Species Reactivity:
Cat,Human,Mouse,Other Mammals,Rat
Immunogen:
Recombinant full length rat Peripherin protein expressed in and purified from E.coli
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgY
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:500-1,000 is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Peripherin; Prph; Prph1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Sekerkova G. et al (2008) Espin actin-cytoskeletal proteins are in rat type I spiral ganglion neurons and include splice-isoforms with a functional nuclear localization signal. J Comp Neurol. 2008 Aug 20;509(6):661-76.
Specificity:
The specificity of this antibody has been confirmed by WB. This antibody detects ~57 kDa Peripherin protein. A suitable control tissue is rat spinal cord or peripheral nerve homogenate. Hu, Rat, Ms, Fel, and other mammals
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Mouse anti-Peripherin Monoclonal Antibody (Unconjugated), suitable for WB, ICC, IHC-Frozen.
Background Info:
Peripherin is a class-III neuronal intermediate filament protein found in certain classes of neuron, most of which are located in the peripheral nervous system.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Mouse
Species Reactivity:
Cat,Human,Mouse,Other Mammals (Predicted),Rat
Immunogen:
Recombinant full length rat Peripherin protein expressed in and purified from E.coli
Applications:
ICC,IHC-Frozen,WB
Clone number:
7C5
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A concentration of 0.5 - 2 µg/mL is recommended for WB. A concentration of 1-5 µg/mL is recommended for IC and IH. This antibody performs well on aldehyde fixed tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Peripherin; Prph; Prph1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Sekerkova G. et al (2008) Espin actin-cytoskeletal proteins are in rat type I spiral ganglion neurons and include splice-isoforms with a functional nuclear localization signal. J Comp Neurol. 2008 Aug 20;509(6):661-76.
Specificity:
The specificity of this antibody has been confirmed by WB. This antibody detects ~57 kDa Peripherin protein. Human, mouse, feline. Predicted to react with other mammalian tissue.
Storage:
Store lyophilized, unopened vial at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C to -80°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Peripherin Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Peripherin is a class-III neuronal intermediate filament protein found in certain classes of neuron, most of which are located in the peripheral nervous system.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Pig,Rat
Immunogen:
Recombinant full length Peripherin protein expressed in and purified from E.coli.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (IC). A dilution of 1:2,000 - 1:10,000 is recommended for WB. A dilution of 1:1,00-1:2,000 is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Peripherin; Prph; Prph1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Ise H. et al (2017) Elucidation of GlcNAc-binding properties of type III intermediate filament proteins, using GlcNAc-bearing polymers. Genes Cell. 2017 Sep; [Epub ahead of print] Sekerkova G. et al (2008) Espin actin-cytoskeletal proteins are in rat type I spiral ganglion neurons and include splice-isoforms with a functional nuclear localization signal. J Comp Neurol. 2008 Aug 20;509(6):661-76.
Specificity:
The specificity of this antibody has been confirmed by WB. This antibody detects ~57 kDa Peripherin protein and a smaller molecule derived from Peripherin at ~48 kDa. Hu, Rat, Ms, Fel, Rb. Predicted to react with other mammalian tissue.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Permanent HRP Green Kit is intended for immunohistochemical and in situ-hybridisation staining procedures with horse radish peroxidase (HRP). It results in the formation of a green precipitate at the location of the target antigen or target nucleic acid. The precipitate is insoluble in organic solvents and can be observed by light microscopy. The HRP Green precipitate shows a very good contrast to red chromogenic substrates used with alkaline phosphatase detection systems and is therefore especially recommended for double stains. Permanent HRP Green Kit is intended for research use only.
100 ml HRP Green Substrate Buffer 3 ml HRP Green Chromogen 1 Dilution Vial
Storage and handling:
The solutions should be stored at 2-8°C without fur ther dilution. Please store the reagents in a dark place and do not freeze them. Under these conditions the solutions are stable up to the expiry date indicated on the label. Do not use product after the expiry date. The working solution should be prepared freshly at the day of use. It is stable for at least 4 hours. Excess working solution should be disposed. A positive and a negative control have to be carried out in parallel to the test material. If you observe unusual staining or other deviations from the expected results which could possibly be caused by the kit reagents please contact our technical support.
Reagent preparation:
1) Pipette 1 ml HRP Green Substrate Buffer into the provided dilution vial. 2) Add 1 drop (30 µl) of HRP Green Chromogen. Mix thoroughly. 3) The resulting working solution is stable for at least 4 hours. If you want to prepare other quantities of the working solution, please use the same ratio HRP Green Substrate and HRP Chromogen.
Procedure:
1) Rinse the slide with wash buffer after the previous incubation step. 2) Apply the Permanent HRP Green working solution onto the slide. Incubate for 2-10 minutes. 3) Rinse with distilled H2O. 4) Counterstain with haematoxylin for about 30 seconds up to 5 minutes (depending on the desired staining intensity). 5) Rinse with distilled H2O. 6) Blueing in tap water for 5 minutes. 7) Dehydrate through a graded series of ethanol and clear in xylene. Do not exceed incubation times of 30 sec per dehydration step. Use only high purity xylene. Mount with a permanent mounting medium. Note: The colour intensity can be intensified by increasing the chromogen concentration (up to 3 drops or 90 µl chromogen) in the working solution. Lithium carbonate may have a negative effect on the staining result. We recommend to only bluing in tap water. Occasionally precipitates may appear in the HRP Green Chromogen solution. This doesnt affect the staining result.
Expected results:
During the reaction of the substrate with horse radish peroxidase in presence of the Permanent HRP Green chromogen, a green precipitate is formed at the location of the target antigen or nucleic acid. The precipitate is insoluble in organic solvents and can be observed by light microscopy.
Trouble shooting:
If you observe unusual staining or other deviations from the expected results please read these instructions carefully, contact our technical support. Also refer to the instructions of the detection systems for guidance on general troubleshooting.
Quality Control:
We recommend carrying out a positive and a negative control with every staining run. The positive control permits the validation of appropriate processing of the sample. If the negative control has a positive result, this points to unspecific staining. Please refer to the instructions of the detection system for guidance on general quality control procedures.
Performance characteristics:
Studies have been conducted to evaluate the performance of the kit reagents. The product has been found to be suitable for the intended use
Limitations of procedure:
Too long incubation steps at the final dehydration serious can diminish the staining intensity. Also low grade xylene and some forms of recycled alcohol can have a negative effect on the staining result. In double stain procedures we recommend to use Permanent HRP Green as the last chromogen. Immunohistochemistry is a complex method in which histological as well as immunological detection methods are combined. Tissue processing and handling prior to immunostaining, for example variations in fixation and embedding or the inherent nature of the tissue can cause inconsistent results (Nadji and Morales, 1983). Sanbio guarantees that the product will meet all requirements described from its shipping date until its expiry date, as long as the product is correctly stored and utilized. No additional guarantees can be given. Under no circumstances shall Sanbio be liable for any damages arising out of the use of the reagent provided.
Precautions:
Use by qualified personnel only. Wear protective clothing to avoid contact of reagents or specimen with eye, skin or mucous membrane. In case of a reagent or specimen coming into contact with a sensitive area, wash the area with large amounts of water. Microbial contamination of the reagents must be avoided, since otherwise non-specific staining may occur. Material safety data sheets (MSDS) are available upon request.
Peroxiredoxin-1 has a role in redox regulation of the cell.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (PLVSDPKRTIAQDY) corresponding to the region 103-116 amino acids of human Peroxiredoxin-1 conjugated to diptheria toxin.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF of 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 4,000 is recommended. A dilution of 1: 1,000 to 1: 4,000 is recommended for ELISA. This antibody stains non-ciliated bronchiolar cells in rat airways and specific kidney tubule cells. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Peroxiredoxin-2 has a role in redox regulation of the cell.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (VVDGAFKEVKLS) corresponding to region (20-31 aa) from human Peroxiredoxin-2 conjugated to diptheria toxin.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF of 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 4,000 is recommended. A dilution of 1: 1,000 to 1: 4,000 is recommended for ELISA. This antibody stains basal cells in rat airways and specific kidney tubule cells. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human Peroxiredoxin-2, no cross reactivity to other family members
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Peroxiredoxin-3 has a role in redox regulation of the cell.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (CEVVAVSVDSHFSHLAW) from a region (127-143 aa) on human Peroxiredoxin-3 conjugated to KLH.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF of 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 2,000 is recommended. This antibody detects a protein at approx 23 kDa on WB of human brain tissue which is the mature form of this protein. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Thioredoxin-dependent peroxide reductase, mitochondrial; Antioxidant protein 1; AOP-1; HBC189; Peroxiredoxin III; Prx-III; Peroxiredoxin-3; Protein MER5 homolog; PRDX3; AOP1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Peroxiredoxin-3 no cross reactivity to other family members
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Peroxiredoxin-4 has a probable role in redox regulation of the cell.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (SRVSVADHSLHLSKAKISK) corresponding to a region (65-83 aa) from human Peroxiredoxin-4 conjugated to diptheria toxin.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF of 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 4,000 is recommended. A dilution of 1: 1,000 to 1: 4,000 is recommended for ELISA. This antibody stains non-ciliated bronchiolar cells in rat lung and what appears to be sebaceous glands in rat skin. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Tam KC et al. (2018) Evidence for the interaction of peroxiredoxin-4 with the store-operated calcium channel activator STIM1 in liver cells. Cell Calcium. 2018 May 15;74:14-28.
Specificity:
Human Peroxiredoxin-4 no cross reactivity to other family members
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Peroxiredoxin-5 has a role in intracellular redox signaling.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (VKALNVEPDGTGLTC) corresponding to region (190-204 aa) of human Peroxiredoxin-5 conjugated to KLH. Human, mouse and rat sequences of this peptide are identical.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, IF, WB. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 2,000 is recommended. This antibody clearly detects a protein at approximately 22 kDa on WB of human brain tissue. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human Peroxiredoxin-5 no cross reactivity to other family members
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
FUNCTION: Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. SUBUNIT: Homotetramer. SUBCELLULAR LOCATION: Cytoplasm. Lysosome. Also found in lung secretory organelles. MISCELLANEOUS: The active site is the redox-active Cys-47 oxidized to Cys-SOH. Cys-SOH may rapidly react with a Cys-SH of the other subunit to form an intermolecular disulfide with a concomitant homodimer formation. The enzyme may be subsequently regenerated by reduction of the disulfide by thioredoxin . MISCELLANEOUS: Irreversibly inactivated by overoxidation of Cys-47 (to Cys-SO(3)H) upon oxidative stress. SIMILARITY: Belongs to the ahpC/TSA family. Rehydrin subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Rat recombinant Peroxiredoxin-6. The sequence is homologous in human and mouse peroxiredoxin-6.
Applications:
ELISA,ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works superbly in Immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 100 to 1: 1000 depending on tissue and detection method. For western blotting a dilution range of 1: 1000 to 1: 4000 is recommended. A dilution of 1: 1000 to 1: 4000 is recommended for ELISA. This antiserum stains the cytoplasm of epithelial cells in the rat and mouse lung and rat and human brain astrocytes. It stains human brain astrocytes in Parkinson's and Alzheimer 's disease and the central core of some Lewy bodies in Parkinson's disease and dementia with Lewy bodies. Other tissues have not yet been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Walsh B. et al. (2010) Overexpression of Prdx6 and resistance to peroxide-induced death in Hepa1-6 cells: Prdx suppression increases apoptosis. Redox Rep. 2009;14(6):275-84. Gardiner F. et al. (2010) Induction of Prdx1 and Prdx6 in Liver Cellsby Serum and TPA. Intl J. Biol. Vol. 2, No. 1
Specificity:
This antibody has been shown to be specific for Peroxiredoxin-6 protein. Rat, human and mouse, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Involved in redox regulation of the cell. Can reduce hydrogen peroxide and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. SUBUNIT: Homotetramer. May interact with HTR2A. SUBCELLULAR LOCATION: Cytoplasm. Lysosome. Also found in lung secretory organelles. MISCELLANEOUS: The active site is the redox-active Cys-47 oxidized to Cys-SOH. Cys-SOH may rapidly react with a Cys-SH of the other subunit to form an intermolecular disulfide with a concomitant homodimer formation. The enzyme may be subsequently regenerated by reduction of the disulfide by thioredoxin . MISCELLANEOUS: Irreversibly inactivated by overoxidation of Cys-47 (to Cys-SO(3)H) upon oxidative stress. SIMILARITY: Belongs to the ahpC/TSA family. Rehydrin subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Rat recombinant Peroxiredoxin-6
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works superbly in Immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 100 to 1: 1000 depending on tissue and detection method. For western blotting a dilution range of 1: 500 to 1: 2000 is recommended. A dilution of 1: 1000 to 1: 2000 is recommended for ELISA. This antiserum stains the cytoplasm of epithelial cells in the rat and mouse lung and rat and human brain astrocytes. It stains human brain astrocytes in Parkinson's and Alzheimer 's disease and the central core of some Lewy bodies in Parkinson's disease and dementia with Lewy bodies. Other tissues have not yet been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
This antibody has been shown to be specific for Peroxiredoxin-6 protein. Rat, human and mouse, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Peroxisome proliferator-activated receptor gamma (PPARG) is a nuclear hormone receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the receptor binds to a promoter element in the gene for acyl-CoA oxidase and activates its transcription (Ref: SWISSPROT).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human
Immunogen:
Human Peroxisome proliferator-activated receptor gamma peptide (115-129 aa).
Applications:
WB
Antibody Isotype:
IgY
Application Details:
WB. Suggested dilution at 1:2,000 to 1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
PPAR gamma; PPAR-gamma; Nuclear receptor subfamily 1 group C member 3; PPARG; NR1C3;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Peroxisome proliferator-activated receptor gamma
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rieske Iron-Sulfur Protein (Q9ZR03) is located in chloroplast thylakoid membrane as a component of cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. Alternative names: Rieske iron-sulfur protein, RISP, ISP, plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein, proton gradient regulation protein 1
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Pipitone et al. (2021). A multifaceted analysis reveals two distinct phases of chloroplast biogenesis during de-etiolation in Arabidopsis. Elife. 2021 Feb 25;10:e62709. doi: 10.7554/eLife.62709. PMID: 33629953; PMCID: PMC7906606.Kana et al. (2020). Fast Diffusion of the Unassembled PetC1-GFP Protein in the Cyanobacterial Thylakoid Membrane. Life (Basel). 2020 Dec 29;11(1):E15. doi: 10.3390/life11010015. PMID: 33383642.Zhang et al. (2020). Enhanced Relative Electron Transport Rate Contributes To Increased Photosynthetic Capacity In Autotetraploid Pak Choi. Plant Cell Physiol. 2020 Jan 6. pii: pcz238. doi: 10.1093/pcp/pcz238.Pralon et al. (2019). Plastoquinone homoeostasis by Arabidopsis proton gradient regulation 6 is essential for photosynthetic efficiency. Commun Biol. 2019 Jun 20;2:220. doi: 10.1038/s42003-019-0477-4. Koochak et al. (2019). The structural and functional domains of plant thylakoid membranes. Plant J. 2019 Feb;97(3):412-429. doi: 10.1111/tpj.14127.
Special application note:
This product can be sold containing Proclin if requested.
Rieske Iron-Sulfur Protein (Q9ZR03)is located in chloroplast thylakoid membrane as a component of cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. Alternative names: Rieske iron-sulfur protein, RISP, ISP, plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein, proton gradient regulation protein 1This is a recombinant protein standard, source: Synechocystis PCC 6803.
Product Type:
Antibody
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Concentration: after adding 225 l of milliQ water final concentration of the standard is 0.15 pmol/ lProtein standard buffer composition: Glycerol 10%, Tris Base 141 mM, Tris HCl 106 mM, LDS 2%, EDTA 0.51 mM, SERVA Blue G250 0.22 mM, Phenol Red 0.175 mM, pH 8.5, 0.1mg/ml PefaBloc protease inhibitor (Roche), 50mM DTT.This standard is ready-to-load and does not require any additions or heating. It needs to be fully thawed and thoroughly mixed prior to using. Avoid vigorous vortexing, as buffers contain detergent. Following mixing, briefly pulse in a microcentrifuge to collect material from cap.This standard is stabilized and ready and does not require heating before loading on the gel. Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Application Details:
Standard curve: 3 loads are recommended (0.5, 2 and 4μl).For most applications a sample load of 0.2μg of chlorophyll will give a PsbA signal in this range.Positive control:a 2μl load per well is optimal for most chemiluminescent detection systems.This standard is stabilized and ready and does not require heating before loading on the gel. Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Reconstitution:
For reconstitution add 225 l of milliQ water, Please notice that this product contains 10% glycerol and might appear as liquid but is provided lyophilized
Molecular Weight:
33 kDa (larger than native protein due to the addition of His-tag), In most gel systems, PetC protein migrates at 23 kDa
Selected references:
Pipitone et al. (2021). A multifaceted analysis reveals two distinct phases of chloroplast biogenesis during de-etiolation in Arabidopsis. Elife. 2021 Feb 25;10:e62709. doi: 10.7554/eLife.62709. PMID: 33629953; PMCID: PMC7906606.Li et al. (2014). The nitrogen costs of photosynthesis in a diatom under current and future pCO2. New Phytol. 2014 Sep 25. doi: 10.1111/nph.13037.Wu et al. (2014). Large centric diatoms allocate more cellular nitrogen to photosynthesis to counter slower RUBISCO turnover rates. Front. Mar. Sci., 09 December 2014 | doi: 10.3389/fmars.2014.00068.
Special application note:
The PetC protein standard can be used in combination with global anti-PetC antibodies to quantitate PetC from a wide range of species. Global antibodies are raised against highly conserved amino acid sequences in the PetC protein.Quantitative western blot: detailed method description, video tutorial
PetD (Cytochrome b6-f complex subunit 4) is the component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. Alternative name: 17 kDa polypeptide
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes.
Pex14p has a protein transporter activity and is involved in protein targeting into peroxisome. Submitted protein name: Genomic DNA, chromosome 5, P1 clone:MQB2
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Cucumis melo, Magnaporthe oryzaeSpecies of your interest not listed? Contact us
Immunogen:
Recombinant, soluble N-terminal domain of Arabidopsis thaliana Pex14p UniProt:Q9FE40, TAIR: At5g62810) that mediates PEX5 and PEX19 binding. The transmembrane and coiled-coil domains of PEX14 were replaced with a dual StrepII-His6 tag.
Antibodies will detect Pex14 protein in both light- and dark-grown seedlings grown on petri dishes and in rosette leaves of adult plants grown in soil
Application Details:
1 : 10 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 25 l of sterile water
Molecular Weight:
55,5 | 75-65 kDa (depending on the gel system)
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Llinas et al. (2022) An Arabidopsis pre-RNA processing8a (prp8a) missense allele restores splicing of a subset of mis-spliced mRNAs. Plant Physiol. 2022 Aug 1;189(4):2175-2192. doi: 10.1093/plphys/kiac221. PMID: 35608297.Calero-Munoz et al. (2019). Cadmium induces reactive oxygen species-dependent pexophagy in Arabidopsis leaves. Plant Cell Environ. 2019 Sep;42(9):2696-2714. doi: 10.1111/pce.13597.McLoughlin et al. (2018). Maize multi-omics reveal roles for autophagic recycling in proteome remodelling and lipid turnover. Nat Plants. 2018 Dec;4(12):1056-1070. doi: 10.1038/s41477-018-0299-2.Gonzalez et al. (2018). A pex1 missense mutation improves peroxisome function in a subset of Arabidopsis pex6 mutants without restoring PEX5 recycling. Proc Natl Acad Sci U S A. 2018 Apr 3;115(14):E3163-E3172. doi: 10.1073/pnas.1721279115.Vincent et al. (2017). A genome-scale analysis of mRNAs targeting to plant mitochondria: upstream AUGs in 5' untranslated regions reduce mitochondrial association. Plant J. 2017 Dec;92(6):1132-1142. doi: 10.1111/tpj.13749.
PGDH3 | Phosphoglycerate dehydrogenase 3 (chloroplastic) is an enzyme ((EC:1.1.1.95) involved in the plastidial phosphorylated pathway of serine biosynthesis (PPSB), step 1 of the subpathway that synthesizes L-serine from 3-phospho-D-glycerate. Expressed in aerial parts. Not detected in roots and meristematic tissue. Expressed in cotyledons, adult leaves, stigma and anther filaments.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Beside PGDH3 the antibody is recognizing in Arabidopsis thaliana PGDH1, UniProt: O49485-1 and PGDH2, UniProt: O04130-2
Application Details:
1 : 3000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l, of sterile water
Molecular Weight:
62,1 | 55-60 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
H hner et al. (2021) Stromal NADH supplied by PHOSPHOGLYCERATE DEHYDROGENASE3 is crucial for photosynthetic performance. Plant Physiology. 2021. kiaa117, https://doi.org/10.1093/plphys/kiaa117
Plastoglobules are lipoprotein particles which can be found in chloroplasts. They are generally believed to have a function of lipid storage. Recent data suggest that plastoglobules can be also metabolically active, taking part in tocopherol synthesis and likely other pathways. Immunogen: Alternative name AtPap1, fibrillin-1, probable plastid-lipid-associated protein 1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
(2021). Autophagy is required for lipid homeostasis during dark-induced senescence.Plant Physiology, 2021;, kiaa120Luo et al. (2015). Distinct carotenoid and flavonoid accumulation in a spontaneous mutant of Ponkan (Citrus reticulata Blanco) results in yellowish fruit and enhanced postharvest resistance. J Agric Food Chem. 2015 Sep 2.G mez-Arjona et al. (2014). Starch synthase 4 is located in the thylakoid membrane and interacts with plastoglobule-associated proteins in Arabidopsis. Plant J. 2014 Oct;80(2):305-16. doi: 10.1111/tpj.12633.
Special application note:
Cellular [compartment marker] of chloroplast plastoglobules.For IC samples were embedded in Lowicryl HM20 and sectioned into 100-nm-thick sections and placed on Formvar-coated gold slot grids. The sections were blocked for 20 min with a 5% (w/v) solution of nonfat milk in TBS plus 0.1%Tween 20 (TBST). Anti-PGL antibodies were diluted 1:20 in a solution of 2.5% nonfat milk in TBST at room temperature for 1 h. The sections were rinsed in a stream of TBS plus 0.5% Tween 20 and then transferred to the secondary antibody (anti-rabbit IgG 1:20 in TBST) conjugated to 10-nm gold particles for 1 h. images of localization can be found in Austin et al. (2006).
Phosphoglucomutase is an enzyme which participates in both the breakdown and synthesis of glucose.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Zea mays
Expected Species:
Arabidopsis thaliana, Glycine max, Triticum aestivum Species of your interest not listed? Contact us
Immunogen:
Recombinant phosphoglucomutase of Zea mays, UniProt: P93804
Immunoprecipitation was performed by using Dynabeads Protein A: briefly 100 l suspension was washed with 200 l TTBS (Tris Buffered saline, 50 mM Tris-HCl pH 7.6 and 165 mM NaCl with 0.1% Tween 80) using the magnetic stands for concentrating the magnetic beads. After wash the beads were preincubated with 20 l primary antibodies in 180 l TTBS at room temperature for 30 minutes (minimum 15 minues). A first wash was followed afterwards with 200 l TTBS and hence a real incubation with 200 l plant extract (supernatant 20,000 x g for 3 min.), 200 l of TTBS and further 50 l YeastBuster reagent (Novagen) containing a mixture of detergents to break and solubilize the mitochondria membrane. This incubation at room temperature was allowed to be under mild shaking to allow the beads to be in suspension. Hence supernatant was aspirated away by the use of the magnetic stand and two further washesing steps with 200 l TTBS were performed prior mixing with 100 l SDS-Sample buffer.Antibody is recognizing recombinant PGM1, overexpressed in E.coli.
PGR5 (Protn gradient regulation 5) is involved in the regulation of the cyclic electron flow (CEF) around Photosystem I and cellular response to light intensity and photoprotection. Essential for the reduction of PGRL1A by ferredoxin and for photoprotection.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
This product can be sold containing proclin if requested
Application Details:
1: 1000 - 1: 5000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
14,29 kDa
Not reactive in:
diatoms, Chlorella sp., cyanobacteria
Selected references:
Cao et al. (2022) Autophagic pathway contributes to low-nitrogen tolerance by optimizing nitrogen uptake and utilization in tomato. Hortic Res. 2022 Mar 23;9:uhac068. doi: 10.1093/hr/uhac068. PMID: 35669705; PMCID: PMC9164271.Ermakova et al. (2022) Enhanced abundance and activity of the chloroplast ATP synthase in rice through the overexpression of the AtpD subunit. J Exp Bot. 2022 Jul 29:erac320. doi: 10.1093/jxb/erac320. Epub ahead of print. PMID: 35904136.Urban, Rogowski & Romanowska (2022), Crucial role of the PTOX and CET pathways in optimizing ATP synthesis in mesophyll chloroplasts of C3 and C4 plants, Environmental and Experimental Botany, Volume 202, October 2022, 105024, https://doi.org/10.1016/j.envexpbot.2022.105026Yang et al. (2020). Two dominant boreal conifers use contrasting mechanisms to reactivate photosynthesis in the spring. Nat Commun. 2020 Jan 8;11(1):128. doi: 10.1038/s41467-019-13954-0.Rantala et al. (2020). PGR5 and NDH-1 systems do not function as protective electron acceptors but mitigate the consequences of PSI inhibition. Biochim Biophys Acta Bioenerg. 2020 Jan 11;1861(3):148154. doi: 10.1016/j.bbabio.2020.148154.
PGRL1 is a transmembrane protein present in thylakoids of higher plants and algae. Arabidopsis plants lacking PGRL1 show perturbation of cyclic electron transport (CEF) around photosystem I (PSI), similar to PGR5-deficient plants. PGRL1 has been shown to interact physically with PGR5 and associate with PSI (DalCorso et al., 2008). In Chlamydomonas reinhardtii, PGRL1 is part of a protein supercomplex, composed of PSI with its own light-harvesting complex (LHCI), the photosystem II light-harvesting complex (LHCII), the cytochrome b6/f complex (Cyt b6f), ferredoxin (Fd)-NADPH oxidoreductase (FNR), responsible of the energy balance of the two photosystems and of the switch between thylakoid linear and cyclic electron transport (Iwai et al., 2010). Synonymes: Ferredoxin-plastoquinone reductase 1
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Dichanthelium oligosanthes, Glycine soja, Gossypium arboreum, Klebsormidium nitens, Nelumbo nucifera, Noccaea caerulescens, Physcomitrium patens, Prunus dulcis, Prunus yedoensis, Rhizophora mucronatamm, Solanum chacoense, Trifolium medium, Zea mays, Vitis viniferaSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana PGRL1A UniProt: Q8H112, TAIR: At4g22890Peptide used to elicit this antibody is conserved in both isoforms PGRL1A and 1B of Zea mays
McKinnon et al. (2020). Membrane Chaperoning of a Thylakoid Protease Whose Structural Stability Is Modified by the Protonmotive Force. Plant Cell DOI: 10.1105/tpc.19.00797
Protein belongs to DNA photolyases and functions in DNA repair.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Lyophilized antibody can be stored at -20 °C for up to 3 years. Re-constituted antibody can be stored at 4°Cfor several days to weeks. Once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Mucuna pruriens (A0A371HBY0), Noccaea caerulescens (A0A1J3JTQ8) Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana DNA photolyase, UniProt: F4JSJ6, TAIR: AT4G25290, located towards C-terminal part of this protein
Protein belongs to DNA photolyases and functions in DNA repair.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana DNA photolyase, UniProt: F4JSJ6, TAIR: AT4G25290, loacted in the N-terminal part of the protein
Rabbit anti-Phospho-calcium/calmodulin-dependent protein kinase type II subunit alpha, Thr253 (alpha-CaMKII, Thr253) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Calcium/calmodulin-stimulated protein kinase II (CaMKII) is composed of four different chains (alpha, beta, gamma, and delta) and is abundantly expressed in neurons. CaMKII is involved in regulating many aspects of neuronal function, including neurotransmitter synthesis and release, modulation of ion channel activity and cellular transport. The enzymatic function of CaMKII is regulated by its multiple phosphorylation sites and targeting to sub-cellular locations through interactions with protein binding partners. Phosphorylation of Thr253 has been identified in vivo and found to alter the interaction of CaMKII with binding partners, but not change its enzymatic activity. Thus, phosphorylation of Thr253 is suggested to modulate functional responses based on its binding partner and subsequently its sub-cellular localization.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Rat
Immunogen:
A synthetic peptide (NKmLpTINPSC) corresponding to the sequence around Thr253 (AA 249-257) in alpha-CaMKII was synthesized, purified to 95% purity by HPLC, analyzed by mass spectroscopy and coupled to diphtheria toxoid.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (1:200 - 1:1000). Other applications have not been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Skelding KA et al (2012) J J Cereb Blood Flow Metab 32 (12), 2181-2192. Skelding KA et al (2010) Cell Signal 22 (5), 759-769. Gurd JW et al (2008) Brain Res 1218, 158-165. Migues PV et al (2006) J Neurochem 98 (1), 289-299.
Specificity:
Rat Predicted from gene analysis to react with human and mouse alpha-CaMKII.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
Phospho-calcium/calmodulin-dependent protein kinase type II subunit alpha, Thr253 (alpha-CaMKII, Thr253)
Phosphoglucose isomerase, is a cytoplasmic enzyme, which catalyses the conversion of glucose-6-phosphate to fructose-6-phosphate, the second step in glycolysis, and the reverse reaction during gluconeogenesis. Alternative names: GPI , Phosphoglucose isomerase, PGI Phosphohexose isomerase, PHI
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Saccharomyces cerevisiae
Expected Species:
Species of your interest not listed? Contact us
Immunogen:
Phosphoglucose isomerase isolated and purified from Saccharomyces cerevisiae, UniProt: P12709
Applications:
Dot blot (Dot), ELISA (ELISA), Indirect immunofluorescence (indirect IF), Western blot (WB)
Phosphoglucose isomerase, is a cytoplasmic enzyme, which catalyses the conversion of glucose-6-phosphate to fructose-6-phosphate, the second step in glycolysis, and the reverse reaction during gluconeogenesis. Alternative names: GPI , Phosphoglucose isomerase, PGI Phosphohexose isomerase, PHI
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Saccharomyces cerevisiae
Expected Species:
Species of your interest not listed? Contact us
Immunogen:
Phosphoglucose isomerase isolated and purified from Saccharomyces cerevisiae, UniProt: P12709
Applications:
Dot blot (Dot), ELISA (ELISA), Indirect immunofluorescence (indirect IF), Western blot (WB)
Detergents typically present in cell lysis buffers are thought to disrupt organelles and compartments and increase the exposure of soluble phospho-proteins to phosphatases and proteases thereby resulting in uncontrolled dephosphorylation and proteolysis. Phospho-Sure RTD Neuronal extraction buffer is optimized for the extraction of phosphorylated proteins from neuronal and other soft tissues types. The buffer extracts the phosphoproteins in a native state without the use of harsh detergents or oxidizers, and it is specially formulated to help maintain phosphoproteins and protect them from degradation better than traditional detergent based extraction buffers.
Product Type:
Buffer & Reagent
Format:
Powder
Applications:
IP,WB
Application Details:
Please download the protocol below for detailed instructions on how to use Phospho-Sure in neuronal and other soft tissues.
Alternative Names:
Phospho-sure
Biosensis Brand:
Phospho-Sure RTD
Shelf Life:
Powdered format can be stored up to 12 months after purchase under cool, dry conditions.
Use:
For research use only.
Product references:
1. Suneja SK, Mo Z, Potashner SJ. (2006) Phospho-CREB and other phospho-proteins: improved recovery from brain tissue. J Neurosci Methods. 2006 Jan 30;150(2):238-41. 2. Elvira Mass, Dagmar Wachten, Anna C. Aschenbrenner, Andre Voelzmann, Michael Hochemail (2014) Murine Creld1 Controls Cardiac Development through Activation of Calcineurin/NFATc1 Signaling, Developmental Cell Volume 28, Issue 6, p711-726
Storage:
The dry, unopened container should be stored at room temperature in a dry or desiccated location protected from light. Do not store in the refrigerator unless material is in a dry, moisture free environment. Material is hydroscopic so once the seal is broken it should be hydrated and not resealed while dry. Once hydrated, the buffer can be stored at 2-8°C for up to 3 months. Solution can be frozen but clumping may occur upon thawing and is not recommended.
Detergents typically present in cell lysis buffers are thought to disrupt organelles and compartments and increase the exposure of soluble phospho-proteins to phosphatases and proteases thereby resulting in uncontrolled dephosphorylation and proteolysis. Phospho-Sure RTD Neuronal extraction buffer is optimized for the extraction of phosphorylated proteins from neuronal and other soft tissues types. The buffer extracts the phosphoproteins in a native state without the use of harsh detergents or oxidizers, and it is specially formulated to help maintain phosphoproteins and protect them from degradation better than traditional detergent based extraction buffers.
Product Type:
Buffer & Reagent
Format:
Powder
Applications:
IP,WB
Application Details:
Please download the protocol below for detailed instructions on how to use Phospho-Sure in neuronal and other soft tissues.
Alternative Names:
Phospho-sure
Biosensis Brand:
Phospho-Sure RTD
Shelf Life:
Powdered format can be stored up to 12 months after purchase under cool, dry conditions.
Use:
For research use only.
Product references:
1. Suneja SK, Mo Z, Potashner SJ. (2006) Phospho-CREB and other phospho-proteins: improved recovery from brain tissue. J Neurosci Methods. 2006 Jan 30;150(2):238-41. 2. Elvira Mass, Dagmar Wachten, Anna C. Aschenbrenner, Andre Voelzmann, Michael Hochemail (2014) Murine Creld1 Controls Cardiac Development through Activation of Calcineurin/NFATc1 Signaling, Developmental Cell Volume 28, Issue 6, p711-726
Storage:
The dry, unopened container should be stored at room temperature in a dry or desiccated location protected from light. Do not store in the refrigerator unless material is in a dry, moisture free environment. Material is hydroscopic so once the seal is broken it should be hydrated and not resealed while dry. Once hydrated, the buffer can be stored at 2-8°C for up to 3 months. Solution can be frozen but clumping may occur upon thawing and is not recommended.
Phosphothreonine is a phosphoamino acid and phosphorylated ester of threonine.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at -20 °C for one year in storage buffer: PBS, 50 % glycerol and 0,01 % sodium azide, Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Antibody detects proteins phosphorylated on threonine residues. Does not cross-react with phosphotyrosine.5 % BSA is recommened to use for blocking as milk contains casein which is a phospho protein.
Immunogen:
KLH-conjugated phosphothreonine
Applications:
ELISA (ELISA), Immunoprecipitation (IP), Immunofluorescence (IF), Immunocytochemistry (ICC), Western blot (WB)
2 g/ml of this antibody is sufficient for detection of phosphorylation signal in western blot using mouse spleen extract treated with Vanadium.Use freshly extracted samples. Precipitate target protein to purify it and avoid cross-reactions.
Application Details:
ELISA (1:2000), ICC/IF (1:60), IP (1:100), WB (1:500)
Purity:
Immunogen affinity purified in PBS, 50% glycerol, 0.01% sodium azide.
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Affinity purified in PBS, pH 7.4 with 0.09 % sodium azide and 50 % glycerol at concentration 0.25 mg/ml. This antibody is recognizing proteins and peptides phosphorylated on threonine residues. There are no cross reactions with phosphotyrosine.
Phosphorylation of specific tyrosine residues has been shown to be a primary mechanism of signal transduction during normal mitogenesis, cell cycle progression and oncogenic transformation. Antibodies that specifically recognize phosphorylated tyrosine residues have proved to be invaluable to the study of tyrosine -phosphorylated proteins and the biochemical pathways in which they function.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at -20 °C; make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Mouse
Species Reactivity:
Phosphotyrosine - not species dependent
Immunogen:
balbC mice immunized with phosphotyrosine coupled to carrier protein
Applications:
ELISA (ELISA), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western blot (WB)
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on the label. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Mouse
Species Reactivity:
Species independent
Immunogen:
BSA-conjugated phosphotyrosine
Applications:
Immunocyto chemistry (ICC), Flowcyt (FC), Western blot (WB)
PHOT1 | phototropin-1 is a blue-light photoreceptor which containst light activated serine-threonine kinase domain. Is required for stomatal opening, chloroplast movements, leaf flattening and phototropism. Undergoes blue-light-dependent autophosphorylation. Alternative names: NPH1, RPT1, JK224, Non-phototropic hypocotyl protein 1, Root phototropism protein 1
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabidopsis thaliana
Immunogen:
KLH-conjugated synthetic peptide derived from known Arabidopsis thaliana PHOT1 O48963, At3g45780
Information about phot1 mutant, first named nph1: Liscum &. Briggs (1995). Mutations in the NPH1 Locus of Arabidopsis Disrupt the Perception of Phototropic Stimuli. The Plant Cell, Vol. 7, 473-485.Huala et al. (1997). Arabidopsis NPH1: A Protein Kinase with a Putative Redox-Sensing Domain. Science 19: Vol. 278 no. 5346 pp. 2120-2123.Lehmann et al. (2011). Transitions of gene expression induced by short-term blue light. Plant Biology Volume 13, Issue 2, pages 349–361. Seeds of this mutant are available at uNASC.
Application Details:
1 : 5000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
111 | 132 kDa
Not reactive in:
Cuscuta campestris, Oryza sativa
Selected references:
Labuz et al. (2021) Phototropin interactions with SUMO proteins. Plant Cell Physiol. 2021 Feb 17:pcab027. doi: 10.1093/pcp/pcab027. Epub ahead of print. PMID: 33594440.Krzeszowiec et al. (2020). Chloroplasts in C3 grasses move in response to blue-light. Plant Cell Rep . 2020 Oct;39(10):1331-1343.doi: 10.1007/s00299-020-02567-3. Epub 2020 Jul 13.Labuz et al. (2015). The impact of temperature on blue light induced chloroplast movements in Arabidopsis thaliana. Plant Science, doi:10.1016/j.plantsci.2015.07.013.Eckstein et al. (2015). Auxin and chloroplast movements. Physiol Plant. 2015 Oct 15. doi: 10.1111/ppl.12396.
Special application note:
This product can be sold containing ProClin if requested
PHOT2 | phototropin-2 is a membrane-bound serine/threonine kinase that functions as blue light photoreceptor in redundancy with PHOT1. Involved in processed like stomatal opening, chloroplast movement and phototropism. Alternative names: NPL1, K21L19.6, AtKin7, Defective in chloroplast avoidance protein 1Non-phototropic hypocotyl 1-like protein 1, NPH1-like protein 1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabidopsis thaliana
Immunogen:
KLH-conjugated synthetic peptide derived from known Arabidopsis thaliana PHOT2 P93025, At5g58140
Labuz et al. (2021) Phototropin interactions with SUMO proteins. Plant Cell Physiol. 2021 Feb 17:pcab027. doi: 10.1093/pcp/pcab027. Epub ahead of print. PMID: 33594440.Krzeszowiec et al. (2020). Chloroplasts in C3 grasses move in response to blue-light. Plant Cell Rep . 2020 Oct;39(10):1331-1343.doi: 10.1007/s00299-020-02567-3. Epub 2020 Jul 13.Labuz et al. (2015). The impact of temperature on blue light induced chloroplast movements in Arabidopsis thaliana. Plant Science, doi:10.1016/j.plantsci.2015.07.013.Aggarwal et al. (2014). Blue-light-activated phototropin2 trafficking from the cytoplasm to Golgi/post-Golgi vesicles. J Exp Bot. 2014 May 12.
Special application note:
This product can be sold containing ProClin if requested
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit, Secondary antibody: Goat,
Species Reactivity:
Algae, Cyanobacteria, Higher plants
Immunogen:
KLH-conjugated syntetic peptides for respective antibodies, see product info sheets
50 µl of respective antibody, 100 µl of each protein standard, 2 x 10 µl of secondary antibody, 10 ml of ECL reagent,
Estimation of PSI to PSII ratio can be done using quantitative western blot technique using anti-PsaC (PSI) and PsbA (PSII) antibodies. References: Brown et al. (2007). Resource dynamics during infection of Micromonas pusilla by virus MpV-SP1. Environmental Microbiology 9(11): 2720-2727. Brown et al. (2008). Flux capacities and acclimation costs in Trichodesmium from the Gulf of Mexico. Marine Biology 154 (3): 413-422.
Selected references:
Abramson (2018). CARBON PARTITIONING IN ENGINEERED CYANOBACTERI UM FOR THE STUDY OF FEEDBACK INHIBITION OF PHOTOSYNTHESIS. Michigan State University, ProQuest Dissertations Publishing, 2018. 10826228.Morash et al. (2007) Macromolecular dynamics of the photosynthetic system over a seasonal developmental progression in Spartina alterniflora. Can J. of Bot. 85: 476-483(8)Bouchard et al. (2006) UVB effects on the photosystem II-D1 protein of phytoplankton and natural phytoplankton communities. Photochem and Photobiol 82: 936-951.MacKenzie et al (2005). Large reallocations of carbon, nitrogen and photosynthetic reductant among phycobilisomes, photosystems and Rubisco during light acclimation in Synechococcus elongatus are constrained in cells under low environmental inorganic carbon. Arch of Microbiol. 183: 190 - 202.
Special application note:
Product information - Primary antibodies:Product number:Product name:Reconstitution: Recommended dilution:AS03 037Rabbit Anti-RbcL Global antibodyFor reconstitution see lable on respective tube.1:5000-10 000 with ECLAS10 939Rabbit Anti-PsaC Global antibodyFor reconstitution see lable on respective tube.1:1000 with ECLAS05 084Rabbit Anti-PsbAGlobal antibodyFor reconstitution see lable on respective tube.1:10 000 with ECL* All primary antibodies in this kit are raised in rabbits.Product information - Protein standards:Product number:Product name:Concentration:Size:Western Blot – Positive Control:AS01 016SPsbA *0.25 pmol/ μl41.5 kDa#To generate a standard curve, 3 loads are suggested (0.5, 2 and 4 ul). For most applications a sample load of 0.2 ug of chlorophyll will give a PsbA signal in this range.A 2 ul load is optimal for most chemiluminescent detection systems to use as a positive control.AS01 017SRbcL *0.15 pmol/ μl52.7 kDaTo generate a standard curve, 3 loads are suggested (0.5, 2 and 4 ul). For most applications a sample load of 0.2 ug of chlorophyll will give a RbcL signal in this range.A 2 ul load is optimal for most chemiluminescent detection systems to use as a positive control.AS04 042SPsaC *0.15 pmol/μl11.5 kDa#To generate a standard curve, 3 loads are suggested (0.5, 2 and 4 l). For most applications a sample load of 0.2 g of chlorophyll will give a PsaC signal in this range.A 2 ul load is optimal for most chemiluminescent detection systems as a positive control.*These proteins are larger than a respective native protein due to the addition of His-tag* For reconstitution of standards see lable on respective tube.Product information - Secondary antibody:AS09 602-trial Goat anti-Rabbit IgG (H&L), HRP conjugated, 20 l (2x10 l)Product information - ECLreagent:AS16 ECL-N-10 AgriseraECL Bright (10 ml trial pack)Educational information about Quantitative western blot can be found here: detailed method description, video tutorial
PHR1 (Phosphate starvation response 1) is nuclear localized and involved in transcription regulation.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Lyophilized antibody can be stored at -20 °C for up to 3 years. Re-constituted antibody can be stored at 4°Cfor several days to weeks. Once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Hordeum vulgare (recombinant PHR1)
Expected Species:
Aegilops tauschii, Brachypodium distachyon, Dichanthelium oligosanthes, Panicum hallii Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from Hordeum vulgare PHR1, UniProt: F4Y5E9
pHRed is a red fluorescent sensor of pH. Fluorescence emission of pHRed peaks at 610 nm while exhibiting dual excitation peaks at 440 nm and 585 nm.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
pHRed
Immunogen:
Recombinat part of pHRed of Chlamydomonas reinhardtii.
Hordeum vulgare Pht1-1 and 1-2 are putative high-affinity barley phosphate transporters that are likely to function in phosphate uptake from the soil (expressed in root epidermal cells).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Hordeum vulgare
Expected Species:
Triticum aestivumSpecies of your interest not listed? Contact us
Immunogen:
two synthetic peptides from the loop region of Pht1-1 (Q8H6E0) and 1-2, conjugated to KLH
Applications:
ELISA (ELISA), Immunolocalization (IL), Western blot (WB)
Antibody cannot discriminate between Pht1-1 or Pht1-2 due to the high level of sequence conservation
Application Details:
1 : 10 000 (ELISA), 1: 100 (IL), 1 : 2000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 100 µl of sterile water
Molecular Weight:
56.9 kDa
Not reactive in:
Arabidopsis thaliana
Selected references:
Namyslov et al. (2020). Exodermis and Endodermis Respond to Nutrient Deficiency in Nutrient-Specific and Localized Manner. Plants (Basel). 2020 Feb 6;9(2). pii: E201. doi: 10.3390/plants9020201. (immunolocalization)
Hordeum vulgare Pht1-6 is a putative low-affinity barley phosphate transporter that is likely to function in phosporus remobilisation around the plant (expressed in plant vascular tissues).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Hordeum vulgare
Immunogen:
two synthetic peptides from the loop region of Pht1-6 (Q8H6D9), conjugated to KLH
Phytochrome A (PhyA) is the primary photoreceptor mediating various responses to far-red (FR) light in plants. Alternative protein names: FAR RED ELONGATED HYPOCOTYL 2, FAR RED ELONGATED 1, ELONGATED HYPOCOTYL 8.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Brassica rapa, Cardamine hirsuta, Dacucus carota, Lathyrus sativus, Fragaria ananassa, Glycine max, Gossyoium hirsutum, Hordeum vulgare, Lotus corniculatus, Medicago truncatula, Nicotiana benthamiana (PhyA1), Nicotiana tabacum, Pisum sativum, Populus balsamifera, Ricinus communis, Solanum lycopersicumSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from conserved plant PhyA protein sequences including Arabidopsis thaliana UniProt:P14712, TAIR:At1g59070; peptide sequence is not present in other plant phytochrome forms (B-E)
Careful sample collection is adviced to assure the best results with this antibody
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
124 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Schwenk et al. (2021) Uncovering a novel function of the CCR4-NOT complex in phytochrome A-mediated light signalling in plants. Elife. 2021 Mar 30;10:e63697. doi: 10.7554/eLife.63697. PMID: 33783355; PMCID: PMC8009681.Schenk et al. (2021) Light-induced degradation of SPA2 via its N-terminal kinase domain is required for photomorphogenesis, Plant Physiology, 2021;, kiab156, https://doi.org/10.1093/plphys/kiab156Menon et al. (2019). Arabidopsis FAR-RED ELONGATED HYPOCOTYL 1 and FHY1-LIKE are not required for phytochrome A signal transduction in the nucleus. Plant Communications. Available online 9 November 2019, 100007.Agliassa et al. (2018). Geomagnetic field impacts on cryptochrome and phytochrome signaling. J Photochem Photobiol B. 2018 Aug;185:32-40. doi: 10.1016/j.jphotobiol.2018.05.027.Zhang et al. (2018). Characterization of peanut phytochromes and their possible regulating roles in early peanut pod development. PLoS One. 2018 May 25;13(5):e0198041. doi: 10.1371/journal.pone.0198041.
Special application note:
In vivo pull down assay for PhyA and western blot analysis of eluted proteins is described in Paik et al. (2012). Phytochrome regulates translation of mRNA in the cytosol. PNAS 109 (4): 1335-1340.
PhyB (Phytochrome B) is a Red/far-red photoreceptor involved in the regulation of de-etiolation. Protein exists in two inter-convertible forms: Pr and Pfr (active). Involved in the light-promotion of seed germination and in the shade avoidance response. Alternative names: Protein LONG HYPOCOTYL 3, Protein OUT OF PHASE 1, OOP1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabis alpina, Camelina sativa, Capsella rubella, Brassica napus, Brassica oleracea, Eutrema salsugineum, Raphanus sativusSpecies of your interest not listed? Contact us
Phytochrome is a photomorphogenically active pigment that modulates plant growth and development with respect to incident light intensity and wavelength distribution. It exists in two forms: an inactive, red-absorbing form (Pr),4 and an active far-red-absorbing form (Pfr). When either absorbs light, it is photoconverted to the other. Phytochrome is a dimeric, water-soluble, relatively labile chromoprotein with similar, if not identical, monomers of about 124 kDa each. It is also a relatively low abundance protein, even under the best of conditions. Genetic manipulation of phytochrome expression in plants leads to plants requiring less light and able to divert more energy to the production of fruits and seeds. For its physicochemical characterization, it has therefore been difficult to utilize techniques that require large quantitites of highly purified protein. Consequently, indirect methods for elucidating its structure/function relationships are especially important. These could also be applicable to fabaceae and closely related families.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at -80 C; Avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Mouse
Species Reactivity:
Avena sativa, Pisum sativum
Expected Species:
graminae, fabaceaeSpecies of your interest not listed? Contact us
Immunogen:
Phytochrome
Applications:
ELISA (ELISA), Competitive ELISA, Immunoflourescence (IF), Immunoprecipiation (IP), Western blot (WB)
Epitope for this antibody is located at 36 kDa from N-terminus and very near the site of chromophore attachment
Application Details:
assay dependent
Purity:
Cell culture supernatant
Molecular Weight:
124 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Pratt et al. (1988). Mapping of antigenic domains on phytochrome from etiolated Avena sativa L. by immunoblot analysis of proteolytically derived peptides. Arch Biochem Biophys. 267(2):723-35. doi: 10.1016/0003-9861(88)90081-1.Cordonnier et al. (1983). Production and purification of monoclonal antibodies to Pisum and Avena phytochrome. Planta. 158(4):369-76. doi: 10.1007/BF00397340.
PIF3 (Phytochrome interacting factor 3) is a transcription factor which acts positively in the phytochrome signaling pathway. It activates transcription by binding to the G box. Subcellular localization is nucleus. Alternative names:Basic helix-loop-helix protein 8, AtbHLH8, bHLH8, Phytochrome-associated protein 3, Phytochrome-interacting factor 3, Transcription factor EN 100, EN100, bHLH transcription factor bHLH008, PAP3, PHYTOCHROME-ASSOCIATED PROTEIN 3, POC1, PHOTOCURRENT 1,ABI1, ABA INSENSITIVE 1, AtABI1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles,Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Goat
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Cardamine hirsuta Species of your interest not listed? Contact us
PIF3 protein runs at higher MW than expected, as observed previously (Al-Sady et al. 2006). PIF proteins are not that stable, therefore special precautions should be taken during extraction and whole procedure should be performed in as little light as possible (light green light).
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
57 | ca, 65 kDa
Not reactive in:
Nicotiana attenuata
Selected references:
Sinclair et al. (2017) Etiolated Seedling Development Requires Repression of Photomorphogenesis by a Small Cell-Wall-Derived Dark Signal. Curr Biol. 2017 Nov 20;27(22):3403-3418.e7. doi: 10.1016/j.cub.2017.09.063.
Special application note:
Please, do not re-use PIF3 antibody solution after first incubation with your membrane as most of antibody will bind in this step and next result will not be reproducable
PIF4 (PHYTOCHROME INTERACTING FACTOR 4) is a transcription factor involved in the phytochrome B signaling pathway. Interacts with APRR1/TOC1 and PIF3 and binds to EGL2 and RGA. Alternative names: AtPIF4, Basic helix-loop-helix protein 9, AtbHLH9, bHLH 9, SRL2, Short under red-light 2, EN102, Transcription factor EN 102, bHLH transcription factor bHLH009.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles,Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Goat
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica napus, Brassica rapa, Camelina sativa, Eutrema salsugineumSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana PIF4, UniProt:Q8W2F3, TAIR:AT2G43010
Material used need to be up to 8 days old as detection in older rosette leaf may fail
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
48,3 | 60 kDa
Not reactive in:
Solanum lycopersicum
Selected references:
Fang et al. (2022) TANDEM ZINC-FINGER/PLUS3 regulates phytochrome B abundance and signaling to fine-tune hypocotyl growth. Plant Cell. 2022;34(11):4213-4231. doi:10.1093/plcell/koac236Bajracharya, Xi, Grace, et al. (2022) PHYTOCHROME-INTERACTING FACTOR 4/HEMERA-mediated thermosensory growth requires the Mediator subunit MED14. Plant Physiol. 2022;190(4):2706-2721. doi:10.1093/plphys/kiac412Agrawal et al. (2022) MEDIATOR SUBUNIT17 integrates jasmonate and auxin signaling pathways to regulate thermomorphogenesis. Plant Physiol. 2022 Aug 1;189(4):2259-2280. doi: 10.1093/plphys/kiac220. PMID: 35567489.Lee at al. (2021) Spatial regulation of thermomorphogenesis by HY5 and PIF4 in Arabidopsis. Nat Commun. 2021 Jun 16;12(1):3656. doi: 10.1038/s41467-021-24018-7. PMID: 34135347; PMCID: PMC8209091.Lee, Paik & Huq. (2020). SPAs promote thermomorphogenesis by regulating the phyB-PIF4 module in Arabidopsis. Development. 2020 Oct 8;147(19):dev189233. doi: 10.1242/dev.189233. PMID: 32994167; PMCID: PMC7561471.
Special application note:
PIF proteins are not that stable, therefore special precautions should be taken during extraction and whole procedure should be performed in as little light as possible (light green light). Extraction of PIF proteins is described in Shen et al. (2007).
PIF4 (PHYTOCHROME INTERACTING FACTOR 4) is a transcription factor involved in the phytochrome B signaling pathway. Interacts with APRR1/TOC1 and PIF3 and binds to EGL2 and RGA. Alternative names: AtPIF4, Basic helix-loop-helix protein 9, AtbHLH9, bHLH 9, SRL2, Short under red-light 2, EN102, Transcription factor EN 102, bHLH transcription factor bHLH009.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana PIF4, UniProt: Q8W2F3, TAIR:AT2G43010
Applications:
Chromatin Immunoprecipitation (ChIP), Western blot (WB)
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Gras et al. (2020). Arabidopsis Thaliana SURFEIT1-like Genes Link Mitochondrial Function to Early Plant Development and Hormonal Growth Responses. Plant J . 2020 Apr 5. doi: 10.1111/tpj.14762.Ferrero et al. (2019). Class I TCP transcription factors target the gibberellin biosynthesis gene GA20ox1 and the growth promoting genes HBI1 and PRE6 during thermomorphogenic growth in Arabidopsis. Plant Cell Physiol. 2019 Jul 11. pii: pcz137. doi: 10.1093/pcp/pcz137.Hwang et al. (2019). Trehalose-6-phosphate signaling regulates thermoresponsive hypocotyl growth in Arabidopsis thaliana. EMBO Rep. 2019 Aug 8:e47828. doi: 10.15252/embr.201947828.
Special application note:
PIF proteins are very unstable, therefore special precautions should be taken during extraction and whole procedure should be performed in the dark and with as little light as possible (green light only). Extraction of PIF proteins is described in Shen et al. (2007).This product can be sold containing ProClin if requested.
PIF5 (Phytochrome interacting factor 5) is a transcription factor which acts negatively in the phytochrome B signaling pathway and regulates PHYB at post-transcriptional level. Alternative protein names: AtbHLH65, bHLH65, bHLH065, Basic helix-loop-helix protein 65, PHYTOCHROME INTERACTING FACTORAS12 2112 3-LIKE 6, PIL6, Phytochrome interacting factor-like 6, Transcription factor EN 103.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
For detection of PIF5 please use the most sensitive detection reagent
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
49.3 | 62 kDa
Not reactive in:
Physcomitrella patens, Solanum lycopersicum
Selected references:
Pham et al. (2018). Dynamic regulation of PIF5 by COP1-SPA complex to optimize photomorphogenesis in Arabidopsis. Plant J. 2018 Aug 25. doi: 10.1111/tpj.14074.
Special application note:
PIF proteins are not that stable, therefore special precautions should be taken during extraction and whole procedure should be performed in as little light as possible (light green light). Extraction of PIF proteins is described in Shen et al. (2007).
Pig purified IgG contains Protein A purified pig IgG from normal serum, e.g. serum of non immunized animals and is excellent for use as blocking reagent in immunoassays.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Pig Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Pig Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C. For storage at 2-8 C, add a preservative to prevent growth of bacteria.This product is used as a blocking reagent or control for
Purified serum, lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2.
Special application note:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 C. Centrifuge reconstituted serum to remove any precipitates.This product is used as a blocking reagent or control for most immunoassay applications.
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C. For storage at 2-8 C, add a preservative to prevent growth of bacteria.This product is used as a blocking reagent or control for
After opening the vial, the lyophilized content is reconstituted by adding 1 ml of sterile distilled water, mixed gently by inversion until complete dissolution is obtained, Allow to stand at ambient temperature for 5-10 minutes to reach equilibrium, Reconstituted serum may be stored frozen
Special application note:
This normal serum can be used as an internal relative standard for quantitative protein assays such as double radial immunodiffusion (Mancini, Fahey), ELISA, Western blot and electroimmunodiffusion (Laurell). The product can be also applied as a blocking or negative control in non-precipitating antibody binding assays as immunofluorescence.Normal pig serum was obtained from healthy animals of European origin.
Normal pig (swine) serum lipid extracted and dialyzed against 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2. This product is used as a blocking reagent or control for most immunoassay applications.
Product Type:
Antibody
Format:
Lyophilized
Storage Temp:
Store lyophilized material at 2-8°C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C. For storage at 2-8 C, add a preservative to prevent growth of bacteria. Rehydrate with 10,0 ml of deionized water. Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Protein concentration is 60,0 mg/ml (Bradford, IgG standards), Antibody is supplied in 10 mM sodium phosphate, 0,15 M sodium chloride, pH 7,2, No preservative is added
Arabidopsis thaliana auxin efflux carrier component AtPIN2 encoded by the AtPIN2 gene (also known as EIR1 and AGR1). AtPIN proteins are asymmetrically localized within plant plasma membranes and mediate polar auxin transport. AtPIN2 is a key regulator of the response of Arabidopsis roots to gravity. Alternative names: Auxin efflux carrier AGR, Ethylene-insensitive root 1, AtEIR1, Polar-auxin-transport efflux component AGR1, Protein AGRAVITROPIC 1, AtAGR1, Protein WAVY 6.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Beta vulgaris, Brassica napus, Camelina sativa, Cannabis sativa, Capsella rubella, Cucumis melo, Eucalyptus grandis, Eutrema salsugineum, Glycine max, Malus domestica, Morus notabilis, Prunus dulcis, Raphanus sativus, Spinacia oleracea, Vitis vinifera Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated mixture of two synthetic peptides derived from AtPIN2 sequence, UniProt:Q9LU77, TAIR:At5g57090
Plasma membrane aquaporin, PIP2;7 is water channel protein required for water transport across cell membrane. Alternative names: plasma membrane intrinsic protein 2-7, AtPIP2;7, plasma membrane intrinsic protein 3, salt stress-induced major intrinsic protein, PIP3a
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Detection pattern consists of di and monomer of PIP2-7.This antibody has a potential to work in immunolocalization studies, as it is recognizing C-terminal part of the sequence.This product can be sold containing ProClin if requested.
Application Details:
1 : 600 (IP), 1: 3000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
30.7 | 30 kDa (Zea mays)
Not reactive in:
Hordeum vulgare
Selected references:
Kumar et al. (2022). Proteomic dissection of rice cytoskeleton reveals the dominance of microtubule and microfilament proteins, and novel components in the cytoskeleton-bound polysome, Plant Physiology and Biochemistry, Volume 170,2022,Pages 75-86,ISSN 0981-9428, https://doi.org/10.1016/j.plaphy.2021.11.037.
PIPs proteins are aquaporins which facilitate the transport of water and small neutral molecules across the cell membrane. Alternative names: PIP1-1, PIP1-2, PIP1-3, plasma membrane intrinsic protein 1a, 1b, 1c, PIP1a, PIP1b, PIP1c, plasma membrane aquaporin-1, transmembrane protein A, TMP-A, AthH2, transmembrane protein B, TMP-B,
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Brassica sp., Jatropha curcas L. cv. Biji Jarak , Mesembryantheum crystallinum, Populus nigra, Populus trichocarpa, Raphanus sativus, Setaria viridis, Thellungiella salsuginea
Expected Species:
Brassica sp., Hordeum vulgare, Juglans regia, Nicotiana tabacum, Oryza sativa, Populus tremula, Triticum aestivum, Vicia fabaSpecies of your interest not listed? Contact us
Protein or membrane sample should be treated at 70 C for 10 min before loading on the gel.
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
30,68 | 28 kDa
Not reactive in:
Fragaria sp., Spinacia oleracea
Selected references:
Chen et al. (2022) Elucidating the role of SWEET13 in phloem loading of the C4 grass Setaria viridis. Plant J. 2022 Feb;109(3):615-632. doi: 10.1111/tpj.15581. Epub 2021 Dec 12. PMID: 34780111.Jang et al. (2013). Twoaquaporins of Jatropha are regulated differentially during drought stress and subsequent recovery. J Plant Physiol. March 25.Lopez et al. (2013). Aquaporins And Leaf Hydraulics, Poplar Sheds New Light. Plant Cell Physiol. Sep 20.
Special application note:
Antibodies will detect target protein in a few µg of a crude preparation loaded per well. If purified preparations of vacuolar and plasma membranes are used, one µg load per well should be sufficient
PIPs proteins are aquaporins which facilitate the transport of water and small neutral molecules across cell membrane. Alternative names: PIP1-1, PIP1-2, PIP1-3, plasma membrane intrinistic protein 1a, 1b, 1c, PIP1a, PIP1b, PIP1c, plasma membrane aquaporin-1, transmembrane protein A, TMP-A, AthH2, transmembrane protein B, TMP-B,
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Brassica sp., Jatropha curcas L. cv. Biji Jarak , Mesembryantheum crystallinum, Populus nigra, Populus trichocarpa, Raphanus sativus, Thellungiella salsuginea
Expected Species:
Brassica sp., Hordeum vulgare, Juglans regia, Oryza sativa, Populus tremula, Triticum aestivum, Vicia faba Species of your interest not listed? Contact us
Protein or membrane sample should be treated at 70 C for 10 min before loading on the gel.
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to ALP.
Molecular Weight:
30,68 | 28 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Antibodies will detect target protein in a few µg of a crude preparation loaded per well. If purified preparations of vacuolar and plasma membranes are used, one µg load per well should be sufficient
PIPs proteins are aquaporins which facilitate the transport of water and small neutral molecules across cell membrane. Alternative names: PIP1-1, PIP1-2, PIP1-3, plasma membrane intrinistic protein 1a, 1b, 1c, PIP1a, PIP1b, PIP1c, plasma membrane aquaporin-1, transmembrane protein A, TMP-A, AthH2, transmembrane protein B, TMP-B,
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Brassica sp., Jatropha curcas L. cv. Biji Jarak , Mesembryantheum crystallinum, Populus nigra, Populus trichocarpa, Raphanus sativus, Thellungiella salsuginea
Expected Species:
Brassica sp., Hordeum vulgare, Juglans regia, Oryza sativa, Populus tremula, Triticum aestivum, Vicia fabaSpecies of your interest not listed? Contact us
Protein or membrane sample should be treated at 70 C for 10 min before loading on the gel.
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to biotin.
Molecular Weight:
30,68 | 28 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Antibodies will detect target protein in a few µg of a crude preparation loaded per well. If purified preparations of vacuolar and plasma membranes are used, one µg load per well should be sufficient
PIPs proteins are aquaporins which facilitate the transport of water and small neutral molecules across the cell membrane. Alternative names: PIP1-1, PIP1-2, PIP1-3, plasma membrane intrinsic protein 1a, 1b, 1c, PIP1a, PIP1b, PIP1c, plasma membrane aquaporin-1, transmembrane protein A, TMP-A, AthH2, transmembrane protein B, TMP-B.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Brassica sp,, Jatropha curcas L, cv, Biji Jarak , Mesembryantheum crystallinum, Populus nigra, Populus trichocarpa, Raphanus sativus, Thellungiella salsuginea
Expected Species:
Brassica sp., Hordeum vulgare, Juglans regia, Nicotiana tabacum, Oryza sativa, Populus tremula, Triticum aestivum, Vicia fabaSpecies of your interest not listed? Contact us
Protein or membrane sample should be treated at 70 C for 10 min before loading on the gel.
Application Details:
To be determined by end user.
Purity:
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 488.
Molecular Weight:
30,68 | 28 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known.
Selected references:
To be added when available. Antibody released in May 2023.
Special application note:
Antibodies will detect target protein in a few µg of a crude preparation loaded per well. If purified preparations of vacuolar and plasma membranes are used, one µg load per well should be sufficient.DyLight 488 Amax = 493 nm, Emax = 519 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
PIPs proteins are aquaporins which facilitate the transport of water and small neutral molecules across the cell membrane, Alternative names: PIP1-1, PIP1-2, PIP1-3, plasma membrane intrinsic protein 1a, 1b, 1c, PIP1a, PIP1b, PIP1c, plasma membrane aquaporin-1, transmembrane protein A, TMP-A, AthH2, transmembrane protein B, TMP-B.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Brassica sp,, Jatropha curcas L, cv, Biji Jarak , Mesembryantheum crystallinum, Populus nigra, Populus trichocarpa, Raphanus sativus, Thellungiella salsuginea
Expected Species:
Brassica sp., Hordeum vulgare, Juglans regia, Nicotiana tabacum, Oryza sativa, Populus tremula, Triticum aestivum, Vicia fabaSpecies of your interest not listed? Contact us
Protein or membrane sample should be treated at 70 C for 10 min before loading on the gel,
Application Details:
To be determined by end user.
Purity:
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 594.
Molecular Weight:
30,68 | 28 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known,
Selected references:
To be added when available. Antibody released in May 2023.
Special application note:
Antibodies will detect target protein in a few µg of a crude preparation loaded per well. If purified preparations of vacuolar and plasma membranes are used, one g load per well should be sufficient.DyLight 594 has Amax = 593 nm, Emax = 618 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
PIPs proteins are aquaporins which facilitate the transport of water and small neutral molecules across the cell membrane. Alternative names: PIP1-1, PIP1-2, PIP1-3, plasma membrane intrinsic protein 1a, 1b, 1c, PIP1a, PIP1b, PIP1c, plasma membrane aquaporin-1, transmembrane protein A, TMP-A, AthH2, transmembrane protein B, TMP-B.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Brassica sp,, Jatropha curcas L, cv, Biji Jarak , Mesembryantheum crystallinum, Populus nigra, Populus trichocarpa, Raphanus sativus, Thellungiella salsuginea
Expected Species:
Brassica sp., Hordeum vulgare, Juglans regia, Nicotiana tabacum, Oryza sativa, Populus tremula, Triticum aestivum, Vicia fabaSpecies of your interest not listed? Contact us
Protein or membrane sample should be treated at 70 C for 10 min before loading on the gel.
Application Details:
To be determined by end user.
Purity:
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 650.
Molecular Weight:
30,68 | 28 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known.
Selected references:
To be added when available. Antibody released in May 2023.
Special application note:
Antibodies will detect target protein in a few µg of a crude preparation loaded per well. If purified preparations of vacuolar and plasma membranes are used, one g load per well should be sufficient.DyLight 650 has Amax = 652 nm, Emax = 672 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
PIPs proteins are aquaporins which facilitate the transport of water and small neutral molecules across cell membrane. Alternative names: PIP1-1, PIP1-2, PIP1-3, plasma membrane intrinistic protein 1a, 1b, 1c, PIP1a, PIP1b, PIP1c, plasma membrane aquaporin-1, transmembrane protein A, TMP-A, AthH2, transmembrane protein B, TMP-B,
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Brassica sp., Jatropha curcas L. cv. Biji Jarak , Mesembryantheum crystallinum, Populus nigra, Populus trichocarpa, Raphanus sativus, Thellungiella salsuginea
Expected Species:
Brassica sp., Hordeum vulgare, Juglans regia, Oryza sativa, Populus tremula, Triticum aestivum, Vicia faba Species of your interest not listed? Contact us
Protein or membrane sample should be treated at 70 C for 10 min before loading on the gel.
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to HRP.
Molecular Weight:
30,68 | 28 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Antibodies will detect target protein in a few µg of a crude preparation loaded per well. If purified preparations of vacuolar and plasma membranes are used, one µg load per well should be sufficient
The PLAP [IHC088] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Applications:
IHC
Clone number:
IHC088
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Placenta
Buffer:
Tris Buffer, pH 7.3 - 7.7, with 1% BSA and <0.1% Sodium Azide
The PLAP [IHC088] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Applications:
IHC
Clone number:
IHC088
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Placenta
Buffer:
Tris Buffer, pH 7.3 - 7.7, with 1% BSA and <0.1% Sodium Azide
The PLAP [IHC088] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Applications:
IHC
Clone number:
IHC088
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Placenta
Buffer:
Tris Buffer, pH 7.3 - 7.7, with 1% BSA and <0.1% Sodium Azide
Affinity purified using solid phase human plasminogen. Antibody concentration is > 4.5 mg/ml (E 1% at 280 nm = 13.0).Antibody is supplied in 10 mM sodium phosphate, 0.15 M sodium chloride, pH 7.2. Contains 0.05% (w/v) sodium azide as preservative. Antibody purity is > 95% based on SDS-PAGE.
Application Details:
The optimal working dilution should be determined by the investigator
Purity:
Immunogen Affinity purified using solid phase human Plasminogen.
Molecular Weight:
95 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Plastid acyl-ACP desaturase, coded by FAB2 gene is involved in fatty acid metabolism in Chlamydomonas reinhardtii. It displays acyl-[acyl-carrier-protein] desaturase activity.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Expected Species:
Volvox carteri Species of your interest not listed? Contact us
Immunogen:
putative mature form of Chlamydomonas reinhardtii plastid acyl-ACP desaturase expressed in E.coli, UniProt: A8IQB8
PLDA1/2 (phospholipase D alpha 1/2) is an enzyme which hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond and plays an important tole in processes as phytochormone action and response to stress. This protein is highly expressed in roots, stems and flowers, moderately in leaves, seedlings and siliques. Not detected in seeds. Induced by ABA, ethylene, heavy metal, cold, salt and osmotic stresses. Alternative names:PLDalpha1,PLD alpha 1,Choline phosphatase 1 PLDalpha, Phosphatidylcholine-hydrolyzing phospholipase D 1, Choline phosphatase 2, Phosphatidylcholine-hydrolyzing phospholipase D 2, PLDalpha2, PLD alpha 2.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Brassica oleracea
Expected Species:
Brassica napus, Brassica rapa, Capsella rubella, Carica papaya, Gossypium hirsutum, Glycine max, Ricinus communisSpecies of your interest not listed? Contact us
Kocourkova et al. (2020). Phospholipase Da1 mediates the high-Mg2+ stress response partially through regulation of K+ homeostasis. Plant Cell Environ. 2020 Jun 25.doi: 10.1111/pce.13831.
PLGG1 (Plastidal glycolate/glycerate translocator) is a glycolate/glycerate transporter protein required for photorespiration Alternative names of protein: AtLrgB, LrgB, PLGG
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Nicotiana tabacum
Expected Species:
Arabidopsis thaliana, Noccaea caerulescensSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana UniProt: Q9FVQ4
Experimental contitions: 5 g of total protein extracted freshly from 3-4 weeks old plant leaves with a blender at 4 C in 300 mM Sorbitol, 50 mM HEPES, 5mM MgCl2. Separated on 10 % SDS-PAGE and blotted 1h to PVDF, semi-dry. Blot was blocked with 6 % milk for 1h 4 C with agitation. Blot was incubated in the primary antibody at a dilution of 1: 1 000 ON at 4 C with agitation. According to South et. al (2019).
Plus RIPA Lysis Buffer reagent is a complete cell lysis reagent popularly used for cultured mammalian cells. Plus RIPA lysis buffer is highly compatible with immunoassays, protein purification procedures, immunoprecipitation, and western blotting.
Postmeiotic Segregation Increased 2 (PMS2) is a DNA repair protein involved in mismatch repair. Mutations and deficiencies in the PMS2 gene have been linked to microsatellite instability and malignancies such as hereditary nonpolyposis colorectal cancer and endometrial cancer. Expression levels of the PMS2 protein may be useful as a screening tool for Lynch syndrome after a colorectal cancer diagnosis. Anti-PMS2 is recommended to be used as part of a panel along with antibodies against MSH2, MSH6, and MLH1.
Postmeiotic Segregation Increased 2 (PMS2) is a DNA repair protein involved in mismatch repair. Mutations and deficiencies in the PMS2 gene have been linked to microsatellite instability and malignancies such as hereditary nonpolyposis colorectal cancer and endometrial cancer. Expression levels of the PMS2 protein may be useful as a screening tool for Lynch syndrome after a colorectal cancer diagnosis. Anti-PMS2 is recommended to be used as part of a panel along with antibodies against MSH2, MSH6, and MLH1.
Postmeiotic Segregation Increased 2 (PMS2) is a DNA repair protein involved in mismatch repair. Mutations and deficiencies in the PMS2 gene have been linked to microsatellite instability and malignancies such as hereditary nonpolyposis colorectal cancer and endometrial cancer. Expression levels of the PMS2 protein may be useful as a screening tool for Lynch syndrome after a colorectal cancer diagnosis. Anti-PMS2 is recommended to be used as part of a panel along with antibodies against MSH2, MSH6, and MLH1.
PntA (Slr1239) (Pyridine nucleotide transhydrogenase alpha-subunit) is an integral mambrane protein complex which participates in the regulation of ion of NAD(P)+:NAD(P)H redox homeostasis. Functional enzyme is a dimer of PntA and PntB.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Synechocystis sp. PCC6803
Expected Species:
Bacillus subtilis, Cyanothece sp. PCC 7822, Desulfobulbaceae bacterium BRH_c16a, Elusimicrobia bacterium, Fischerella sp. JSC-11, Hapalosiphon sp. MRB220, Magnetococcus marinus, Moorea producens JHB , Pleurocapsa sp. PCC 7327, Stanieria cyanosphaera Species of your interest not listed? Contact us
K m r inen et al. (2017). Pyridine nucleotide transhydrogenase PntAB is essential for optimal growth and photosynthetic integrity under low-light mixotrophic conditions in Synechocystis sp. PCC 6803. New Phytol. 2017 Apr;214(1):194-204. doi: 10.1111/nph.14353.
Podoplanin is a transmembrane mucoprotein specifically expressed in the endothelium of lymphatic capillaries, while remaining absent from the blood vasculature. The protein is co-localized with VEGFR3/FLT4 in normal skin and kidney. Anti-Podoplanin is useful in the identification of lymphangiomas, Kaposi's sarcomas, epithelioid mesotheliomas, hemangioblastomas, seminomas, and some angiosarcomas that likely have lymphatic differentiation.
Podoplanin is a transmembrane mucoprotein specifically expressed in the endothelium of lymphatic capillaries, while remaining absent from the blood vasculature. The protein is co-localized with VEGFR3/FLT4 in normal skin and kidney. Anti-Podoplanin is useful in the identification of lymphangiomas, Kaposi's sarcomas, epithelioid mesotheliomas, hemangioblastomas, seminomas, and some angiosarcomas that likely have lymphatic differentiation.
Podoplanin is a transmembrane mucoprotein specifically expressed in the endothelium of lymphatic capillaries, while remaining absent from the blood vasculature. The protein is co-localized with VEGFR3/FLT4 in normal skin and kidney. Anti-Podoplanin is useful in the identification of lymphangiomas, Kaposi's sarcomas, epithelioid mesotheliomas, hemangioblastomas, seminomas, and some angiosarcomas that likely have lymphatic differentiation.
E. coli DNA polymerase 1 (928 aa; 103 kDa) is encoded by polA gene and involved in DNA replication and repair. In addition to polymerase activity, this DNA polymerase exhibits 3' to 5' and 5' to 3' exonuclease activity. It is able to utilize nicked circular duplex DNA as a template and can unwind the parental DNA strand from its template.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at -20 °C; make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Escherichia coli
Expected Species:
Species of your interest not listed? Contact us
Immunogen:
Purified, full length, recombinant POL I protein from E.coli, UniProt: P00582
Alpha-fetoprotein (AFP) is a fetal tumor-associated polypeptide of the albuminoid gene family that binds and transports molecules in addition to many other proposed functions. This secretory protein is synthesized primarily in the fetal liver whereas expression is repressed in adult liver.Anti-AFP has been immunohistochemically demonstrated in hepatocellular carcinoma (HCC) and shows no immunoreactivity in normal liver.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Mizejewski GJ et al. Exp Biol Med. 2001; 226:377-408
References 2:
Lazarevich NL et al.Biochemistry (Mosc). 2000; 65:117-33
References 3:
Yusof YA, et al. Anal Quant Cytol Histol. 2003; 25:332-8
The immunohistochemical staining of Alpha-1-Antitrypsin is considered to be very useful in the study of inherited AAT deficiency, benign and malignant hepatic tumors and yolk sac carcinomas. Positive staining for A-1-Antitrypsin may also be used in detection of benign and malignant lesions of an histiocytic nature. Sensitivity and specificity of the results have made this antibody a useful tool in the screening of patients with cryptogenic cirrhosis or other forms of liver disease with portal fibrosis of uncertain etiology.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Callea F, et al. J Hepatol. 1986; 2:389-401
References 2:
Palmer PE, et al.Am J Clin Pathol. 1974; 62:350-4
References 3:
Palmer PE, et al. Cancer. 1980; 45:1424-31
References 4:
Raintoft I, et al. Hum Pathol. 1979; 10:419-24
References 5:
Ramsay AD, et al. Appl Immunohistochem Mol Morphol. 2008; 16:140-7
ACTH or Adrenocorticotropic hormone is synthesized from pre-pro-opiomelanocortin (pre-POMC). ACTH is produced and secreted from corticotrophs in the anterior lobe (or adenohypophysis) of the pituitary gland. The anti-ACTH immunohistochemical reagent could be useful in the study of neoplastic and non-neoplastic pituitary diseases
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Pizarro CB, et al. Braz J Med Biol Res. 2004; 37:235-43
References 2:
Kageyama K, et al. Am J Med Sci. 2002; 324:326-30
References 3:
Fan X, et al. J Histochem Cytochem. 2002; 50:1509- 16
References 4:
Japon MA, et al. J Clin Endocrinol Metab. 2002; 87:1879-84
Alpha-fetoprotein (AFP) is a fetal tumor-associated polypeptide of the albuminoid gene family that binds and transports molecules in addition to many other proposed functions. This secretory protein is synthesized primarily in the fetal liver whereas expression is repressed in adult liver.Anti-AFP has been immunohistochemically demonstrated in hepatocellular carcinoma (HCC) and shows no immunoreactivity in normal liver.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Mizejewski GJ et al. Exp Biol Med. 2001; 226:377-408
References 2:
Lazarevich NL et al.Biochemistry (Mosc). 2000; 65:117-33
References 3:
Yusof YA, et al. Anal Quant Cytol Histol. 2003; 25:332-8
Complement component C3 plays a central role in the activation of complement system. Its activation is required for both classical and alternative complement activation pathways. C3d deposition in the renal transplant PTCs (peritubular capillaries) is indicative of AR (acute rejection) with subsequent high probability of graft loss. Anti-C3d, combined with anti-C4d, can be utilized as a tool for diagnosis of AR and warrant prompt and aggressive anti-rejection treatment. In another study, Pfaltz et al. have shown that anti-C3d labeled the epidermal basement membrane in 97% (31/32) cases of bullous pemphigoid (BP), with none of the normal controls demonstrating such findings. In the same study 27% (3/11) cases of pemphigus vulgaris (PV) demonstrated intercellular C3d deposition. Therefore, C3d immunohistochemistry is a helpful adjunct in the diagnosis of BP (and perhaps PV), especially in the cases in which only formalin-fixed, paraffin embedded tissue is available for analysis.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Bickerstaff A, et al. Am J Pathol. 2008; 173:347-57
References 2:
Kuypers DR, et al. Transplantation. 2003; 76:102-8
C4d is a stable split product remnant of classical complement activation which becomes covalently bound to endothelium and basement membrane, after induction of the classical antibody-induced pathway. As an established marker of antibody-mediated acute renal allograft rejection and its proclivity for endothelium, this component can be detected in peritubular capillaries in both chronic renal allograft rejection as well as hyperacute rejection, acute vascular rejection, acute cellular rejection, and borderline rejection. It has been shown to be a significant predictor of transplant kidney graft survival and is an aid in treating acute rejection.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Jianghua C, et al. Clin Transplant. 2005; 19:785-91
References 2:
Kayler LK, et al. Transplantation. 2008; 85:813-20
References 3:
Ranjan P, et al. Nephrol Dial Transplant .2008; 23:1735-41
References 4:
Seemayer CA, et al. Nephrol Dial Transplant. 2007; 22:568-76
References 5:
Bouron-Dal Soglio D, et al. Hum Pathol. 2008; 39:1103-10
Immunohistochemical staining with anti-calcitonin antibody has proven to be an effective way of demonstrating calcitonin-producing cells in the thyroid. C-cell hyperplasia and medullary thyroid carcinomas stain positive for calcitonin. Studies of calcitonin have resulted in the identification of a wide spectrum of C-cell proliferative abnormalities.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Matias-Guiu X, et al. Endocr Pathol. 2014; 25:21-9
References 2:
Fisher S, et al. Arch Pathol Lab Med. 2008;132:359-72
Anti-CD3 antibody has been considered the best all around T-cell marker. This antibody reacts with an antigen present in early thymocytes. The positive staining of this marker may represent a sign of early commitment to the T-cell lineage.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Beverley PC, et al. Eur J Immunol. 1981; 11:329-34
References 2:
Clevers H, et al. Eur J Immunol. 1988; 18:705-10
References 3:
Hedvat CV, et al. Hum Pathol. 2002; 33:968-74
References 4:
Karube K, et al. Am J Surg Pathol. 2003; 27:1366-74
Anti-CEA specifies a group of proteins in the Carcinoembryonic Antigen (CEA) family of proteins which are present in the epithelia of various types and tumors (both benign and malignant) derived from such epithelia. Such tissues are represented by the epithelia of colon, bronchus, alveoli, breast, pancreas, biliary tract, superficial layer and parietal layers of the stomach. Predominately biliary canaliculi are labelled in the liver and this factor is useful in the diagnosis of hepatocelluar carcinoma. Anti-CEA has been quite useful in differentiating adenocarcinoma of the lung vs. mesothelioma. Associated products: CK 5/6, Calretinin, WT-1, E-Cadherin, TTF-1, TAG-72, EMA, CK 20
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Shield PW, et al. Am J Clin Pathol. 1996; 105:157-62
References 2:
Sheahan K, et al. Am J Clin Pathol. 1990; 94:157-64
Anti-Factor VIII-Related Antigen antibody reacts with endothelial cells and neoplastic blood cells. This antibody has helped to establish the endothelial nature of some lesions of disputed histogenesis, e.g. Kaposis sarcoma and cardiac myxoma. Not all endothelial cells synthesize (or store) this molecule; therefore, it should not be surprising that not all tumors of endothelial differentiation (benign or malignant) react with this antigen.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Nichols GE, et al. Am J Clin Pathol. 1992; 97:770-5
References 2:
Falk S, et al. Am J Surg Pathol. 1993; 17:959-70
References 3:
Meis-Kindblom JM, et al. Am J Surg Pathol. 1998; 22:683-97
References 4:
Allison KH, et al. Am J Surg Pathol. 2004; 28:298-307
References 5:
Peyvandi F, et al. Blood Transfus. 2011; 9 Suppl 2:s3-8
Anti-FSH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with FSH-producing cells (gonadotrophs).
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Baenziger JU, et al. Biochim Biophys Acta. 1988; 947:287-306
References 2:
Nussey SS, et al. BIOS Scientific Publishers Ltd; 2001 p. 217-79
References 3:
Uccella S, et al. Pituitary. 2000; 3:131-9
References 4:
Schmid M, et al. Pathol Res Pract. 2001; 197:663-9
Anti-FSH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with FSH-producing cells (gonadotrophs).
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Baenziger JU, et al. Biochim Biophys Acta. 1988; 947:287-306
References 2:
Nussey SS, et al. BIOS Scientific Publishers Ltd; 2001 p. 217-79
References 3:
Uccella S, et al. Pituitary. 2000; 3:131-9
References 4:
Schmid M, et al. Pathol Res Pract. 2001; 197:663-9
Anti-Gastrin antibody gives positive staining of G-cells of human antral/pyloric mucosa and cells producing gastrin or a structural gastrin analogue as is seen in stomach; no staining of other cells or tissue types has been observed. This antibody may react with sulfated and non-sulfated forms of gastrin. The antibody cross-reacts with more than 50% of the present choleocystokinin octapeptide.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Kasacka W, et al. Folia Morphol. 2012; 71:39-44.
References 2:
Hur K, et al. J Cancer Res Clin Oncol. 2006; 132:85-91
References 3:
Waldum et al. Frontiers in Endocrinology. 2017; 8:1-7
Anti-Gastrin antibody gives positive staining of G-cells of human antral/pyloric mucosa and cells producing gastrin or a structural gastrin analogue as is seen in stomach; no staining of other cells or tissue types has been observed. This antibody may react with sulfated and non-sulfated forms of gastrin. The antibody cross-reacts with more than 50% of the present choleocystokinin octapeptide.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Kasacka W, et al. Folia Morphol. 2012; 71:39-44.
References 2:
Hur K, et al. J Cancer Res Clin Oncol. 2006; 132:85-91
References 3:
Waldum et al. Frontiers in Endocrinology. 2017; 8:1-7
Anti-GH is a useful marker in classification of pituitary tumors and the study of pituitary disease (acromegaly). It reacts with GH-producing cells. Growth hormone receptors have been found in various non-pituitary cells, including that from hepatocellular carcinoma and various benign and malignant cutaneous lesions.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Rezaei M, et al. J Res Med Sci. 2012; 17:681-5
References 2:
Al-Brahim NY, et al. J Clin Pathol. 2006; 59:1245-53
References 3:
Fukaya T, et al. Cancer. 1980; 45:1598-1603
References 4:
Kovacs K, et al. Virch Arch Pathol Anat. 1982; 395:59-68
Anti-GH is a useful marker in classification of pituitary tumors and the study of pituitary disease (acromegaly). It reacts with GH-producing cells. Growth hormone receptors have been found in various non-pituitary cells, including that from hepatocellular carcinoma and various benign and malignant cutaneous lesions.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Rezaei M, et al. J Res Med Sci. 2012; 17:681-5
References 2:
Al-Brahim NY, et al. J Clin Pathol. 2006; 59:1245-53
References 3:
Fukaya T, et al. Cancer. 1980; 45:1598-1603
References 4:
Kovacs K, et al. Virch Arch Pathol Anat. 1982; 395:59-68
Anti-Glucagon antibody detects glucagon-secreting cells and tumors such as glucagonomas. Studies show that approximately 80% of glucagonomas are malignant and these patients have a syndrome often initially recognized by dermatologists. Symptoms include necrolytic migratory erythema as well as diabetes, anemia, stomatitis, weight loss, frequent venous thromboses, and in some instances, diarrhea and psychiatric disturbances. The diagnosis may be readily confirmed by the demonstration of elevated plasma glucagon concentration.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Quesada I, et al. J Endocrinol. 2008; 199:5-19
References 2:
Gurlo T, et al. J Histotechnol. 2016; 39:8-16
References 3:
Wewer Albrechtsen NJ, et al. Biomark Med. 2016; 10:1141-51
Anti-Glucagon antibody detects glucagon-secreting cells and tumors such as glucagonomas. Studies show that approximately 80% of glucagonomas are malignant and these patients have a syndrome often initially recognized by dermatologists. Symptoms include necrolytic migratory erythema as well as diabetes, anemia, stomatitis, weight loss, frequent venous thromboses, and in some instances, diarrhea and psychiatric disturbances. The diagnosis may be readily confirmed by the demonstration of elevated plasma glucagon concentration.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Quesada I, et al. J Endocrinol. 2008; 199:5-19
References 2:
Gurlo T, et al. J Histotechnol. 2016; 39:8-16
References 3:
Wewer Albrechtsen NJ, et al. Biomark Med. 2016; 10:1141-51
Glucose transporter type I (GLUT1), a prototype member of GLUT super family, reacts with a 55 kD protein, is a membrane-associated erythrocyte glucose transport protein. It is a major glucose transporter in the mammalian blood-brain barrier, and also mediates glucose transport in endothelial cells of the vasculature, adipose tissue and cardiac muscle. GLUT1 is detectable in many human tissues including those of colon, lung, stomach, esophagus, and breast. GLUT1 is overexpressed in malignant cells and in a variety of tumors that include the breast, pancreas, cervix, endometrium, lung, mesothelium, colon, bladder, thyroid, bone, soft tissues, and oral cavity. Immuohistochemical detection of GLUT1 can discriminate between reactive mesothelium and malignant mesothelioma. Anti-GLUT1 with anti-Claudin1, and anti-EMA are perineurial markers in diagnosis of perineuriomas. Anti-GLUT1 is also useful in distinguishing benign endometrial hyperplasia from atypical endometrial hyperplasia and adenocarcinoma. GLUT1 expression has been associated with increased malignant potential, invasiveness, and a poor prognosis in general. Expression of GLUT1 is a late event in colorectal cancer and expression in a high proportion of cancer cells is associated with a high incidence of lymph node metastases.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Kato Y, et al. Mod Pathol. 2006; 20:215-20
References 2:
Afify A, et al. Acta Cytol. 2005; 49:621-6
References 3:
Parente P, et al. J Exp Clin Cancer Res. 2008; 27:34
Granzymes are serine proteases which are stored in specialized lytic granules of cytotoxic T lymphocytes and in natural killer cells. Anti-Granzyme B has been useful in diagnosing Natural killer/T cell lymphoma, as well as anaplastic large cell lymphoma. High percentages of cytotoxic T cells have been shown to be an unfavorable prognostic indicator in Hodgkins disease.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Kummer JA, et al. Clin Exp Immunol. 1995; 100:164-72
hCG is a protein secreted in large quantities by normal trophoblasts; the antibody detects cells and tumors of trophoblastic origin such as Choriocarcinoma. Large Cell Carcinoma and Adenocarcinoma of Lung demonstrate hCG positivity in 90% and 60% of cases respectively. 20% of Squamous Cell Lung Carcinomas are positive for hCG. hCG expression by nontrophoblastic tumors may indicate aggressive behavior since it has been observed that hCG may play a role in the host response to a given tumor.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
hCG is a protein secreted in large quantities by normal trophoblasts; the antibody detects cells and tumors of trophoblastic origin such as Choriocarcinoma. Large Cell Carcinoma and Adenocarcinoma of Lung demonstrate hCG positivity in 90% and 60% of cases respectively. 20% of Squamous Cell Lung Carcinomas are positive for hCG. hCG expression by nontrophoblastic tumors may indicate aggressive behavior since it has been observed that hCG may play a role in the host response to a given tumor.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Helicobacter pylori is strongly associated with inflammation of the stomach and is also implicated in the development of gastric malignancy, peptic ulcers, and gastric lymphomas in humans. Helicobacter pylori can exist in a number of locations: in the mucus, attached to epithelial cells, or inside of vacuoles in epithelial cells, where it produces adhesions that bind to membrane-associated lipids and carbohydrates in or on epithelial cells. The most reliable method for detecting H. pylori infection is a biopsy during endoscopy histologic examination and detection by immunohistochemistry. Immunohistochemical staining of H. pylori on the surface of gastric mucosa is a valuable tool for identification of H. pylori infections.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Helicobacter pylori is strongly associated with inflammation of the stomach and is also implicated in the development of gastric malignancy, peptic ulcers, and gastric lymphomas in humans. Helicobacter pylori can exist in a number of locations: in the mucus, attached to epithelial cells, or inside of vacuoles in epithelial cells, where it produces adhesions that bind to membrane-associated lipids and carbohydrates in or on epithelial cells. The most reliable method for detecting H. pylori infection is a biopsy during endoscopy histologic examination and detection by immunohistochemistry. Immunohistochemical staining of H. pylori on the surface of gastric mucosa is a valuable tool for identification of H. pylori infections.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Herpes simplex virus is quite ubiquitous and is quite variable in its presentation in human disease. Type I usually infects the non-genital mucosal surfaces. It may affect the skin or internal organs (typically brain, lung, liver, adrenal gland, or GI tract) of immunocompromised individuals. This polyclonal antibody reacts with Type I Herpes viruses. There may be cross-reactivity with varicella zoster virus at higher concentrations. Cross-reactivity with CMV or Epstein-Barr virus is not seen with this antibody.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Human placental lactogen (hPL), also previously known as human chorionic somatomammotropin, is a 22 kD protein with partial homology to growth hormone. hPL is first detectable in the maternal serum in the fifth week of gestation and reaches a plateau by the thirty-fourth week. hPL has been demonstrated by immunochemistry in the syncytiotrophoblastic cells of choriocarcinoma. A rare variant of trophoblastic tumor has been reported in the testis with resemblance to uterine placental site trophoblastic tumor. It consisted purely of intermediate trophoblasts, which was diffusely positive for hPL and focally for ?-hCG.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Shih IM, et al. Am J Surg Pathol. 2004; 28:1177-83
References 2:
Ulbright TM, et al. Am J Surg Pathol. 1997; 21:282-8
Human placental lactogen (hPL), also previously known as human chorionic somatomammotropin, is a 22-kD protein with partial homology to growth hormone. hPL is first detectable in the maternal serum in the fifth week of gestation and is involved in maintaining nutritient supply to the fetus. Anti-hPL reactivity is seen in syncytiotrophoblastic cells of placenta and choriocarcinoma
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Shih IM, et al. Am J Surg Pathol. 2004; 28:1177-83
References 2:
Ulbright TM, et al. Am J Surg Pathol. 1997; 21:282-8
Immunoglobulin A (IgA) plays a critical role in mucosal immunity. It is present in the mucosal secretions such as tears, saliva, colostrum, intestinal juice, vaginal fluid, and secretions from the prostate and respiratory epithelium, and represents a key first line of defense against invasion by inhaled and ingested pathogens at the vulnerable mucosal surfaces. It is also found in small amounts in blood. Because it is resistant to degradation by enzymes, secretory IgA can survive in harsh environments such as the digestive and respiratory tracts, to provide protection against microbes that multiply in body secretions. It is useful when identifying multiple myeloma.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Ansari NA, et al. Asian Pac J Cancer Prev. 2007; 8:593-6
Immunoglobulin A (IgA) plays a critical role in mucosal immunity. It is present in the mucosal secretions such as tears, saliva, colostrum, intestinal juice, vaginal fluid, and secretions from the prostate and respiratory epithelium, and represents a key first line of defense against invasion by inhaled and ingested pathogens at the vulnerable mucosal surfaces. It is also found in small amounts in blood. Because it is resistant to degradation by enzymes, secretory IgA can survive in harsh environments such as the digestive and respiratory tracts, to provide protection against microbes that multiply in body secretions. It is useful when identifying multiple myeloma.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Ansari NA, et al. Asian Pac J Cancer Prev. 2007; 8:593-6
Anti-IgM reacts with immunoglobulin mu (IgM) chains. IgM is one of the predominant surface immunoglobulins on B-lymphocytes. This antibody is useful when differentiating and sub-classifying hematolymphoid neoplasms.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Arnold A, et al. New Eng J Med. 1983; 309:1593-1599
References 2:
Leong AS, et al. Geenwich Medical Media Ltd. 1999; 217-219
References 3:
Taylor CR. Arch Path Lab Med. 1978; 102:113-121
References 4:
Kojima M, et al. APMIS. 2002; 110:875-80
References 5:
Pambuccian SE, et al. Am J Surg Pathol. 1997; 21:179-86
Anti-IgM reacts with immunoglobulin mu (IgM) chains. IgM is one of the predominant surface immunoglobulins on B-lymphocytes. This antibody is useful when differentiating and sub-classifying hematolymphoid neoplasms.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Arnold A, et al. New Eng J Med. 1983; 309:1593-1599
References 2:
Leong AS, et al. Geenwich Medical Media Ltd. 1999; 217-219
References 3:
Taylor CR. Arch Path Lab Med. 1978; 102:113-121
References 4:
Kojima M, et al. APMIS. 2002; 110:875-80
References 5:
Pambuccian SE, et al. Am J Surg Pathol. 1997; 21:179-86
Luteinizing hormone (LH) is a heterodimeric glycoprotein produced by gonadotropic cells of the pituitary gland. Anti-LH is a useful marker to aid in the classification of pituitary tumors and the study of pituitary disease.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Sano T, et al. Virchows Arch A Pathol Anat Histopathol. 1990; 417:361-7
References 2:
Felix I, et al. Hum Pathol. 1991; 22:719-21
References 3:
Saccomanno K, et al. J Clin Endocrinol Metab. 1994; 78:1103-7
Luteinizing hormone (LH) is a heterodimeric glycoprotein produced by gonadotropic cells of the pituitary gland. Anti-LH is a useful marker to aid in the classification of pituitary tumors and the study of pituitary disease.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Sano T, et al. Virchows Arch A Pathol Anat Histopathol. 1990; 417:361-7
References 2:
Felix I, et al. Hum Pathol. 1991; 22:719-21
References 3:
Saccomanno K, et al. J Clin Endocrinol Metab. 1994; 78:1103-7
Anti-Lysozyme stains myeloid cells, histiocytes, granulocytes, macrophages, and monocytes in human tonsil, colon and skin. It is an important marker that may demonstrate the myeloid or monocytic nature of acute leukemia. The restrictive nature of anti-lysozyme antibody staining suggests that lysozyme may be synthesized predominantly in reactive histiocytes rather than in resting, unstimulated phagocytes. Anti-lysozyme may aid in the identification of histiocytic neoplasias, large lymphocytes and classifying lymphoproliferative disorders.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Rehg J, et al. Toxicol Pathol. 2012; 40: 345-74
References 2:
Seifert RP, et al. Annals Diag Pathol. 2014; 18:253-60.
Anti-Lysozyme stains myeloid cells, histiocytes, granulocytes, macrophages, and monocytes in human tonsil, colon and skin. It is an important marker that may demonstrate the myeloid or monocytic nature of acute leukemia. The restrictive nature of anti-lysozyme antibody staining suggests that lysozyme may be synthesized predominantly in reactive histiocytes rather than in resting, unstimulated phagocytes. Anti-lysozyme may aid in the identification of histiocytic neoplasias, large lymphocytes and classifying lymphoproliferative disorders.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Rehg J, et al. Toxicol Pathol. 2012; 40: 345-74
References 2:
Seifert RP, et al. Annals Diag Pathol. 2014; 18:253-60.
Anti-Myeloperoxidase detects granulocytes and monocytes in blood and precursors of granulocytes in the bone marrow. This antibody can detect myeloid cell populations of the bone marrow as well as in other sites.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Pinkus GS, et al. Mod Pathol. 1991; 4:733-41
References 2:
Markoc F, et al. Tumori. 2010; 96:149-53
References 3:
Alexiev BA, et al. Diagn Pathol. 2007; 31;2:42
References 4:
Saravanan L, et al. Int J Lab Hematol. 2010; 32:132-6
References 5:
Manaloor EJ, et al. Am J Clin Pathol. 2000; 113:814-22
Anti-Myeloperoxidase detects granulocytes and monocytes in blood and precursors of granulocytes in the bone marrow. This antibody can detect myeloid cell populations of the bone marrow as well as in other sites.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Pinkus GS, et al. Mod Pathol. 1991; 4:733-41
References 2:
Markoc F, et al. Tumori. 2010; 96:149-53
References 3:
Alexiev BA, et al. Diagn Pathol. 2007; 31;2:42
References 4:
Saravanan L, et al. Int J Lab Hematol. 2010; 32:132-6
References 5:
Manaloor EJ, et al. Am J Clin Pathol. 2000; 113:814-22
Immunostaining with anti-myoglobin provides a specific, sensitive, and practical procedure for the identification of tumors of muscle origin. Since myoglobin is found exclusively in skeletal and cardiac muscle and is not present in any other cells of the human body, it may be used to distinguish rhabdomyosarcoma from other soft tissue tumors.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Mukai K, et al. Am J Surg Pathol. 1979; 3:373-6
References 2:
Corson JM, et al.Am J Pathol. 1981; 103:384-9
References 3:
Brooks JJ. Cancer. 1982; 50:1757-63
References 4:
Furlong MA, et al. Ann Diagn Pathol. 2001; 5:199-206
Immunostaining with anti-myoglobin provides a specific, sensitive, and practical procedure for the identification of tumors of muscle origin. Since myoglobin is found exclusively in skeletal and cardiac muscle and is not present in any other cells of the human body, it may be used to distinguish rhabdomyosarcoma from other soft tissue tumors.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Mukai K, et al. Am J Surg Pathol. 1979; 3:373-6
References 2:
Corson JM, et al.Am J Pathol. 1981; 103:384-9
References 3:
Brooks JJ. Cancer. 1982; 50:1757-63
References 4:
Furlong MA, et al. Ann Diagn Pathol. 2001; 5:199-206
Napsin is a pepsin-like aspartic proteinase in the A1 clan of the AA clade of proteinases. There are two closely related napsins, napsin A (NAPSA) and napsin B (NAPSB). Napsin A is involved in processing propeptide pulmonary surfactant protein B (proSP-B) in the lung.4 In normal tissue, Napsin A is expressed in type II pneumocytes of the lung and proximal tubules of the kidney. Napsin A is a useful marker for lung adenocarcinoma
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Brasch F, et al. J Biol Chem. 2003; 278: 49006-14
References 2:
Jagirdar J et al. Arch Pathol Lab Med. 2008; 132:384-96
References 3:
Bishop JA, et al. Hum Pathol. 2010; 41:20-5
References 4:
Ye J, et al. Appl Immunohistochem Mol Morphol. 2011; 19:313-17
References 5:
Mukhopadhyay S, et al. Am J Surg Pathol. 2011; 35:15-25
Protein gene product 9.5 (PGP 9.5), also known as ubiquitin carboxyl-terminal hydrolase-1 (UCH-L1), is a 27-kDa protein originally isolated from whole brain extracts (1). Although PGP9.5 expression in normal tissues was originally felt to be strictly confined to neurons and neuroendocrine cells (2), it has been subsequently documented in distal renal tubular epithelium, spermatogonia, Leydig cells, oocytes, melanocytes, prostatic secretory epithelium, ejaculatory duct cells, epididymis, mammary epithelial cells, Merkel cells, and dermal fibroblasts. LK Campbell et al demonstrated immunostaining of a plethora of different mesenchymal neoplasms with this antibody.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Campbell LK, et al. Mod Pathol. 2003; 16:963-9
References 2:
Bassotti G, et al. J Clin Pathol. 2005; 58:973-7
References 3:
Mahalingam M, et al. J Cutan Pathol. 2001; 28:282-6.
References 4:
Mahalingam M, et al. J Cutan Pathol. 2006; 33:51-6.
Protein gene product 9.5 (PGP 9.5), also known as ubiquitin carboxyl-terminal hydrolase-1 (UCH-L1), is a 27-kDa protein originally isolated from whole brain extracts (1). Although PGP9.5 expression in normal tissues was originally felt to be strictly confined to neurons and neuroendocrine cells (2), it has been subsequently documented in distal renal tubular epithelium, spermatogonia, Leydig cells, oocytes, melanocytes, prostatic secretory epithelium, ejaculatory duct cells, epididymis, mammary epithelial cells, Merkel cells, and dermal fibroblasts. LK Campbell et al demonstrated immunostaining of a plethora of different mesenchymal neoplasms with this antibody.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Campbell LK, et al. Mod Pathol. 2003; 16:963-9
References 2:
Bassotti G, et al. J Clin Pathol. 2005; 58:973-7
References 3:
Mahalingam M, et al. J Cutan Pathol. 2001; 28:282-6.
References 4:
Mahalingam M, et al. J Cutan Pathol. 2006; 33:51-6.
Phosphohistone H3 (PHH3) is a core histone protein, which together with other histones, forms the major protein constituents of the chromatin in eukaryotic cells. In mammalian cells, phosphohistone H3 is negligible during interphase but reaches a maximum for chromatin condensation during mitosis. Immunohistochemical studies showed anti-PHH3 specifically detected the core protein histone H3 only when phosphorylated at serine 10 or serine 28. Studies have also revealed no phosphorylation on the histone H3 during apoptosis. PHH3 can serve as a mitotic marker to separate mitotic figures from apoptotic bodies and karyorrhectic debris, which may be a very useful tool in diagnosis of tumor grades, especially in CNS, skin, gyn., soft tissue, and GIST.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Gurley LR, et al. Eur J Biochem 1978; 84:1-15
References 2:
Hendzel MJ, et al. J Biol Chem 1998; 273:24470-8
References 3:
Colman H, et al. Am J Surg Pathol. 2006; 30:657-64
References 4:
Nasr MR, et al. Am J Dermatopathol. 2008; 30:117-22
Phosphohistone H3 (PHH3) is a core histone protein, which together with other histones, forms the major protein constituents of the chromatin in eukaryotic cells. In mammalian cells, phosphohistone H3 is negligible during interphase but reaches a maximum for chromatin condensation during mitosis. Immunohistochemical studies showed anti-PHH3 specifically detected the core protein histone H3 only when phosphorylated at serine 10 or serine 28. Studies have also revealed no phosphorylation on the histone H3 during apoptosis. PHH3 can serve as a mitotic marker to separate mitotic figures from apoptotic bodies and karyorrhectic debris, which may be a very useful tool in diagnosis of tumor grades, especially in CNS, skin, gyn., soft tissue, and GIST.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Gurley LR, et al. Eur J Biochem 1978; 84:1-15
References 2:
Hendzel MJ, et al. J Biol Chem 1998; 273:24470-8
References 3:
Colman H, et al. Am J Surg Pathol. 2006; 30:657-64
References 4:
Nasr MR, et al. Am J Dermatopathol. 2008; 30:117-22
Prolactin (PRL) is a single-chain polypeptide of 226 amino acids and plays a role in multiple processes including cell growth, reproduction, and immune function. Anti-Prolactin reacts with prolactin-producing cells and is a useful marker in classification of pituitary tumors and the study of pituitary disease.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Asa SL, et al. Arch Pathol Lab Med. 1982; 106:360-3
References 2:
Duello TM, et al. Am J Anat. 1980; 158:463-9
References 3:
Minniti G, et al. Surg Neurol. 2002; 57:99-103
References 4:
Popadic A, et al. Surg Neurol. 1999; 51:47-54
References 5:
Nevalainen MT, et al. J Clin Invest. 1997; 99:618-27
Prolactin (PRL) is a single-chain polypeptide of 226 amino acids and plays a role in multiple processes including cell growth, reproduction, and immune function. Anti-Prolactin reacts with prolactin-producing cells and is a useful marker in classification of pituitary tumors and the study of pituitary disease.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Asa SL, et al. Arch Pathol Lab Med. 1982; 106:360-3
References 2:
Duello TM, et al. Am J Anat. 1980; 158:463-9
References 3:
Minniti G, et al. Surg Neurol. 2002; 57:99-103
References 4:
Popadic A, et al. Surg Neurol. 1999; 51:47-54
References 5:
Nevalainen MT, et al. J Clin Invest. 1997; 99:618-27
Anti-Synaptophysin reacts with neuroendocrine cells of human adrenal medulla, carotid body, skin, pituitary, thyroid, lung, pancreas and gastrointestinal mucosa. Positive staining is seen in neurons of the brain, spinal cord, retina, and Paneths cells in the gastrointestinal tract and gastric parietal cells. This antibody identifies normal neuroendocrine cells and neuroendocrine neoplasms. Diffuse, finely granular cytoplasmic staining is observed, which probably correlates with the distribution of the antigen within neurosecretory vesicles. The expression of synaptophysin is independent of the presence of NSE or other neuroendocrine markers. Anti-Synaptophysin is an independent broadrange marker of neural and neuroendocrine differentiation.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Navone F, et al. J Cell Biol. 1986; 103:2511-27
References 2:
Wiedenmann B, et al. Cell. 1985; 41:1017-28
References 3:
Kayser K, et al. Pathol Res Pract. 1988; 183:412-7
Anti-Synaptophysin reacts with neuroendocrine cells of human adrenal medulla, carotid body, skin, pituitary, thyroid, lung, pancreas and gastrointestinal mucosa. Positive staining is seen in neurons of the brain, spinal cord, retina, and Paneths cells in the gastrointestinal tract and gastric parietal cells. This antibody identifies normal neuroendocrine cells and neuroendocrine neoplasms. Diffuse, finely granular cytoplasmic staining is observed, which probably correlates with the distribution of the antigen within neurosecretory vesicles. The expression of synaptophysin is independent of the presence of NSE or other neuroendocrine markers. Anti-Synaptophysin is an independent broadrange marker of neural and neuroendocrine differentiation.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Navone F, et al. J Cell Biol. 1986; 103:2511-27
References 2:
Wiedenmann B, et al. Cell. 1985; 41:1017-28
References 3:
Kayser K, et al. Pathol Res Pract. 1988; 183:412-7
Anti-TdT antibody labels normal cortical thymocytes and primitive lymphocytes. Anti-TdT antibody detects an enzyme found in the nucleus of normal hematopoietic cells, normal cortical thymocytes and in the cytoplasm of megakaryocytes of the bone marrow. TdT expression is seen in over 90% of acute lymphoblastic lymphoma/ leukemia cases with the exception of pre-B-Cell ALL. TdT expression is not seen in normal mature T-or B-lymphocytes. Anti-TdT is positive for approximately one third of all cases of chronic myeloid leukemia, making it a good indicator of better response to chemotherapy.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Motea EA, et al. Biochimica et Biophysica Acta. 2010; 1804:1151-66
References 2:
Stauchen JA, et al. Int J Surg Pathol. 2003; 11:21-4
References 3:
Suzumiya J, et al. J Pathol. 1997; 182:86-91
References 4:
Arber DA, et al. Am J Clin Pathol. 1996; 106:462-8
Anti-TdT antibody labels normal cortical thymocytes and primitive lymphocytes. Anti-TdT antibody detects an enzyme found in the nucleus of normal hematopoietic cells, normal cortical thymocytes and in the cytoplasm of megakaryocytes of the bone marrow. TdT expression is seen in over 90% of acute lymphoblastic lymphoma/ leukemia cases with the exception of pre-B-Cell ALL. TdT expression is not seen in normal mature T-or B-lymphocytes. Anti-TdT is positive for approximately one third of all cases of chronic myeloid leukemia, making it a good indicator of better response to chemotherapy.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Motea EA, et al. Biochimica et Biophysica Acta. 2010; 1804:1151-66
References 2:
Stauchen JA, et al. Int J Surg Pathol. 2003; 11:21-4
References 3:
Suzumiya J, et al. J Pathol. 1997; 182:86-91
References 4:
Arber DA, et al. Am J Clin Pathol. 1996; 106:462-8
Toxoplasma gondii is a spindle-to-oval-shaped protozoan which presents as an infection in humans of various sorts. The cyst (30 um) and trophozoite (7 um) stages can be identified in humans is such cases. This intracellular parasite is transmitted via raw/undercooked meat, contaminated soil, or by direct contact with an infected host. Infection in humans is usually associated with a variable degree of immunosuppression such as in pregnancy or immunosuppression due to various drugs.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Toxoplasma gondii is a spindle-to-oval-shaped protozoan which presents as an infection in humans of various sorts. The cyst (30 um) and trophozoite (7 um) stages can be identified in humans is such cases. This intracellular parasite is transmitted via raw/undercooked meat, contaminated soil, or by direct contact with an infected host. Infection in humans is usually associated with a variable degree of immunosuppression such as in pregnancy or immunosuppression due to various drugs.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Thyroid-stimulating hormone (also known as TSH or thyrotropin) is a peptide hormone synthesized and secreted by thyrotrops in the anterior pituitary gland which regulate the endocrine function of the thyroid gland. TSH is a glycoprotein and consists of two subunits which are non-covalently bound to one another. Anti-TSH reacts with TSH-producing cells (thyrotrophs), and is a useful marker in classification of pituitary tumors.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Batanero E, et al. Brain Behav Immun. 1992; 6:249-64
References 2:
Sanno N, et al. J Clin Endocrinol Metab. 1995; 80:2518-22
References 3:
La Rosa S, et al. Virchows Arch. 2000; 437:264-9
References 4:
Kuzuya N, et al. J Clin Endocrinol Metab. 1990; 71:1103-11
Thyroid-stimulating hormone (also known as TSH or thyrotropin) is a peptide hormone synthesized and secreted by thyrotrops in the anterior pituitary gland which regulate the endocrine function of the thyroid gland. TSH is a glycoprotein and consists of two subunits which are non-covalently bound to one another. Anti-TSH reacts with TSH-producing cells (thyrotrophs), and is a useful marker in classification of pituitary tumors.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Batanero E, et al. Brain Behav Immun. 1992; 6:249-64
References 2:
Sanno N, et al. J Clin Endocrinol Metab. 1995; 80:2518-22
References 3:
La Rosa S, et al. Virchows Arch. 2000; 437:264-9
References 4:
Kuzuya N, et al. J Clin Endocrinol Metab. 1990; 71:1103-11
Claudins are a family of over twenty proteins which are components of tight junctions. Tight junctions are specialized regions of cell-to-cell contact made up of a network of strands to act as a molecular gasket for preventing the leakage of ions, water, etc., between cells.1 Claudin 1 has been shown to distinguish epithelial neoplasms from lymphomas, making it a useful marker for nearly all carcinomas.2
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Folpe AL, et al. Am J Surg Pathol. 2002; 26:1620-6
Glucose transporter type I (GLUT1), a prototype member of GLUT super family, reacts with a 55 kD protein, is a membrane-associated erythrocyte glucose transport protein. It is a major glucose transporter in the mammalian blood-brain barrier, and also mediates glucose transport in endothelial cells of the vasculature, adipose tissue and cardiac muscle. GLUT1 is detectable in many human tissues including those of colon, lung, stomach, esophagus, and breast. GLUT1 is overexpressed in malignant cells and in a variety of tumors that include the breast, pancreas, cervix, endometrium, lung, mesothelium, colon, bladder, thyroid, bone, soft tissues, and oral cavity. Immuohistochemical detection of GLUT1 can discriminate between reactive mesothelium and malignant mesothelioma. Anti-GLUT1 with anti-Claudin1, and anti-EMA are perineurial markers in diagnosis of perineuriomas. Anti-GLUT1 is also useful in distinguishing benign endometrial hyperplasia from atypical endometrial hyperplasia and adenocarcinoma. GLUT1 expression has been associated with increased malignant potential, invasiveness, and a poor prognosis in general. Expression of GLUT1 is a late event in colorectal cancer and expression in a high proportion of cancer cells is associated with a high incidence of lymph node metastases.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Kato Y, et al. Mod Pathol. 2006; 20:215-20
References 2:
Afify A, et al. Acta Cytol. 2005; 49:621-6
References 3:
Parente P, et al. J Exp Clin Cancer Res. 2008; 27:34
Granzymes are serine proteases which are stored in specialized lytic granules of cytotoxic T lymphocytes and in natural killer cells. Anti-Granzyme B has been useful in diagnosing Natural killer/T cell lymphoma, as well as anaplastic large cell lymphoma. High percentages of cytotoxic T cells have been shown to be an unfavorable prognostic indicator in Hodgkins disease.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Kummer JA, et al. Clin Exp Immunol. 1995; 100:164-72
Herpes simplex virus is quite ubiquitous and is quite variable in its presentation in human disease. Type I usually infects the non-genital mucosal surfaces. It may affect the skin or internal organs (typically brain, lung, liver, adrenal gland, or GI tract) of immunocompromised individuals. This polyclonal antibody reacts with Type I Herpes viruses. There may be cross-reactivity with varicella zoster virus at higher concentrations. Cross-reactivity with CMV or Epstein-Barr virus is not seen with this antibody.
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Napsin is a pepsin-like aspartic proteinase in the A1 clan of the AA clade of proteinases. There are two closely related napsins, napsin A (NAPSA) and napsin B (NAPSB). Napsin A is involved in processing propeptide pulmonary surfactant protein B (proSP-B) in the lung.4 In normal tissue, Napsin A is expressed in type II pneumocytes of the lung and proximal tubules of the kidney. Napsin A is a useful marker for lung adenocarcinoma
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Brasch F, et al. J Biol Chem. 2003; 278: 49006-14
References 2:
Jagirdar J et al. Arch Pathol Lab Med. 2008; 132:384-96
References 3:
Bishop JA, et al. Hum Pathol. 2010; 41:20-5
References 4:
Ye J, et al. Appl Immunohistochem Mol Morphol. 2011; 19:313-17
References 5:
Mukhopadhyay S, et al. Am J Surg Pathol. 2011; 35:15-25
PAX-8 is a transcription factor expressed during embryonic development of Müllerian organs, kidney, and thyroid, with continued expression in some epithelial cell types of these mature tissues.1 It can be useful for marking several types of carcinoma including ovarian serous carcinoma, clear cell renal cell carcinoma, and papillary thyroid carcinoma.1-5 Additionally, PAX-8 is not found in the epithelial cells of the breast, lung, mesothelium, stomach, colon, pancreas and other sites.1-4
Monosan Range:
MONOSAN Ready To Use
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Ozcan A, et al. Mod Pathol. 2011; 24:751-64
References 2:
Laury AR, et al. Am J Surg Pathol. 2011; 35:816-26
References 3:
Nonaka, D et al. Am J Surg Pathol. 2008; 32:1566-71
Human lactoferrin (LF) is an 80 kDa glycoprotein which was first isolated from human milk. It plays an important part in the immune system and helps to fight infections. Lactoferrin promotes the health of the gastro-intestinal system by improving the intestinal microbial balance. In addition, LF can be found in epithelia and most body fluids and secretions. Lactoferrin is secreted in plasma by neutrophils. Its plasma concentration also represents a positive relation to the total pool of neutrophils and the rate of neutrophil turnover. In inflammation lactoferrin is released from secondary granules of neutrophilic leukocytes into the extracellular medium. Therefore the extracellular lactoferrin concentration can be used as an index for neutrophil activation. Lactoferrin strongly binds to iron and this iron binding property is considered to be an important antimicrobial. Human lactoferrin binds to bacterial products through its highly positively charged N-terminus, it kills various bacteria, most probably by inducing intracellular changes in these bacteria without affecting the membrane permeability. Cleavage by pepsin of lactoferrin leads to the release of lactoferricin H. This 47 amino acid peptide has more antimicrobial activity than its precursor and it can inhibit the classical but not the alternative complement pathway. Lactoferrin also plays a role in signal transduction, immunomodulation and has antiadhesive, anticancer, antiviral activity.
Adrenomedullin is a potent vasorelaxing and hypotensive peptide, originally isolated from human pheochromocytoma. Adrenomedullin shares some homology with CGRP (calcitonin gene-related peptide). The antiserum was raised using synthetic peptides as immunogens. The antibody does not cross-react with CGRP. Positive control: Stefanini-fixed frozen sections of rat fundus.
The CGRP-sequence was predicted from the corresponding mRNA. CGRP is present in the C-cells of the thyroid and in nerves, in both brain and periphery, particularly within the sensory system. CGRP is a potent vasodilator, probably involved in neurogenic inflammation. Medullary carcinomas of the thyroid contain large amounts of CGRP. Absorption with 10-100 ug CGRP per ml diluted antiserum abolishes the staining while calcitonin, does not. Cross-reacts with amylin (IAPP).<br>Positive control: Stefanini-fixed frozen sections of rat colon.
The CGRP-sequence was predicted from the corresponding mRNA. CGRP is present in the C-cells of the thyroid and in nerves, in both brain and periphery, particularly within the sensory system. CGRP is a potent vasodilator, probably involved in neurogenic inflammation. Medullary carcinomas of the thyroid contain large amounts of CGRP. Absorption with 10-100 ug CGRP per ml diluted antiserum abolishes the staining while calcitonin does not. Does not cross-react with amylin (IAPP).<br>Positive control: frozen sections of rat colon.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Schulze, E. et al. Acta Histochem.1997; 99: 301309
References 2:
Bechakra, M. et al. Mol.Pain.2018; 14, 1744806918797040
Gastrin-secreting cells are numerous in the antrum and a few are found in the proximal duodenum. The antibody can be used for the diagnosis of gastrin-producing tumors which are mainly found in the pancreas and occasionally in the stomach and the duodenum. <br>Absorption with 10-100 ug gastrin 1-34 and CCK 8 per ml antiserum abolishes the staining. Positive control: formalin-fixed paraffin sections of rat antrum.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Portela-Gomes, G. M.et al. Histochem. Cell Biol. 1999;111: 4954
References 2:
Portela-Gomes, G. M.et al. J. Histochem. Cytochem.1997;45: 81522
References 3:
Mulder, H. et al. Gastroenterology 1994;107: 7129
Glucagon is a common constituent of endocrine pancreatic tumors and of rectal carcinoids. The antibody is specific to pancreatic glucagon. Absorption with 10-100 ug glucagon per ml diluted antiserum abolishes the staining. Positive control: Bouin-fixed paraffin sections of cat pancreas.
Insulin is produced by the B-cells of the pancreatic islets and by insulin-producing islet cell tumors. <br>Absorption with 10-100 ug proinsulin per ml diluted antiserum inactivates the antiserum, while C-peptide and insulin only partly reduce staining.<br>Positive control: formalin-fixed paraffin sections of human pancreas.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Kohnert, K. D. et al. Regul. Pept.1999; 82: 719
References 2:
Ahrén, B. et al. Pancreas 1999; 18: 7583
References 3:
Al-Amily, I. et al. Pflugers.Arch.2019; 471:633-645
Nitric oxide synthase is an enzyme catalizing the synthesis of NO from L-arginine. The antiserum was raised against a synthetic peptide of rat cerebellar NOS, that shows no homology with other related proteins. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: frozen sections of rat colon.
Ornithine decarboxylase is the rate-limiting enzyme in polyamine biosynthesis converting ornithine into putrescine. In normal tissue ornithine decarboxylase activity is low but increases in proliferating tissue. Positive control: Stefanini-fixed frozen sections of renal cortex from testosterone-treated mice.
Phenylethanolamine-N-methyltransferase (PNMT) is an enzyme converting noradrenaline to adrenaline. <br>The enzyme is present in adrenomedullary cells and in the brain neurons. <br> Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining.<br>Positive control: DEPC-fixed paraffin sections of rat adrenal gland.
The intestinal peptide YY is related to the PP-family of peptides and occurs in the glicentin cells in the gut. They are numerous in the rectum, colon, and ileum and few in the duodenum and jejunum. PYY has hormone-like action, inhibits gut motility and pancreatic exocrine secretion and cause vasoconstriction. <br>PYY may occur in endorine tumors of the pancreas and of the rectum. Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining.<br>Positive control: frozen sections of rat intestine.
Substance P occurs in nerve fibers of the central and peripheral nervous system and in endocrine cells of the gut. It stimulates smooth muscle contraction, gives rise to vasodilation and is involved in sensory functions. Substance P-containing tumors arising in the ileum are often associated with the carcinoid syndrome, characterized by flushing of the skin, diarrhea, broncho-constriction and sudden drops in blood pressure. Substance P is commonly found in the midgut carcinoids and some of the symptoms may be related to this peptide. Absorption with 10-100 ug SP and NKA per ml diluted antiserum abolishes the staining while GRP and NKB do not. Positive control:<strong> </strong>frozen sections of rat colon.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Kressel, M.et al. J. Comp. Neurol. 1999;412: 161172
VIP is localized in nerve fibers of the central and peripheral nervous system, and is probably acting as a neurotransmitter. Smooth muscle relaxation, vasodilation and secretion from exocrine glands are some of the effects of VIP. The Verner-Morrison or Watery Diarrhea Hypokaliemia and Achlorhydria (WDHA) syndrome is a characteristic clinical syndrome associated with overproduction of VIP from endocrine tumors. These VIP-producing tumors are usually neuroblastomas of endocrine tumors in the pancreas.<br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while PHI does not.<br>Positive control: Stefanini-fixed frozen sections of rat intestine.
The vesicular monoamine transporter is responsible for the vesicular uptake of monoamines, like dopamine, norepinephrine, epinephrine, serotonin and histamine. The antiserum recognizes monoaminergic neurons of the CNS, the ECL-cells of the stomach, as well as enteric nerve fibers. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. In Western blot experiments using a crude synaptic vesicle fraction of rat brain, the 70 kDa of anti-VMaT2 is recognized (suggested dilution 1:500). Positive control: frozen sections of rat small intestine.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Carballo-Carbajal, I. et al. Nat.Commun. 2019;10: 973
Specific for alpha-melanocyte stimulating hormone. Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining.<br>In man,<strong> </strong>alpha-MSH is found in corticotrophs of the anterior pituitary and may also occur in brain neurons.<br>Positive control: Bouin-fixed paraffin sections of pig pituitary.
Amylin or islet amyloid polypeptide (IAPP) is produced in the pancreas beta cells and co-released with insulin. The amino acid sequence shows great homology with CGRP. Amylin has been shown to reverse insulin inhibition of hepatic gluconeogenesis and to inhibit muscle uptake of glucose. Positive control: Formalin-fixed paraffin and frozen sections of human or rat pancreas.
This polyclonal antibody can be used for the study of endocrine differentiation in tumors of the respiratory tract.<br />Positive control: Gut (peripheral nerves), fetal lung
Bombesin is an amphibian peptide and the mammalian counterpart is referred to as Gastrin Releasing Peptide (GRP). Bombesin/GRP is widely distributed in the brain, in peripheral nerves (particularly numerous in the gut) and in endocrine cells of some sub-mammalian species, e.g. in the oxyntic mucosa of birds. The peptide stimulates secretion from endocrine and exocrine cells and intestinal smooth muscle activity. Bombesin/GRP occurs frequently in the bronchial carcinoids.<br><br> Absorption with 10-100 ug bombesin and GRP per ml diluted antiserum abolishes the staining. Positive control: formalin-fixed paraffin and frozen sections of rat or chicken stomach.
Lactoferrin is an approximately 80 kDa glycoprotein which was first isolated from milk and found in epithelia and most body fluids and secretions. Lactoferrin is secreted in plasma by neutrophils. Its plasma concentration represents a positive relation to the total pool of neutrophils and the rate of neutrophil turnover. In inflammation lactoferrin is released from secondary granules of neutrophilic leukocytes into the extracellular medium. Therefore the extracellular lactoferrin concentration can be used as an index for neutrophil activation. <br /> Lactoferrin is able to strongly bind to iron and considered to have antibacterial properties. Human lactoferrin binds to bacterial products through its highly positively charged N terminus and kills various bacteria most probably by inducing intracellular changes in these bacteria without affecting the membrane permeability. Lactoferrin also plays a role in signal transduction, immunomodulation and has antiadhesive, anticancer, antiviral activity.
Useful for studying sensory afferent neurons. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of rat spinal cord.
Rabbit anti Human Caspase-1 antibody recognizes an epitope within the C-terminal region (CT) of human Caspase-1, otherwise known as IL-1Beta converting enzyme. Caspase-1 is an intracellular cysteine protease, identified as a mammalian homologue to C. elegans cell death gene (ced-3).Caspase-1 has been classified as an inflammatory, rather than apoptotic caspase, due to its essential role in the cleavage of the inactive precursors of the cytokines IL-1beta and IL-18, into their mature activated and secretable forms. Regulation of pro-inflammatory cytokines by Caspase-1 has made inhibitors of Caspase-1 a possible target for use as therapeutic drugs for the treatment of inflammatory diseases (Ghayur et al. 1997).Rabbit anti Human Caspase-1 antibody detects a cleaved subunit band of approximately 21 kDa in human heart cell lysates (predicted precursor MWT 45.2kDa).
Rabbit anti caspase-4 (N-terminal) antibody recognizes an epitope within the N-terminal region (NT) of Caspase-4, otherwise known as ICH-2. Caspase-4, a member of the Caspase-1 subfamily of cysteine proteases, exists as an inactive pro-enzyme which undergoes proteolytic cleavage of its p30 precursor form, into smaller p20 and p10 subunits.The cellular localization of Caspase-4 on the endoplasmic reticulum (ER) membrane, has resulted in this protein becoming a focus of studies in which dysfunction or stress to the ER membrane is implicated, such as Alzheimers disease and Ischemia and confirms the involvement of Caspase-4 as an instigator of cellular apoptosis.
Rabbit anti Human caspase-7 antibody recognizes an epitope within the C-terminal region (CT) of Caspase-7, a ~35 kDa cysteine protease, otherwise known as ICE-like Apoptotic Protease 3 (ICE-LAP3).
Caspase-7, a member of the ICE/Ced-3 subfamily, is an executioner caspase which undergoes proteolytic cleavage of its precursor to form active p12 and p20 subunits. Evidence that activation of Caspase-7 occurs during cell death induced by the cytokine death receptors Fas/APO-1 and the receptor of tumour necrosis factor (TNFR-1), coupled with the fact that granzyme-B activated Caspase-7 cleaves the nuclear enzyme poly (ADP-ribose) polymerase (PARP), suggests an important role for Caspase-7 in both cytokine-mediated and granzyme-B mediated apoptosis pathways.
The antibody reacts with the extra-cellular part of the TNF-RI and with the soluble receptor. TNF-RI is present on most cell types and is considered to play a prominent role in cell stimulation by TNF-alpha. Induction of cytotoxicity and other functions are mediated largely via TNF-RI.
The antibody reacts with a large variety of tumors with oncofetal characteristics; the antigen may also be detected in normal epithelia and tissue of non-neoplastic state. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: Bouin-fixed paraffin sections of human colon carcinoma.
The CGRP-sequence was predicted from the corresponding mRNA. CGRP is present in the C-cells of the thyroid and in nerves, in both brain and periphery, particularly within the sensory system. CGRP is a potent vasodilator, probably involved in neurogenic inflammation. Medullary carcinomas of the thyroid contain large amounts of CGRP. Absorption with 10-100 ug CGRP per ml diluted antiserum abolishes the staining while calcitonin, substance P and Neurokinin A do not. The antiserum cross-reacts with amylin. Positive control: frozen sections of rat colon.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Suzuki, N. et al. Neuroscience 1989;30: 595604
References 2:
Grunditz, T. et al. Endocrinology 1986;119:2313-2324
The antibody is reactive with collagen type IV of basement membranes, and shows a homogeneous staining pattern in all tissues. As neoplastic cells of invasive carcinomas often lack a continuous basement membrane, the antiserum is useful to distinguish between non-invasive and invasive lesions. Additionally, it can be used for the differentiation of bullous lesions in dermatopathology. In immunohistochemistry no cross-reactivity with other collagens at optimal dilutions. In immunoblotting, a slight cross-reactivity with collagen type V is observed. Positive control: Skin, kidney.
PAG (phosphoprotein associated with GEMs), also known as Cbp (Csk-binding protein), is a ubiquitously expressed 46 kDa transmembrane adaptor protein present in membrane rafts (glycosphingolipid-enriched microdomains), which however migrates on SDS PAGE gels anomalously as an 80 kDa molecule. Following tyrosine phosphorylation by Src family kinases, PAG binds and thereby activates the protein tyrosine kinase Csk, the major negative regulator of the Src family kinases. Signaling via the B-cell receptor in B cells or high affinity IgE receptor (FcepsilonRI) in mast cells leads to PAG increased tyrosine phosphorylation and Csk binding, while T cell receptor signaling causes PAG dephosphorylation, loss of Csk binding and increased activation of the protein tyrosine kinase Lck.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
Desmin is a 53 kDa intermediate filament protein and exhibits a high degree of tissue specificity, its expression being predominantly confined to all types of muscle cells (cardiac, skeletal and smooth muscle). Regulation of desmin expression is stage and tissue-specific, since it is induced during terminal development and muscle cell differentiation. In skeletal en cardiac muscle cells desmin is localized in the Z-disk region and at the intercalated disk. The expression pattern of desmin in smooth muscle is much more heterogenous. Coexpression of desmin and vimentin has been observed in tumors derived from muscle tissue, i.e. rhabdomyosarcomas and leiomyosarcomas. Furthermore, during myocard dysfunction dramatic changes in the distribution of desmin have been observed. RCK106 reacts exclusively with Cytokeratin 18 in glandular epithelial cells of the digestive, respiRatory, and urogenital tracts, endocrine and exocrine cells and mesothelial cells, as well as adenocarcinomas originating from them.
Enkephalins are small peptides derived from large precursers (pro-enkephalin A and B) containing multiple enkephalin copies. They are the most abundant opioid peptides in the body and are widely distributed in the brain and the peripheral nervous system and occur also in the adrenal medulla. Several types of neuroendocrine tumors, incl. pheochromocytomas, neuroblastomas and bronchial and gastrointestinal endocrine tumors, produce enkephalin. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while beta-endorphin does not. Cross-reacts with leu-enkephalin. Positive control:<strong> </strong>Frozen sections of cat or pig small intestine.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Kirchgessner, A. L. et al. Neurol.1989; 285, 3853
The antibody reacts with the Lectin Domain of E-selectin, CD62-e, formerly designated Endothelial Leucocyte Adhesion Molecule-1 (ELAM-1). The antibody reacts with human endothelial cells activated with TNF, IL-1 or endotoxin. The antibody was found to react also with cells transfected with the ELAM-1 gene. The antibody inhibits the adhesion of granulocytes both neutrophilic and eosinophilic.
GAP-43, also called neuromodulin, B-50, pp46 and F1, is a neuron-specific, membrane-associated phosphoprotein involved in axonal growth and found in neurons undergoing regeneration.<br>The antiserum was raised against a synthetic C-terminal peptide of GAP-43.<br> Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: rat duodenum.
Gastrin-secreting cells are numerous in the antrum and a few are found in the proximal duodenum. The antibody can be used for the diagnosis of gastrin-producing tumors which are mainly found in the pancreas and occasionally in the stomach and the duodenum.<br />Positive control: Antrum (antigen localization: cytoplasmic, extracellular)
The antibody is directed against the 56 kDa GFAP protein (Glial Fibrillary Acidic Protein, Glial Filament Protein), the main subunit of intermediate filaments of glial cells and astrocytes. The antibody can be used to discriminate glial tumors (astrocytomas, ependy-monas) from other tumors, as meningiomas, neuro-blastomas, chordomas, chondrosarcomas, lym-phomas and carcinomas. Positive control: Brain tissue.
GIP occurs in endocrine cells in the small intestine. GIP is released upon feeding, particularly after carbohydrate-rich food, and is known to sensitize the insulin cells to rise in blood sugar and is thus involved in the insular axis. GIP also inhibits gastric acid secretion.<br> Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while CCK-39, VIP and secretin do not.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 50-100 ul dist. water (final solution contains 0.09% sodium azide, 1% BSA in PBS buffer, pH 7.4)
Glicentin contains the glucagon sequence and is produced in endocrine cells of the distal intestine, in pancreatic glucagon cells and in the nerves in the brain. <br />This glicentin antibody is reactive with glycentin as well as glucagon. The antibody can be used for the diagnosis of tumors from the distal intestine (rectal carcinoids) as well as pancreatic islet cell tumors.<br />Positive control: Pancreas, small intestine.
Glicentin contains the glucagon sequence and is produced in a prominent population of endocrine cells in the distal intestine as well as in pancreatic glucagon cells and in the nerves in the brain. Serum levels of glicentin are elevated after food uptake and in certain clinical conditions, e.g. after resections of the intestine. The functional role of glicentin is largely unknown. Glicentin occurs in endocrine tumors arising in the distal intestine (rectal carcinoids) and in pancreatic islet cell tumors. <br>Absorption with 10-100 ug glucagon and glicentin per ml diluted antiserum abolishes the staining, while secretin, GIP and VIP do not. Positive control: formalin-fixed paraffin sections of pig pancreas.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Sjölund, K. et al. Gastroenterology 1983;85: 112030
The peptide was found in the salivary gland venom of the lizard Gila monster. It belongs to the VIP-secretin family of peptides and has many VIP-like actions. Helospectin-immunoreactivity has been demonstrated in the neurons of the gut.<br> Absorption with 10-100 ug helospectin per ml diluted antiserum abolishes the staining, while secretin, PHI and PACAP do not. <br> Cross-reacts with helodermin. Positive control: Stefanini-fixed frozen sections of rat small intestine (1% carbodiimide added to the fixative).
Histamine is a neurotransmitter in the central nervous system as well as a mast cell constituent. In addition, histamine is produced by endocrine cells (ECL-cells) in the oxynthic mucosa of the stomach. Absorption with 10-100 ug histamine per ml diluted antiserum abolishes the staining, while noradrenaline, 5-HT, VIP, glucagon and histidine do not. Positive control: cryostat sections of carbodiimide fixed human skin or freeze-dried paraffin-sections (vapor fixed in diethylpyrocarbonate; DEPC) of rat stomach.
Histidine decarboxylase (HDC) is the enzyme catalyzing the conversion of histidine into histamine. HDC can be found in the histamine secreting ECL cells of some species as well as in the mast cells. Absorption with 10-100 ug immunogen per ml diluted antiserum abolishesthe staining. <br>In Western blot the antiserum detects the 54 kDa and 73 kDa forms in addition to a 63 kDa form (rat stomach, see Dartsch et al., 1998).<br>Positive control: Stefanini-fixed frozen sections of rat fundus. <br> Dartsch, C., Chen, D. & Persson, L. Multiple forms of rat stomach histidine decarboxylase may reflect posttranslational activation of the enzyme. Regul. Pept. 77, 33-41 (1998).
The antibody reacts with both intact human ICAM-1, CD54 and with soluble human ICAM-1. The antibody reacts also with ICAM-1 present on chimpanzee, rhesus monkey, cynomolgus monkey and baboon tissues.
Insulin is produced by the B-cells of the pancreatic islets. The antibody can be used for the diagnosis of pancreatic B-cell tumors. <br />Antigen localization: cyto-plasm, extracellular.<br />Positive control: Pancreas.
The antibody reacts with human gamma IFN (IFN-gamma) of both natural and recombinant origin. IFN-gamma is a pluripotent cytokine with important pro-inflammatory functions. The antibody inhibits the biological activity of natural and recombinant human IFN-gamma. The antigen specificity was further assessed by ELISA and Western blot. No cross reactivities with other cytokines have been detected.
The antibody reacts with human Interleukin-10 (IL-10) of both natural and recombinant origin. IL-10 is a pluripotent cytokine with important immunosuppressive actions: it can inhibit cytokines involved in the Th1 response such as IL-2, Interferon gamma and also inhibits the production of pro-inflammatory cytokines such as IL-1, IL-6, IL-8 and TNF-alpha. The antibody inhibits the biological activity of natural and recombinant human IL-10. The antigen specificity was further assessed by ELISA. No cross reactivities with other cytokines have been detected.
The antibody reacts specificly with human Interleukin (IL-1)RII. The IL-1 system includes two agonists (IL-1alpha and IL-1beta), converting enzymes, antagonists, two receptors (IL-1RI and IL-1RII) and the IL-1 receptor accessory protein. The IL-1RII is part of the antagonistic IL-1 mechanism. It is also known as decoy receptor and is a non signalling molecule which functions by capturing IL-1 and preventing it from interacting with the signalling IL-1RI. The decoy IL-1RII can after binding to IL-1 also recruit the IL-1 receptor accessory protein and thus inhibit by coreceptor competition. Further a soluble form of IL-1RII exists which is shed, a process in which matrix metalloproteases have been found to play a role, by various cells including monocytes, polymorphonuclear cells, B cells and fibroblasts.
Antibody Isotype:
Ig
Monosan Range:
MONOSAN
Concentration:
100 ug/ ml
Storage buffer:
PBS with 0.1% BSA and 0.02% sodium azide
Storage:
2-8°C
References 1:
Mantovani; A et al. Ann N Y Acad Sci 1998; 840: 338
The polyclonal antibody reacts with human natural and recombinant Interleukin-8 (IL-8) as assessed by ELISA. The antibody inhibits the biological activity of human native and recombinant IL-8. The antibody cross reacts with rhesus and cynomolgus natural IL-8.
The polyclonal antibody recognizes human intestinal fatty acid binding protein (I-FABP) of both natural and recombinant origin. The I-FABP protein is derived from the human FABP2 gene. FABPs are small intracellular proteins (~13-14 kDa) with a high degree of tissue specificity that bind long chain fatty acids. They are abundantly present in various cell types and play an important role in the intracellular utilization of fatty acids, transport and metabolism. There are at least nine distinct types of FABP, each showing a specific pattern of tissue expression. Due to its small size, FABP leaks rapidly out of ischemically damaged necrotic cells leading to a rise in serum levels. Ischemically damaged tissues are characterized histologically by absence (or low presence) of FABP facilitating recognition of such areas. I-FABP is localized in the small bowel epithelium, with highest expression level in the jejunum.
The antiserum reacts positively with all stratified squamous epithelia and epidermal appendages such as hairfollicles, sebaceous glands. Also positive on epithelia of the urinary tract, stomach, intestine, uterine endometrium and prostate. Identifies mesotheliomas, squamous cell carcinomas, adenocarcinomas, transitional cell carcinomas and anaplastic carcinomas. Recommended for positive control: Squamous cell carcinoma, skin, cervix.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Contains 0.01% sodium azide
Storage:
2-8°C
References 1:
Ramaekers F et al. A Pathol Anat Histopathol 1985;408:127-142
Kinesin belongs to the group of microtubule-associated motor proteins known to convert chemical energy released from nucleoside triphosphates (preferentially from ATP) into mechanical energy. Conventional kinesin, member of the kinesin superfamily comprising more than 100 proteins, is involved in the anterograde vesicle transport in neuronal cells. Kinesin purified from mammalian brain homogenates is a heterotetramer consisting of two heavy (120 to 130 kDa) and two light chains (60 to 70 kDa), resulting in a molecular mass about 400 kDa. Each heavy chain contains an N-terminal globular motordomain with both a microtubule-binding site and an ATPase active center, stalk region responsible for heavy chain dimerization and finally C-terminal globular tail domain, which is implicated in cargo binding. Light chains may have a regulatory function.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
Laminin is a glycoprotein (Mr 850 - 1.000 kD, consisting of 3 glycosylated polypeptide chains with molecular weights of 440 and 225 (2x) kD) produced by various human epithelial and mesenchymal cells, and forms an extracellular matrix of thin filaments. In normal tissues, laminin is invariably present in all basal laminas surrounding muscle, nerve, fat and decidua cells and separates epithelial and endothelial cells from abutting connective tissues. Laminin has also been identified within the cytoplasm of breast epithelia, stromal cells of the endometrium, and within endothelial, bile duct epithelial and mesenchymal cells of the liver. Laminin has been found to be involved in cellular activities such as adhesion, spreading, differentiation, polarization, proliferation, locomotion, tissue invasion and chemotactic responses. <br />No cross reaction was obtained with human type I, III, IV and V collagen in immunoblotting, whereas the antibody reacted with a distinct band of appr. 200-220 kD from a 8M Urea extract from amnion basement membrane. Positive control: skin, kidney.
LIME (Lck-interacting molecule) is a 30 kDa double-palmitoylated protein with unusually basic cytoplasmic domain, expressed by T cells. After ligation of CD4 or CD8 T cell coreceptors, LIME is phosphorylated by Src-family kinases and associates with Lck and Fyn kinases and with their negative regulator Csk. Interestingly, Csk-mediated phosphorylation of C-terminal negative-regulatory tyrosine of LIME-associated Lck can result in increase of enzymatic activity compared with the total pool of Lck, thus, LIME serves as a positive regulator of TCR-dependent T cell signaling. However, under some circumstances, LIME may mediate inhibitory signals.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
Lysozyme is a 14 kd enzyme directed against the b 1 a 4 glycosidic bond between N-acetylglucosamine and N-acetylmuramic acid residues that make up peptidoglycan. Lysozyme is an antimicrobial protein secreted by polymorphonuclear leukocytes and is widely distributed in secretions such as airway secretions and nasal fluid whereas it is the most effective antimicrobial protein. It is also produced by monocytes, macrophages and epithelial cells. Lysozyme is able to kill bacteria by enzymatic lysis of bacterial cell walls and by a nonenzymatic mechanism. Allthough lysozyme is highly active against many gram-positive bacteria it is ineffective against gram-negative bacteria unless potentiated by certain cofactors (lactoferrin, antibody-complement or hydrogen peroxide-ascorbic acid). Next to its antimicrobial activity lysozyme has many other physiological functions including inactivation of certain viruses, important roles in surveillance of membranes of mammalian cells, immune regulatory activity, anti-inflammatory and antitumor activity
Specificity: absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: formalin-fixed paraffin sections of pig duodenum.
SLP65 / BLNK (SH2 domain-containing leukocyte-specific phosphoprotein of 65 kDa; B cell linker protein), also known as BASH, is an adaptor protein that plays key role in B cell activation initiated by cross-linking the B cell receptor (BCR). Phosphorylated by Syk tyrosine kinase, SLP65 serves as a scaffold for Btk tyrosine kinase, Vav1 guanine nucleotide exchange factor, phospholipase C gamma2, as well as Grb2 and Nck adaptor proteins; thus represents a central linker protein that bridges the BCR-associated kinases with a multitude of signaling pathways.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
The antibody reacts with natural and recombinant mouse interleukin 6 (IL-6) as assessed by ELISA. The antibody inhibits the biological activity of natural and recombinant mouse IL-6 as determined with the B9 cell bio-assay. The antibody cross-reacts with natural rat IL-6. IL-6 is a pluripotent 20-22 kDa cytokine which plays a role in the pathophysiology of severe infection and regulates the immune response, acute phase reaction and hematopoiesis. IL-6 plays a critical role in B-cell differentiation to plasma cells and is a potent growth factor for plasmacytoma and myeloma. Continuous IL-6 gene expression makes an essential contribution to a multistep oncogenesis of plasma cell neoplasia. IL-6 is a very useful culture supplement for the generation of a high number of antibody-producing hybridomas.
Tumor Necrosis Factor alpha (TNF-alpha) is a cytokine which has diverse immunomodulatory, anti-tumor and toxic effects. TNF-alpha has been detected in diverse inflammatory status and appears to be a critical mediator in the lethality of septic shock. Furthermore, TNF-alpha has also been found in inflammatory foci such as synovial effusions in rheumatoid arthritis, systemic circulation in septic shock, parasitemia and rejection of renal transplants. The antibody reacts with both rat and mouse natural and recombinant TNF-alpha and recognizes membrane and receptor bound TNF-alpha. The antibody shows neutralizing activity.
The polyclonal antibody recognizes the extracellular part of the mouse Tumor Necrosis Factor Receptor type 2 (TNF-RII) of the membrane-bound as well as the soluble receptor. TNF-RII (~75-80 kDa) is present on most cell types and is considered to play a prominent role in cell stimulation by TNF-alpha. TNF-alpha activates inflammatory responses, induces apoptosis, regulates cellular proliferation, and may even promote cancer progression. The effects of TNF-alpha are mediated by TNF-RI and TNF-RII, which have both distinct and overlapping downstream signaling cascades. Induction of cytotoxicity and other functions are mediated largely via TNF-RI. TNF-RI is equally well activated by both the 17 kDa soluble and 26 kDa membrane-bound form, whereas TNF-RII is efficiently activated only by the membrane bound form of TNF-alpha. Binding of the inherently trimeric TNF-alpha to TNFR1 and TNFR2 induces receptor trimerization and recruitment of several signaling proteins to the cytoplasmic domains of the receptors. Occupancy of TNFR2 results in direct recruitment of TNF Receptor Associated Factor 2 (TRAF2), which in turn recruits TRAF1.
Rabbit anti Mycobacterium tuberculosis polyclonal antibody recognizes PPD from Mycobacterium tuberculosis. Rabbit anti M. tuberculosis has not been cross absorbed and may react with related micro-organisms, however the antibody is non-reactive with E.coli K12, Salmonella typhimurium, Pseudomonas aeruginosa, Streptococcus (group B), Candida albicans and Neisseria meningitidis.
Neurokinin A/Substance K represents a member of the tachykinin family of peptides. Neurokinin A, which arises by cleavage of the substance P precursor, occurs in neurons in the central and peripheral nervous systems, and is particularly numerous in the gastrointestinal tract. The biological actions of neurokinin A are similar to those of substance P, and include vasodilation and stimulation of smooth muscle contraction. <br>Absorption with 10-100 ug NKA per ml diluted antiserum abolishes the staining, while substance P does not. Positive control: formalin-fixed paraffin sections of rat colon.
Neuromedin U was found in porcine spinal cord. Neuromedin U-8 is contained within a larger polypeptide form neuromedin U-25. Neuromedin U is present in central and peripheral neurons, particularly in the enteric nervous system. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: frozen sections of chicken small intestine.
Absorption with 10-100 ug neurotensin per ml diluted antiserum abolishes the staining while glucagon, insulin, gastrin, GIP and VIP do not. Positive control: Bouin-fixed paraffin or Stefanini-fixed frozen sections of cat ileum.
Nitric oxide synthase is an enzyme catalizing the synthesis of NO from L-arginine. The antiserum was raised against a synthetic peptide of rat cerebellar NOS, that shows no homology with other related proteins. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: frozen sections of rat colon.
Neuropeptide Y is a peptide belonging to the PP-family and occurs in neurons and adrenal medullary cells. The brain contains large quantities of NPY and it is also found in the peripheral nervous system, where it coexists with noradrenaline in sympathetic fibers. NPY inhibits gut motility and causes vasoconstriction. Pheochromocytomas contain NPY. Absorption with 10-100 ug NPY 1-20 per ml diluted antiserum abolishes the staining, while PYY and PP do not. Positive control: Stefanini-fixed sections of rat small intestine.
Ornithine decarboxylase is the rate-limiting enzyme in polyamine biosynthesis converting ornithine into putrescine. In normal tissue ornithine decarboxylase activity is low but increases in proliferating tissue. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: Stefanini-fixed frozen sections of renal cortex from testosterone-treated mice.
Oxytocin is synthesized in nerve cell bodies in the supraoptic nucleus and paraventricular nucleus, and carried by axonal transport to the neural stalk and pars nervosa where they are stored. Oxytocin nerve terminals can also be found throughout the CNS, even reaching the lower spinal cord. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of pig pituitary.
Pituitary adenylate cyclase activating peptide (PACAP), originally isolated from ovine hypothalamus, belongs to the VIP-family of peptides. PACAP-related peptide (PRP) is a 29-amino acid peptide, which is produced together with PACAP-27 and PACAP-38 when PreproPACAP is being processed. PRP is abundant in the brain, but can be also found in the respiratory and gastrointestinal tracts.<br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while PACAP-27, PACAP-38, VIP, PHI, CRF, oxytocin and vasopressin do not.<br>Positive control: Stefanini-fixed frozen sections of rat duodenum, fundus or antrum.
Neuropeptide Y is a peptide belonging to the PP-family and occurs in neurons and adrenal medullary cells. Antisera raised against NPY often cross-react with PP and PYY. This antiserum was raised using a synthetic peptide from the prepro-NPY sequence which has no homologies to PP and NPY. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: Stefanini-fixed sections of rat small intestine.
Specificity: absorption with 10-100 ug PYY per ml diluted antiserum abolishes the staining, while NPY and PP do not. Positive control: Bouin-fixed paraffin sections of rat colon and frozen sections of rat colon.
The antiserum is raised against a synthetic peptide (SHMSTSAPPP) from the C-terminus of the rat CCK-A receptor. Suitable for labelling the receptors for the gastrointestinal hormone and neuropeptide CCK. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of rat pancreas.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Ohlsson, B. et al. J. Gastroenterol. 2000;35: 612-8
The antibody reacts with rat Interferon gamma (IFN-gamma) of both natural and recombinant origin. IFN-gamma is a pluripotent cytokine with important pro-inflammatory functions. The antibody inhibits the biological activity of natural and recombinant rat IFN-gamma. The antigen specificity was further assessed by ELISA and Western blotting. No cross-reactivities with other cytokines have been detected.
Located in the cell membrane of thyroid cells, NIS can allow sodium and iodine flow across the membrane. The antiserum is raised against the C-terminus of rat NIS. Suitable for studying the sensitivity of thyroid tumors to iodine treatment. Absorption with 50-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of rat thyroid.
Nitric oxide synthase is an enzyme catalizing the synthesis of NO from L-arginine. The antiserum was raised against a synthetic peptide of rat cerebellar NOS, that shows no homology with other related proteins. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: frozen sections of rat colon.
Pancreastatin is a fragment of chromogranin A and is produced by proteolytic processing of chromogranin A in several peptide hormone-producing cells, such as pancreatic islet cells and gut endocrine cells, as well as tumors arising from these cells. <br> Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: Bouin-fixed paraffin sections of rat pancreas.
Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while glucagon, GIP, PP and VIP do not. Positive control: frozen sections of rat duodenum.
The antibody reacts with secretory leukocyte proteinase inhibitor (SLPI; also known as antileukoprotease (ALP)). SLPI is a 11.7 kDa cationic inhibitor of neutrophil elastase and to a lesser extent of cathepsin G. It is locally produced by epithelial cells in the lung, skin and other organs, by Polymorphonuclear leukocytes (PMN) and (in mice) by macrophages. In addition to its proteinase inhibitory properties that may serve to protect against proteolytic injury, it was recently shown that SLPI also displays several other functions such as antimicrobial and anti-inflammatory activities. These appear to be independent of its ability to inhibit PMN serine proteinases. SLPI has also been demonstrated to display antibacterial and antifungal activity at concentrations in which SLPI is present in mucosal secretions including those of the lung. Another possible role for SLPI is inhibition of protein-disulphide isomerase that is considered essential for invasion of a cell by the Human Immunodeficiency Virus (HIV).
Serotonin is produced by endocrine cells of the stomach, duodenum and ileum. The polyclonal antibody to serotonin can be used to differentiate tumors of serotoninergic origin. The antigen localization is cytoplasmic. <br>Absorption with 10-100 ug serotonin per ml diluted antiserum abolishes the staining. Positive control: duodenum.
SLP76 (SH2 domain-containing leukocyte protein of 76 kDa) is a cytosolic adaptor protein which translocates to the plasma mambrane and is involved in multiple signaling pathways in T cells, mast cells, neutrophils and platelets; B cells express its analog SLP65/BLNK (B cell linker protein). SLP76 is phosphorylated by Syk-family and Tec-family tyrosine kinases and couples them to the phosphorylation and activation of PLC-gamma. Via Gads or Grb2, SLP76 also associates with LAT adaptor by involvement of SLP76 proline-rich region. The SH2 domain of SLP76 has been identified as the region involved in binding the serine/threonine kinase HPK1. HPK1 may act as both a positive and a negative regulator by promoting the Jnk-mitogen activated protein kinase (MAPK) pathway and inhibiting the pathway leading to AP-1 activation.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
Substance P occurs in nerve fibers of the central and peripheral nervous system and in endocrine cells of the gut. It stimulates smooth muscle contraction, gives rise to vasodilation and is involved in sensory functions. Substance P-containing tumors arising in the ileum are often associated with the carcinoid syndrome, characterized by flushing of the skin, diarrhea, broncho-constriction and sudden drops in blood pressure. Substance P is commonly found in the midgut carcinoids and some of the symptoms may be related to this peptide.<br>Absorption with 10-100 ug SP 1-4 per ml diluted antiserum abolishes the staining. Positive control: frozen sections of rat colon.
The antibody reacts with human natural and recombinant TNF-alpha as assessed by ELISA. The antibody inhibits the biological activity of human natural and recombinant TNF-alpha as determined with L929 and WEHI cells in a cytotoxicity assay. The antibody cross reacts with rhesus and cynomolgus natural TNF-alpha and lacks cross reactivity with human lymphotoxin.
The antiserum against the vesicular acetylcholine transporter is a unique immunohistochemical marker for cholinergic nerves, more specific than the commonly used acetylcholine esterase (AchE), since it does not react with postsynaptic neurons, and is more sensitive than choline acetyltransferase (ChAT). The antiserum recognizes VAChT both in the CNS and PNS of rat and mouse. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of rat small intestine.
The antiserum against the vesicular acetylcholine transporter is a unique immunohistochemical marker for cholinergic nerves, more specific than the commonly used acetylcholinesterase (AchE), since it does not react with postsynaptic neurons, and is more sensitive than choline acetyltransferase (ChAT). The antiserum recognizes VAChT both in the CNS and PNS. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of human small intestine (Stefanini fixation).
Regulates the level of GABA available for secretion via secretory vesicles. Marker for neurons using GABA as signaling substance. <br> Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: frozen sections of rat cerebellum.
VIP is localized in nerve fibers of the central and peripheral nervous system, and is probably acting as a neurotransmitter. Smooth muscle relaxation, vasodilation and secretion from exocrine glands are some of the effects of VIP. The Verner-Morrison or Watery Diarrhea Hypokaliemia and Achlorhydria (WDHA) syndrome is a characteristic clinical syndrome associated with overproduction of VIP from endocrine tumors. These VIP-producing tumors are usually neuroblastomas of endocrine tumors in the pancreas. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while PHI, secretin, glucagon, GIP, and CCK do not. Positive control: formalin-fixed paraffin sections of cat ileum.
The vesicular monoamine transporter is responsible for the vesicular uptake of monoamines, like dopamine, norepinephrine, epinephrine, serotonin and histamine. The antiserum recognizes monoaminergic neurons of the CNS, the ECL-cells of the stomach, as well as enteric nerve fibers. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of rat small intestine.
The ZAP70 (zeta-associated protein of 70 kDa) tyrosine kinase was identified as a tyrosine phosphoprotein that associates with TCR zeta subunit and undergoes tyrosine phosphorylation following TCR stimulation. ZAP70 is a Syk family tyrosine kinase primarily expressed in T and NK cells that plays an essential role in signaling through the TCR. TCR-mediated activation of T cells is crucial to the immune response. In humans, ZAP70 gene mutations resulting in lower ZAP70 protein expression levels or expression of catalytically inactive ZAP70 proteins, have been identified. ZAP70 deficiency results in the absence of mature CD8+ T cells and the prevention of TCR-mediated activation of CD4+ T cells, and it can lead to severe combined immunodeficiency.In patients with chronic lymphocytic leukemia (B-CLL), ZAP70 expression on B cell was shown to be correlated with disease progression and survival. ZAP70 contains two N-terminal SH2 domains (Src homology domain 2) and a C-terminal kinase domain. During T cell activation, the binding of ZAP70 SH2 domains to the phosphorylated zeta subunit on the activated TCR complex causes a colocalization with the Lck tyrosine kinase that phosphorylates ZAP70 on Tyr493 in the activation loop. ZAP70 autophosphorylates multiple tyrosines in the region between the SH2 domains and the kinase domain, including the binding sites for additional SH2-containing signaling proteins such as SLP76, LAT, Lck, PLCgamma1, Vav, Shc, Ras-GAP, and Abl. ZAP70-mediated activation of these downstream effectors leads to the release of intracellular calcium stores, and the transcription of interleukin-2 and other genes important for an immune response.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
Sheep anti Human C3c antibody recognizes the C3c component of human complement, formed as a result of the inactivation of C3b. Sheep anti Human C3c antibody may be used for the detection of C3 deposits in tissues following complement activation.
Poly-L-Lysine coated glass slides. Adhesive to frozen and paraffin embedded tissue sections, cyto-centrifuge preparations and cytology smears. Used keep cells and or tissue from peeling off the slides during the experiment.
Product Type:
Plastics & Consumables
Storage Temp:
RT
Additional Info:
Poly-L-Lysine coated glass slides. Adhesive to frozen and paraffin embedded tissue sections, cyto-centrifuge preparations and cytology smears. Used keep cells and or tissue from peeling off the slides during the experiment.
Mouse anti-Polyubiqutin-B Monoclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
Ubiquitin is a highly conserved 76 amino acid protein with an estimated molecular weight of 8.56 kDa which has a central role in regulated protein degradation. It is a protein modifier which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Several types of polymeric chains can be formed depending on the lysine used for the assembly. Attachment to proteins as a polymer leads to their degradation by the 26S proteosome; a complex, multicatalytic cytosolic and nuclear protease. Attachment to proteins as a monomer or as an alternatively linked polymer does not lead to proteasomal degradation and may be required for numerous functions, including maintenance of chromatic structure, regulation of gene expression, stress response, ribosome biogenesis and DNA repair. Ubiquitin is synthesized as a polyubiquitin precursor with exact head to tail repeats, the number of repeats of which differ between species and strains. In some species there is a final amino-acid after the last repeat, here in bovine a Cys. Some ubiquitin genes contain a single copy of ubiquitin fused to a ribosomal protein (either L40 or S27a).
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Mouse
Species Reactivity:
Bovine,C. elegans,Chicken,Drosophila,Human
Immunogen:
Raised against purified ubiquitin conjugated with glutaraldehyde to keyhole limpet hemocyanin.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Clone number:
Ubi-1
Antibody Isotype:
IgG1
Application Details:
Western Blotting (WB), Immunohistochemistry - paraffin embedded tissue (IH-P) and ELISA. Suggested dilution for WB is 1:500-1,000. This antibody can be used on mildly fixed histological sections of human brain for studies of Alzheimer's disease. This antibody also works on paraffin embedded material. It also recognises other ubiquinated inclusion bodies such as Lewy bodies of Parkinson's disease and the Pick bodies in Pick's disease in formalin fixed tissues. Suggested dilution for IH is 1:500. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Josephs K.A. et al (2006) Atypical progressive supranuclear palsy with corticospinal tract degeneration. J Neuropathol Exp Neurol. 2006 Apr;65(4):396-405. Josephs K.A. et al (2007) Neuropathologic features of frontotemporal lobar degeneration with ubiquitin-positive inclusions with progranulin gene (PGRN) mutations. J Neuropathol Exp Neurol. 2007 Feb;66(2):142-51. Rudzinski L.A. et al (2008) Early onset familial Alzheimer Disease with spastic paraparesis, dysarthria, and seizures and N135S mutation in PSEN1. Alzheimer Dis Assoc Disord. 2008 Jul-Sep;22(3):299-307. Josephs K.A. et al (2009) Evaluation of subcortical pathology and clinical correlations in FTLD-U subtypes. Acta Neuropathol. 2009 Sep;118(3):349-58.
Specificity:
The specificity of this antibody has been confirmed by WB. This antibody detects ~8.5 kDa Ubiquitin. Hu, Bov, Chk, Drosophila, and C. elegans
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Chlorophylls are one of the most abundant classes of natural pigments and have an essential role in radiant energy absorptions during photosynthesis in bacteria, algae, and higher plants. Chlorophylls occur as noncovalently bound components of pigment-protein complexes, chloroplast-localized light-harvesting antennas LHC and photosynthetic reaction centers of PSI and PSII. Upon illumination the arrest in chlorophyll biosynthesis is ended and the etiolated parts of the plant and enzymatic photoreduction of protochlorophyllide (Pchlide) to chlorophyllide (Chlide), catalysed by POR enzyme.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
POR is present in high amounts in chloroplasts not exposed to light (etioplasts),
Application Details:
1: 500 (IL), 1 : 2000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
36-37 kDa (Arabidopsis thaliana)
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Lee et al (2021). Chaperone-like protein DAY plays critical roles in photomorphogenesis. Nat Commun. 2021 Jul 7;12(1):4194. doi: 10.1038/s41467-021-24446-5. PMID: 34234144; PMCID: PMC8263706.Floris & K hlbrandt. (2021). Molecular landscape of etioplast inner membranes in higher plants. Nat Plants. 2021 Apr;7(4):514-523. doi: 10.1038/s41477-021-00896-z. Epub 2021 Apr 19. PMID: 33875833.Dogra et al. (2019). Oxidative post-translational modification of EXECUTER1 is required for singlet oxygen sensing in plastids. Nat Commun. 2019 Jun 27;10(1):2834. doi: 10.1038/s41467-019-10760-6. Zhang et al. (2018). Nitric oxide regulates chlorophyllide biosynthesis and singlet oxygen generation differently between Arabidopsis and barley. Nitric Oxide. 2018 Mar 3;76:6-15. doi: 10.1016/j.niox.2018.03.001.Han et al. (2015). A nuclear-encoded chloroplast-targeted S1 RNA-binding domain protein affects chloroplast rRNA processing and is crucial for the normal growth of Arabidopsis thaliana. Plant J. 2015 Jul;83(2):277-89. doi: 10.1111/tpj.12889. Epub 2015 Jun 15.
PP2A (Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit B' gamma isoform) is required for the formation of the PP2A holoenzyme that negatively regulates brassinosteroid signaling by dephosphorylating and inactivating BRI1 in the cytoplasm and is involved in growth regulation and stress signaling. Alternative names: AtB' gamma, PP2A, B' subunit, gamma isoform
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Oryza sativa
Expected Species:
Brassica olereacea, Pisum sativum Species of your interest not listed? Contact us
PPD2 (protein PEABOD 2) belongs to the TIFY/JAZ family and is involved in lamina development, regulating leaf size and its curvature. Alternative name: Protein TIFY4B
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
PPDK (Pyruvate, phosphate dikinase 1) is involved in formation of phosphoenolpyruvate and activated by light-induced dephosphorylation. Inhibited by dark-induced phosphorylation. PPDK is a low-abundance enzyme in C3 plants while it is a key enzyme of C4 photosynthesis.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Hordeum vulagre, Kalanchoe fedtschenkoiSpecies of your interest not listed? Contact us
Immunogen:
Purified recomibinant enzyme consisting of residues 72-947 of Zea mays, UniProt: P11155Peptide used to elicit this antibody is conserved in both isoforms of PPDK in rice: PPDK1 and PPDK2.
PPDK levels inr C3 plants like Arabidopsis thaliana and Hordeum vulgare are very low and PPDK protein is very dilute in most tissues of C3 plants. To perform detection in C3 plants leaf proteins needs to be concentrated before western blot, Chastain et al. (2002).
Application Details:
1 : 25 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 200 l of sterile water in 40% glycerol to a final protein concentration of 100 ng/ l
Molecular Weight:
102 | 95 kDa
Not reactive in:
Cucumis sativus
Selected references:
Shen et al. (2016). The existence of C4-bundle-sheath-like photosynthesis in the mid-vein of C3 rice. Rice (N Y). 2016 Dec;9(1):20. doi: 10.1186/s12284-016-0094-5. Epub 2016 May 10.
PPH1/TAP38 (Protein phosphatase 1) is a choroplast protein phosphatase TAP38/PPH1, required for efficient dephosphorylation of the LHCII anthena and state transition from state 2 to state 1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Cajanus cajan, Cephalotus follicularis, Cicer arietinum, Cucumis melo, Glycine soja, Gossypium hirsutum, Ilex paraguariensis, Mesembryanthemum crystallinum, Nelumbo nucifera, Nicotiana tabacum, Noccaea caerulescens, Populus trichocarpa, Ricinus communis, Theobroma caca, Vigna radiata var. radiata Species of your interest not listed? Contact us
Papain (EC=3.4.22.2) is a cysteine protease which belongs to peptidase C1 family. Can cause an allergic reaction in humans. Alternative names: Papaya proteinase I, allergen= Car p 1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Carica papaya
Expected Species:
Carica papaya
Immunogen:
native papain isolated and purified from Carica papaya
Applications:
ELISA (ELISA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western blot (WB)
The IgG (7S) fraction is prepared from the antiserum by ammonium sulphate precipitation and ion exchange chromatography
Application Details:
1 : 1000-1 : 100 000 (ELISA), (IF), (IHC), (WB)
Purity:
Purified IgG in PBS.
Reconstitution:
For reconstitution add 1 ml of sterile destilled water
Molecular Weight:
38,9 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Antibody potency and purity has been evaluated by immunoelectrophoresis, single radial immunodiffusion (Ouchterlony), ELISA,immunoblotting and enzyme inhibition
Papain (EC=3.4.22.2) is a cysteine protease which belongs to peptidase C1 family. Can cause an allergic reaction in humans. Alternative names: Papaya proteinase I, allergen= Car p 1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Carica papaya
Expected Species:
Carica papaya
Immunogen:
native papain isolated and purified from Carica papaya
Applications:
ELISA (ELISA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western blot (WB)
Antibodies have been purified using solid phase affinity chromatography and are stabilized with dextran
Application Details:
1 : 1000-1 : 100 000 (ELISA), (IF), (IHC), (WB)
Purity:
Immunogen affinity purified IgG in PBS.
Reconstitution:
For reconstitution add 0,5 ml of sterile destilled water
Molecular Weight:
38,9 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Antibody potency and purity has been evaluated by immunoelectrophoresis, single radial immunodiffusion (Ouchterlony), ELISA,immunoblotting and enzyme inhibition
Papain (EC=3.4.22.2) is a cysteine protease which belongs to peptidase C1 family. Can cause an allergic reaction in humans. Alternative names: Papaya proteinase I, allergen= Car p 1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Carica papaya
Expected Species:
Carica papaya
Immunogen:
Native papain isolated and purified from Carica papaya
Applications:
ELISA (ELISA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western blot (WB)
Biotin/IgG protein molar ration is approximately 6,2, No foreign proteins are added
Application Details:
1 : 1000-1 : 100 000 (ELISA), (IF), (IHC), (WB)
Purity:
Purified IgG in PBS.
Reconstitution:
For reconstitution add 0,5 ml of sterile destilled water
Molecular Weight:
38,9 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Antibody is labelled with biotin using N-hydroxysuccinimidobiotin, Antibody potency and purity has been evaluated by immunoelectrophoresis, single radial immunodiffusion (Ouchterlony), ELISA,immunoblotting and enzyme inhibition
Polyphenol oxidase participates in the response of plants to wounding and herbivore attack, mediated by the octadecanoid wound-signalling pathway. Chloroplast polyphenol oxidase is a nuclear-encoded protein that is targeted to the thylakoid lumen. It was found that polyphenol oxidase is one of the most strongly phosphorylated protein in thylakoid lumen although the role of this protein modification is not known. Alternative name: catechol oxidase.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at short-term 4 C, Long-term -20 . Repeated freezing and thawing is not recommended. It ontains 0,01% sodium azide.
Host Animal:
Rabbit
Species Reactivity:
Spinacia oleracea
Expected Species:
Spinacia oleracea
Immunogen:
recombinant lumenal polyphenol oxidase of Spinacia oleracea UniProt: P43310
PPR (Pentatricopeptide repeat-containing protein, chloroplastic - SOT1) is located in chloroplast. Alternative name: Pentatricopeptide repeat-containing protein At5g46580, chloroplastic.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabidopsis lyrata, Capsella rubellaSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana SOT 1 sequence, Uniprot: Q9LS25, TAIR: At5g46580
Pathogenesis-related protein 1 (PR-1), small antimicrobial protein which acts as a marker of plant immune signaling and is partially responsible for acquired pathogen resistance. Induced by INA, salicylic acid and pathogen infection.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Re-using of antibody solution is not recommended, It will contribute to incrteased background signal
Application Details:
1 : 2500 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
17.7 kDa (Arabidopsis thaliana)
Not reactive in:
Citrus sinensis,
Selected references:
Li et al. (2020). N-terminal acetylation stabilizes SIGMA FACTOR BINDING PROTEIN 1 involved in salicylic acid-primed cell death. Plant Physiol. 2020 Mar 5. pii: pp.01417.2019. doi: 10.1104/pp.19.01417.Jung et al. (2020). Pathogen-associated Molecular Pattern-triggered Immunity Involves Proteolytic Degradation of Core Nonsense-mediated mRNA Decay Factors During the Early Defense Response. Plant Cell, February 2020. Chang et al. (2019). PBS3 Protects EDS1 from Proteasome-Mediated Degradation in Plant Immunity. Mol Plant. 2019 Feb 11. pii: S1674-2052(19)30055-3. doi: 10.1016/j.molp.2019.01.023.Lv et al. (2019). Uncoupled Expression of Nuclear and Plastid Photosynthesis-Associated Genes Contributes to Cell Death in a Lesion Mimic Mutant. Plant Cell. 2019 Jan;31(1):210-230. doi: 10.1105/tpc.18.00813.Cecchini et al. (2018). Underground azelaic acid-conferred resistance to Pseudomonas syringae in Arabidopsis. Mol Plant Microbe Interact. 2018 Aug 29. doi: 10.1094/MPMI-07-18-0185-R.Chakraborty et al. (2018). Epigenetic and transcriptional control of chickpea WRKY40 promoter activity under Fusarium stress and its heterologous expression in Arabidopsis leads to enhanced resistance against bacterial pathogen. Plant Science, doi.org/10.1016/j.plantsci.2018.07.014Izquierdo et al. (2018). Arabidopsis nonresponding to oxylipins locus NOXY7 encodes a yeast GCN1 homolog that mediates noncanonical translation regulation and stress adaptation. Plant Cell Environ. 2018 Mar 2. doi: 10.1111/pce.13182.Seguel et al. (2018). PROHIBITIN 3 forms complexes with ISOCHORISMATE SYNTHASE 1 to regulate stress-induced salicylic acid biosynthesis in Arabidopsis. Plant Physiol. Jan 2018. DOI:10.1104/pp.17.00941Huh et al. (2017). Protein-protein interactions in the RPS4/RRS1 immune receptor complex. PLoS Pathog. 2017 May 5;13(5):e1006376. doi: 10.1371/journal.ppat.1006376.Zhang et al. (2017). A suite of receptor-like kinases and a putative mechano-sensitive channel are involved in autoimmunity and plasma membrane-based defenses in Arabidopsis. Mol Plant Microbe Interact. 2017 Jan 4. doi: 10.1094/MPMI-09-16-0184-R.Zhu et al. (2016). CML8, an Arabidopsis calmodulin-like protein plays a role in Pseudomonas syringae plant immunity. Plant Cell Physiol. 2016 Nov 10. pii: pcw189. [Epub ahead of print]
Special application note:
PR-1 protein is present in very low amonts in non-induced plant material.Overnight antibody incubation is not recommended.This product can be sold containing Proclin if requested.
Pathogenesis-related protein 1 (PR-1) is partially responsible for acquired pathogen resistance. Induced by INA, salicylic acid and pathogen infection.This product is a recombinant PR-1 protein, trunctated by first 26 amino acids, source: Arabidopsis thaliana, UniProt: P33154, TAIR: At2g14610
Product Type:
Antibody
Format:
Lyophilized in glycerol.
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Concentration: after adding 90 l of sterile milliQ water final concentration of the standard is 0.10 pmoles/ lProtein standard buffer composition: Glycerol 10%, Tris Base 141 mM, Tris HCl 106 mM, LDS 2%, EDTA 0.51 mM, SERVA Blue G250 0.22 mM, Phenol Red 0.175 mM, pH 8.5, 0.1mg/ml PefaBloc protease inhibitor (Roche), 50mM DTT.This standard is ready-to-load and does not require any additions or heating. It needs to be fully thawed and thoroughly mixed prior to using. Avoid vigorous vortexing, as buffers contain detergent. Following mixing, briefly pulse in a microcentrifuge to collect material from cap.This standard is stabilized and ready and does not require heating before loading on the gel.Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Application Details:
Standard curve: 3 loads are recommended eg.0.5, 2 and 4μl.For most applications a sample load of 10-20 μg of protein will provide with a signal in this range.Positive control:a 2μl load per well is optimal for most chemiluminescent detection systems.This standard is stabilized and ready and does not require heating before loading on the gel.Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Reconstitution:
For reconstitution add 90 l of sterile water, Please notice that this product contains 10% glycerol and might appear as liquid but is provided lyophilized
Molecular Weight:
16,4 kDa
Special application note:
The PR-1 protein standard can be used in combination with anti-PR-1 antibodies to quantitate PR-1 protein. Quantitative western blot: detailed method description, video tutorialThis product can be sold containing ProClin if requested
Pathogenesis-related (PR) proteins, are induced in response to the infection of plants with microbial pathogens. Combinations of glucanase I and chitinase I are potent inhibitors of fungal growth in vitro however precise mechanism of that is still not known. Glucanase I and chitinase I contribute to defense against fungal infection and are currently used as markers for innate immunity, and in particular the ethylene/jasmonate signalling pathway in pathogenesis. Alternative names of the protein: basic beta-1,3-glucanase
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Dicots, Oryza sativa, Prunus persicaSpecies of your interest not listed? Contact us
Immunogen:
Purified tobacco class I, basic -1,3-glucanase. Purified GLU I consists of a mixture of closely related polypeptides encoded by a family of GLU I genes comprising GLA B5APL3 derived from the sylvestris ancestor of tobacco, GLB P27666 derived from the tomentosiformis ancestor of tobacco and homeologous recombinants (Sperisen et al., 1991). Mature GLU I is processed from a pre-pro-polypeptide (Shinshi et al., 1988).
Important note: for blocking 5 % skim milk in PBS without Ca++ should be used.This antibody is purified by affinity chromarography on Portein G.
Application Details:
8 g/ml (WB)
Purity:
Total IgG in PBS pH 7.4. (without Ca++).
Reconstitution:
For reconstitution add 100 l of sterile water
Molecular Weight:
37 | 33 kDa
Not reactive in:
Arabidopsis thaliana
Selected references:
Li et al. (2021) Penicillium chrysogenum polypeptide extract protects Nicotiana benthamiana against TMV infection through modulation of ABA biosynthesis and callose priming. J Exp Bot. 2021 Mar 4:erab102. doi: 10.1093/jxb/erab102. Epub ahead of print. PMID: 33687058. (Immunolocalization)Colman et al. (2019). Chitosan microparticles improve tomato seedling biomass and modulate hormonal, redox and defense pathways. Plant Physiology and Biochemistry. Volume 143, October 2019, Pages 203-211. Martin-Saladana et al. (2018). Salicylic acid loaded chitosan microparticles applied to lettuce seedlings: Recycling shrimp fishing industry waste. Carbohydrate Polymers Volume 200, 15 November 2018, Pages 321-331.Wang et al. (2014). Elicitation of Hypersensitive Responses in Nicotiana glutinosa by the Suppressor of RNA Silencing Protein P0 from Poleroviruses. Mol Plant Pathol. 2014 Sep 4. doi: 10.1111/mpp.12201.Huey-wen et al. (2014). Harpin Protein, an Elicitor of Disease Resistance, Acts as a Growth Promoter in Phalaenopsis Orchids. Journal of Plant Growth Regulation May 2014.
Special application note:
For more details on immunolocalization, please referr to Keefe et al (1990). Plant 182: 43-51.This antibody can be used as a marker of vacuolar contents Keefe et al. (1990). The effect of ethylene on the cell-type-specific and intracellular localization of β-1,3-glucanase and chitinase in tobacco leave. Plant 182: 43-51.
PR-2 (Pathogenesis-related protein 2) is involved in the defence of plants against pathogens. This protein has a catalytic activity and is hydrolysing of (1->3)-beta-D-glucosidic linkages in (1->3)-beta-D-glucans, EC=3.2.1.39. Alternative names:Glucan endo-1,3-beta-glucosidase, acidic isoform,(1->3)-beta-glucan endohydrolase, Beta-1,3-endoglucanase, Beta-1,3-glucanase 2
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Agostis stolonifera cv. ‘Penncross’, Arabidopsis thaliana, Glycine max (roots)
Expected Species:
Brassica juncea, Brassica oleracea, Citrus chinensis, Glycine max, Litchi chinensis, Manihot esculenta, Nicotiana tabacum Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from Arabidopsis thaliana PR-2 UniProt P33157, TAIR AT3G57260
Does not cross-react with other 1,3-beta glucosidases
Application Details:
1 : 1000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
37,3 kDa (processing aa 1-30, mature peptide 34,1 kD)
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Dong et al. (2020). Overexpression of BrAFP1 gene from winter rapeseed (Brassica rapa) confers cold tolerance in Arabidopsis. Plant Physiol Biochem. 2020 Jul 25;155:338-345.doi: 10.1016/j.plaphy.2020.07.011. Lv et al. (2019). Uncoupled Expression of Nuclear and Plastid Photosynthesis-Associated Genes Contributes to Cell Death in a Lesion Mimic Mutant. Plant Cell. 2019 Jan;31(1):210-230. doi: 10.1105/tpc.18.00813.Jespersen et al. (2017). Metabolic Effects of Acibenzolar-S-Methyl for Improving Heat or Drought Stress in Creeping Bentgrass. Front Plant Sci. 2017 Jul 11;8:1224. doi: 10.3389/fpls.2017.01224. eCollection 2017. (western blot, Agostis stolonifera cv. ?Penncross?)Kim et al. (2014). The Arabidopsis Immune Adaptor SRFR1 Interacts with TCP Transcription Factors thatRedundantly Contribute to Effector-Triggered Immunity. Plant J. 2014 Apr 1. doi: 10.1111/tpj.12527.
Special application note:
This product can be sold containing Proclin if requested
Pathogenesis-related (PR) proteins, are induced in response to the infection of plants with microbial pathogens. Combinations of glucanase I and chitinase I are potent inhibitors of fungal growth in vitro however precise mechanism of that is still not known. Glucanase I (PR-2) and chitinase I (PR-3) contribute to defense against fungal infection and are currently used as markers for innate immunity, and in particular the ethylene/jasmonate signalling pathway in pathogenesis.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Arabidopsis thaliana, Manihot esculenta, Zea maysSpecies of your interest not listed? Contact us
Immunogen:
Purified tobacco class I chitinase. The preparation used is a mixture of two class I isoforms (Shinshi et al., 1990; van Buuren et al., 1992): 1) Chitinase A (CHN A) P08252 encoded by gene chn48 derived from the N. tomentosiformis ancestor of tobacco. 2) Chitinase B (CHN B) P24091 encoded by gene chn50 derived from the N. sylvestris ancestor of tobacco.
Applications:
Co-Immunoprecipitation (IP) (Co-IP), Immunolocalization (IL), Western blot (WB)
Important note: For blocking 5 % skim milk in PBS without Ca++ should be used,This antibody is purified by affinity chromarography on Portein G
Application Details:
8 g/ml (WB)
Purity:
Total IgG. Protein G purified in PBS pH 7.4.
Reconstitution:
For reconstitution add 100 l of sterile water
Molecular Weight:
35, 34 | 32 and 34 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Mansilla et al. (2020).- Characterization of functionalized bentonite as nanocarrier of salicylic acid with protective action against Pseudomonas syringae in tomato plants. Eur J Plant Pathol 158, 211?222 (2020). https://doi.org/10.1007/s10658-020-02067-wColman et al. (2019). Chitosan microparticles improve tomato seedling biomass and modulate hormonal, redox and defense pathways. Plant Physiology and Biochemistry Volume 143, October 2019, Pages 203-211. Kumari et al. (2017), Overexpression of a Plasma Membrane Bound Na+/H+ Antiporter-Like Protein (SbNHXLP) Confers Salt Tolerance and Improves Fruit Yield in Tomato by Maintaining Ion Homeostasis. Front Plant Sci. 2017 Jan 6;7:2027. doi: 10.3389/fpls.2016.02027.Jespersen et al. (2017). Metabolic Effects of Acibenzolar-S-Methyl for Improving Heat or Drought Stress in Creeping Bentgrass. Front Plant Sci. 2017 Jul 11;8:1224. doi: 10.3389/fpls.2017.01224. eCollection 2017. (western blot, Agostis stolonifera cv. ?Penncross?)Ko et al. (2016). Constitutive expression of a fungus-inducible carboxylesterase improves disease resistance in transgenic pepper plants. Planta. 2016 Aug; 244(2):379-92. doi: 10.1007/s00425-016-2514-6. Epub 2016 Apr 13.
Special application note:
Antibody is recognizing closely related tobacco class I isoforms: endochitinase A CHN-A (ca. 34 kDa) and endochitinase B CHN-B (ca. 32 kDa)This antibody can be used as a marker of vacuolar contents Keefe et al. (1990). The effect of ethylene on the cell-type-specific and intracellular localization of β-1,3-glucanase and chitinase in tobacco leave. Plant 182: 43-51.
PR-4 (Pathogenesis-related protein 4) involved in defence response. Similar to the antifungal chitin-binding protein hevein from rubber tree latex. mRNA levels increase in response to ethylene and turnip crinkle virus infection.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Capsicum chinense , Carica papaya, Chimonanthus praecox, Drosera adelae, Eutrema japonicum, Ficus pumila var. awkeotsang , Hevea brasiliensis, Hordeum vulgare, Glycine max, Medicago truncatula, Morus notabilis, Phaseolus vulgaris, Pisum sativum, Populus trichocarpa, Prunus dulcis, Ricinus communis, Solanum tuberosum, Theobroma cacao, Triticum aestivum, Triticum urartu , Vitis pseudoreticulata Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from Arabidopsis thaliana PR-4 protein sequence, UniProt:P43082 , TAIR:AT3G04720
PR-5 (Pathogenesis-related protein 5) is involved in plant pathogen defence.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabidopsis thaliana
Immunogen:
KLH-conjugated synthetic peptide derived from Arabidopsis thaliana UniProt: P28493,TAIR:AT1G75040The peptide is not found in other thautamin-like proteins.
The PRAME [IHC092] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC092
GMDN Code:
65250
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Melanoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
The PRAME [IHC092] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC092
GMDN Code:
65250
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Melanoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
The PRAME [IHC092] antibody is intended for qualified laboratories to qualitatively identify by light microscopy, the presence of associated antigens in formalin-fixed, paraffin-embedded (FFPE) tissue sections using immunohistochemistry test methods. Use of this antibody is indicated, subsequent to clinical differential diagnoses of diseases, as an aid in the identification of neoplastic tissues within the context of antibody panels, the patients clinical history and other diagnostic tests as evaluated by a qualified pathologist.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC092
GMDN Code:
65250
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Melanoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Plastocyanin is a “blue” copper protein which catalyzes electron transfer between the cytochrome b6 .f complex and P-700, the reaction center of photosystem I. Plastocyanin is a nuclear encoded polypeptide in all eukaryotic photosynthetic organisms where it has been studied. It is synthesized as a pre-protein of approximate molecular weight 17,000, imported post-translationally into chloroplasts, and processed to its mature form of approximate molecular weight 10,500 within the plastid.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Expected Species:
Chlorella fusca, Pediastrum boryanumSpecies of your interest not listed? Contact us
Immunogen:
GST fusion to Pre-apoplastocyanin of Chlamydomonas reinhartii P18068
This antibody is recognizing pre-apoplatosyanin 17 kDa precursor and a mature protein. There is a slight cross-reactivity with cytochreom c6 in extract from Chlamydomonas reinhardtii cells grown under conditions of cooper deficiency.
Application Details:
1 : 1000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
17 kDa (precursor)
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Li et al. (1996). Molecular genetic analysis of plastocyanin biosynthesis in Chlamydomonas reinhardtii.. J. Biol. Chem. 271:31283-31289
Special application note:
This product can be sold containing ProClin if requested.
Rabbit anti-Presenilin 1 loop region Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Presenilin-1 (PSEN1) is a multi-pass membrane protein and component of the gamma-secretase complex. PSEN1 is thought to play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. It may also play a role in hematopoiesis. Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3), a familial early-onset form of Alzheimer disease (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (GDPEAQRRVSKNSKYNA-C) corresponding to human PS1 [301-317] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blot. Suggested dilution of 1:1,000 is recommended for WB. Full length presenilin 1 (467 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 19 kDa. Human or mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Presenilin 1; PS-1; Protein S182; PS1-CTF12; PSEN1; AD3; PS1; PSNL1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by Western blotting using transfected cells, presenilin 1 knock-out mouse cells and mouse and human brain.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Chicken anti-Presenilin-1 (PS-1) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Presenilin-1 (PSEN1) is a multi-pass membrane protein and component of the gamma-secretase complex. PSEN1 is thought to play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. It may also play a role in hematopoiesis. Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3), a familial early-onset form of Alzheimer disease (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Mixture of two human Presenilin 1 peptides (311-322 and 341-352 aa). Both sequences are highly conserved in human, mouse and rat.
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
WB and ELISA. Suggested dilution of 1:1,000 to 1:4,000. To minimise background staining, a higher concentration of detergent (such as Tween-20) is suggested in the dilution and washing steps. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Presenilin 1; PS-1; Protein S182; PS1-CTF12; PSEN1; AD3; PS1; PSNL1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Presenilin 1
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Presenilin 1 (PS-1) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Presenilin-1 (PSEN1) is a multi-pass membrane protein and component of the gamma-secretase complex. PSEN1 is thought to play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. It may also play a role in hematopoiesis. Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3), a familial early-onset form of Alzheimer disease (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide corresponding to a region (1-20 aa) from the N-terminus of human Presenilin 1 conjugated to Diptheria toxoid.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
IF and WB. Suggested dilution of 1:2,000 is recommended for WB. On SDS-PAGE, the predominant form detected by this antibody is the N-terminal Presenilin 1 fragment of approx 29 kDa. The uncleaved form of Presenilin 1 migrates to approx 45 kDa. Human and mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3M), SDS (1%) in 62.5 mM Tris-HCl pH 6.8 sample buffer heated to 50C for 15 min. The suggested dilution for IF is 1:100 for acetone or paraformaldehyde fixed cells or tissue. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Presenilin 1; PS-1; Protein S182; PS1-CTF12; PSEN1; AD3; PS1; PSNL1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity confirmed by WB and IF using transfected cells, Presenilin 1 knock-out mouse cells, mouse and human brain.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Presenilin 2 loop region Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Autosomal dominant mutations in presenilin 2 are the second major cause of early-onset familial Alzheimer's disease. Presenilin 2 is a multi-transmembrane protein which undergoes endoprotelysis to form an N-terminal fragment of about 29 kDa and C-terminal fragment of about 22 kDa. Presenilin 2 forms the catalytic core of the gamma-secretase complex which cleaves type 1 transmembrane proteins including the amyloid precursor protein to generate the C-terminus of the amyloid beta peptide.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested dilution of 1:1,000 is recommended for WB. Full length presenilin 2 (448 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 22 kDa with this antibody. Human or mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. The suggested dilution for IP is 1:100 . Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
AD3LP, AD5, E5-1, STM-2
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by Western blot using mouse and human brain and knock down of presenilin 2 in vitro using siRNA see ref 6 below. Not reactive with presenilin 1.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Chicken anti-Presenilin-2 (PS-2) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Presenilin-2 (PSEN2) is a multi-pass membrane protein and component of the gamma-secretase complex. Defects in PSEN2 are a cause of Alzheimer disease type 4 (AD4), an autosomal dominant Alzheimer disease. (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Mixture of two human Presenilin 2 peptides (319-330 and 349-360 aa). Both sequences are highly conserved in human, mouse and rat.
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
WB and ELISA. Suggested dilution of 1:1,000 to 1:4,000. To minimise background staining, a higher concentration of detergent (such as Tween-20) is suggested in the dilution and washing steps. Biosensis recommends that the optimal working dilution should be determined by the end user.
PRK ribulose-5-P-kinase| phosphoribulokinase is an enzyme that catalyzes the chemical reaction ATP + D-ribulose 5-phosphate to ADP + D-ribulose 1,5-bisphosphate.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Antibody detects PRK using a load from 4-20 g/well of a chloroplast fraction, incubation over night at 4 C
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
44 | 39 kDa (A. thaliana)
Not reactive in:
Proteobacteria
Selected references:
Fukayama et al. (2018). Expression level of Rubisco activase negatively correlates with Rubisco content in transgenic rice. Photosynth Res. 2018 May 30. doi: 10.1007/s11120-018-0525-9.P rez-Ruiz et al. (2017). NTRC-dependent redox balance of 2-Cys peroxiredoxins is needed for optimal function of the photosynthetic apparatus. Proc Natl Acad Sci U S A. 2017 Nov 7;114(45):12069-12074. doi: 10.1073/pnas.1706003114.Rai et al. (2017). Real-time iTRAQ-based proteome profiling revealed the central metabolism involved in nitrogen starvation induced lipid accumulation in microalgae. Sci Rep. 2017 Apr 5;7:45732. doi: 10.1038/srep45732. (microalga, western blot)Nikkanen et al. (2016). Crosstalk between chloroplast thioredoxin systems in regulation of photosynthesis. Plant Cell Environ. 2016 Aug;39(8):1691-705. doi: 10.1111/pce.12718.
Special application note:
Antibody can be used as a marker of chloroplast stroma
PRK ribulose-5-P-kinase| phosphoribulokinase is an enzyme that catalyzes the chemical reaction ATP + D-ribulose 5-phosphate to ADP + D-ribulose 1,5-bisphosphate.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
PRK ribulose-5-P-kinase| phosphoribulokinase is an enzyme that catalyzes the chemical reaction ATP + D-ribulose 5-phosphate to ADP + D-ribulose 1,5-bisphosphate.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
PRK ribulose-5-P-kinase| phosphoribulokinase is an enzyme that catalyzes the chemical reaction ATP + D-ribulose 5-phosphate to ADP + D-ribulose 1,5-bisphosphate.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 488.
Molecular Weight:
44 | 39 kDa (A. thaliana)
Not reactive in:
Proteobacteria
Selected references:
To be added when available. Antibody released in May 2023.
Special application note:
Antibody can be used as a marker of chloroplast stroma.DyLight 488 Amax = 493 nm, Emax = 519 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
PRK ribulose-5-P-kinase| phosphoribulokinase is an enzyme that catalyzes the chemical reaction ATP + D-ribulose 5-phosphate to ADP + D-ribulose 1,5-bisphosphate.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 594.
Molecular Weight:
44 | 39 kDa (A. thaliana)
Not reactive in:
Proteobacteria
Selected references:
To be added when available. Antibody released in May 2023.
Special application note:
Antibody can be used as a marker of chloroplast stroma.DyLight 594 has Amax = 593 nm, Emax = 618 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
PRK ribulose-5-P-kinase phosphoribulokinase is an enzyme that catalyzes the chemical reaction ATP + D-ribulose 5-phosphate to ADP + D-ribulose 1,5-bisphosphate.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 650.
Molecular Weight:
44 | 39 kDa (A. thaliana)
Not reactive in:
Proteobacteria
Selected references:
To be added when available. Antibody released in May 2023.
Special application note:
Antibody can be used as a marker of chloroplast stroma.DyLight 650 has Amax = 652 nm, Emax = 672 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
PRK ribulose-5-P-kinase| phosphoribulokinase is an enzyme that catalyzes the chemical reaction ATP + D-ribulose 5-phosphate to ADP + D-ribulose 1,5-bisphosphate
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
Rabbit anti-PRKR-like endoplasmic reticulum kinase (phosphorylated and non phosphorylated) (PERK) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
PERK (PKR-like ER kinase) is a single-pass type I ER membrane protein with a stress-sensing luminal domain connected by a transmembrane segment to a cytoplasmic-kinase domain.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. 50% glycerol
Host Animal:
Rabbit
Species Reactivity:
Mouse
Immunogen:
A recombinant peptide from mouse PERK.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunoprecipitation (IP). A dilution of 1:500 is recommended for WB. A dilution of 30 µL of antibody in a total reaction mixture of 500 µL is recommended for IP. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Feliziani C. et al (2022) Ca2+ signalling system initiated by Endoplasmic reticulum stress stimulates PERK activation Cell Calcium. 2022 [Epub ahead of print] Bollo M. et al (2010) Calcineurin interacts with PERK and dephosphorylates calnexin to relieve ER stress in mammals and frogs PLoS One. 2010 Aug 5;5(8)
Specificity:
This antiserum is known to recognise both phosphorylated and non phosphorylated mouse PERK.
Storage:
Aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
PRKR-like endoplasmic reticulum kinase (phosphorylated and non phosphorylated) (PERK)
PRN2 (PIRIN) belongs to a functionally diverse cupin protein superfamily with four family members of Arabidopsis thaliana PRN proteins.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Zhang et al. (2014). PIRIN2 stabilizes cysteine protease XCP2 and increases susceptibility to the vascular pathogen Ralstonia solanacearum in Arabidopsis. Plant J. 2014 Jun 20. doi: 10.1111/tpj.12602.
Brain derived neurotrophic factor (BDNF) is synthesized as a precursor (proBDNF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proBDNF is synthesized in neurons and glia (eg., microglia), transported anterogradely and retrogradely and may be released in an activity dependent manner.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a solution containing PBS buffer pH 7.4 with 3% trehalose, without preservatives.
Host Animal:
Mouse
Species Reactivity:
Human,Mouse (Predicted),Rat
Immunogen:
A synthetic peptide (C-NGPKAGSRGLTS, aa: 47-58) of human proBDNF protein has been used as the immunogen. The sequence is located on the pro-domain of the proBDNF full-length protein.
Applications:
FC,ICC
Clone number:
BS375
Antibody Isotype:
IgG1, kappa
Application Details:
Flow Cytometry (2 ug/10<sup>6</sup> cells).<br>Immunocytochemistry (1-2 µg/mL).<br>Other applications not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Abrineurin
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Not yet tested. Antibody may detect mouse and rat proBDNF protein due to high degree of amino acid sequence homology.
Storage:
After reconstitution divide into aliquots and store at -20°C for a higher stability. Antibody contains no preservatives. Store at 2-8°C with an appropriate antibacterial agent. Use sterile methods. Highest purity Glycerol (1:1) may be added for an additional stability when stored at refrigerated or freezing temperatures. Avoid repetitive freeze/thaw cycles.
BDNF belongs to the neurotrophin family and regulates the survival and differentiation of neurons during development. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. FUNCTION: Promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. Post Translation Modification (PTM): The propeptide is N-glycosylated and glycosulfated. PTM: Converted into mature BDNF by plasmin (PLG) (By similarity). DISEASE: Defects in BDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. CCHS is frequently complicated with neurocristopathies such as Hirschsprung disease that occurs in about 16% of CCHS cases. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Immunogen:
A synthetic peptide (C-ELLDEDQKVRPNEE) as a part of human BDNF precursor protein (aa: 69-82) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1:1000 to 1:5000 is recommended for both applications. ICC: 1:500 to 1:2000, antibody works on 4% formaldehyde fixed cells. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Used in western blot, this antiserum detects a 35 kDa band corresponding to the molecular weight of proBDNF. No cross reactivity with other proneurotrophins was detected. This antiserum is known to react with human, mouse and rat proBDNF and also expected to recognise other mammalian proBDNF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
BDNF belongs to the neurotrophin family and promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. Post translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Immunogen:
A synthetic peptide (C-ELLDEDQKVRPNEE) as a part of human BDNF precursor protein (aa: 69-82) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, WB. 1-5 µg/mL is recommended for both applications, Flow Cytometry (2?g/10^6 cells). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Le Blanc J et al. (2020) Platelets Selectively Regulate the Release of BDNF, But Not That of Its Precursor Protein, proBDNF. Front Immunol. 11:575607 Application: Human, WB. Macias M et al. (2007) Locomotor exercise alters expression of pro-brain-derived neurotrophic factor, brain-derived neurotrophic factor and its receptor TrkB in the spinal cord of adult rats. Eur J Neurosci. 25(8):2425-44 Application: Rat
Specificity:
Used in western blot, this antiserum detects a 35 kDa band corresponding to the molecular weight of proBDNF. No cross reactivity with other proneurotrophins was detected. This antibody is known to react with human, mouse and rat proBDNF and also expected to recognise other mammalian proBDNF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Brain derived neurotrophic factor (BDNF) is synthesized as a precursor (proBDNF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proBDNF is synthesized in neurons and glia (eg., microglia), transported anterogradely and retrogradely and may be released in an activity dependent manner. This antibody is raised in sheep to detect the prodomain of BDNF and not the mature peptide.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
The recombinant prodomain fragment of human brain-derived neurotrophic factor
Applications:
ELISA,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
ELISA, Western Blot, biological neutralization of proBDNF, Immunocytochemistry/Immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Proform brain derived neurotrophic factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed to react with purified human proBDNF, crossreact with mouse and rat proBDNF Cross reactivity with other species than human, mouse and rat has not yet been tested
Storage:
After reconstitution keep aliquots at -20ºC for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Progesterone Receptor (PR), also known as NR3C3 (Nuclear Receptor Subfamily 3, Group C, Member 3), is an intracellular steroid receptor which mediates the physiological effects of progesterone, a female sex hormone involved in the menstrual cycle, pregnancy, and embryogenesis. Progesterone receptor expression has been linked to the prediction of prognosis in breast cancer, as well as associated responses to endocrine therapy. The progesterone receptor has also been linked to risk for ovarian cancer.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC751
Antibody Isotype:
IgG1, kappa
GMDN Code:
57534
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Breast, Breast Carcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Progesterone Receptor (PR), also known as NR3C3 (Nuclear Receptor Subfamily 3, Group C, Member 3), is an intracellular steroid receptor which mediates the physiological effects of progesterone, a female sex hormone involved in the menstrual cycle, pregnancy, and embryogenesis. Progesterone receptor expression has been linked to the prediction of prognosis in breast cancer, as well as associated responses to endocrine therapy. The progesterone receptor has also been linked to risk for ovarian cancer.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC751
Antibody Isotype:
IgG1, kappa
GMDN Code:
57534
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Breast, Breast Carcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Progesterone Receptor (PR), also known as NR3C3 (Nuclear Receptor Subfamily 3, Group C, Member 3), is an intracellular steroid receptor which mediates the physiological effects of progesterone, a female sex hormone involved in the menstrual cycle, pregnancy, and embryogenesis. Progesterone receptor expression has been linked to the prediction of prognosis in breast cancer, as well as associated responses to endocrine therapy. The progesterone receptor has also been linked to risk for ovarian cancer.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC751
Antibody Isotype:
IgG1, kappa
GMDN Code:
57534
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Breast, Breast Carcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Mouse anti-Pro-glial cell line-derived neurotrophic factor (proGDNF) Monoclonal Antibody (Unconjugated), suitable for ICC, FC.
Background Info:
Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake (Ref: uniprot.org). ProGDNF is the unprocessed precursor molecule of mature GDNF and exists as homodimer.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a solution containing PBS buffer pH 7.4 with 3% trehalose, without preservatives.
Host Animal:
Mouse
Species Reactivity:
Human,Mouse (Predicted),Rat
Immunogen:
A synthetic peptide (C-EDYPDQFDDVMD, aa: 55-66) of human proGDNF protein has been used as the immunogen. The sequence is located on the pro-domain of the proGDNF full-length protein and is homologous with mouse and rat form of proGDNF.
Applications:
FC,ICC
Clone number:
BS376
Antibody Isotype:
IgG3, kappa
Application Details:
Flow Cytometry (2 ug/ 10<sup>6</sup> cells). Immunocytochemistry (1-2 µg/mL). Other applications not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human Rat. Antibody is expected to detect mouse proGDNF protein due to 100% amino acid sequence homology.
Storage:
After reconstitution divide into aliquots and store at -20°C for a higher stability. Antibody contains no preservatives. Store at 2-8°C with an appropriate antibacterial agent. Use sterile methods. Highest purity Glycerol (1:1) may be added for an additional stability when stored at refrigerated or freezing temperatures. Avoid repetitive freeze/thaw cycles.
Prolactin (PRL) is a peptide hormone synthesized and secreted by lactotroph cells in the adenohypophysis (anterior pituitary gland). PRL plays a role in a number of processes including cell growth, reproduction, and immune function, with its primary function being associated with lactation. Anti-Prolactin reacts with lactotroph cells, and is useful in classification of pituitary tumours and the study of pituitary disease.
Prolactin (PRL) is a peptide hormone synthesized and secreted by lactotroph cells in the adenohypophysis (anterior pituitary gland). PRL plays a role in a number of processes including cell growth, reproduction, and immune function, with its primary function being associated with lactation. Anti-Prolactin reacts with lactotroph cells, and is useful in classification of pituitary tumours and the study of pituitary disease.
Prolactin (PRL) is a peptide hormone synthesized and secreted by lactotroph cells in the adenohypophysis (anterior pituitary gland). PRL plays a role in a number of processes including cell growth, reproduction, and immune function, with its primary function being associated with lactation. Anti-Prolactin reacts with lactotroph cells, and is useful in classification of pituitary tumours and the study of pituitary disease.
Nerve growth factor (NGF) is synthesized as a precursor (proNGF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proNGF is synthesized in target tissues and glia, transported retrogradely and may be released.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a solution containing PBS buffer pH 7.4 with 3% trehalose, without preservatives.
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
A synthetic peptide (C-HTIPQAHWTKLQ, aa: 30-41) of human proNGF protein has been used as the immunogen. The sequence is located on the pro-domain of the proNGF full-length protein and is 80% homologous to mouse and rat proNGF.
Applications:
FC,ICC,WB
Clone number:
BS312
Antibody Isotype:
IgG2b, lambda
Application Details:
Flow Cytometry (2 ug/ 10^6 cells). Immunocytochemistry (1-2 µg/mL), Western Blotting (1-2 µg/mL). Other applications not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Pro-brain nerve growth factor; proNGF; NGF
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Species cross-reactivity not tested.
Storage:
Store lyophilized antibody at 2-8ºC. After reconstitution divide into aliquots and store at -20°C for a higher stability. Antibody contains no preservatives. Store at 2-8°C with an appropriate antibacterial agent. Use sterile methods. Highest purity Glycerol (1:1) may be added for an additional stability when stored at refrigerated or freezing temperatures. Avoid repetitive freeze/thaw cycles.
Nerve growth factor (NGF) is synthesized as a precursor (proNGF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proNGF is synthesized in target tissues and glia, transported retrogradely and may be released.<br /><br />Biosensis now offers <strong>biotinylated proNGF antibody</strong> allowing more flexibility in experimental design by using the biotin-avidin/streptavidin detection method. The ability of biotinylated proNGF antibody to detect proNGF has been validated by WB.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from a solution containing PBS buffer pH 7.4 with 3% trehalose, without preservatives.
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
A synthetic peptide (C-HTIPQAHWTKLQ, aa: 30-41) of human proNGF protein has been used as the immunogen. The sequence is located on the pro-domain of the proNGF full-length protein and is 80% homologous to mouse and rat proNGF.
Applications:
WB
Clone number:
BS312
Antibody Isotype:
IgG2, lambda
Application Details:
The biotinylated proNGF antibody has been tested by Western Blotting (0.1-0.5 µg/mL) and is also expected to work in applications validated for the unlabelled antibody M-1738-100 at same or higher dilutions: Flow Cytometry and Immunofluorescence.<br><br>Other applications not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Pro-brain nerve growth factor; proNGF; NGF
Biosensis Brand:
Biosensis®
Conjugate:
Biotin
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Species cross-reactivity not tested.
Storage:
After reconstitution divide into aliquots and store at -20°C for a higher stability. Antibody contains no preservatives. Store at 2-8°C with an appropriate antibacterial agent. Use sterile methods. Highest purity Glycerol (1:1) may be added for an additional stability when stored at refrigerated or freezing temperatures. Avoid repetitive freeze/thaw cycles.
Purification:
Antibody was purified from cell culture supernatant by Protein G chromatography, biotinylated and buffer-exchanged into PBS, pH 7.4 buffer
Nerve growth factor (NGF) is synthesized as a precursor (proNGF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proNGF is synthesized in target tissues and glia, transported retrogradely and may be released. This antibody is raised in sheep to detect the prodomain of NGF not the mature peptide.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
The recombinant prodomain fragment of human nerve growth factor
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, Immunofluorescence, ELISA, Western Blot, biological neutralization of proNGF. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
pro-brain nerve growth factor; proNGF; NGF;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Sugimoto J et al. (2021). Fabry disease-associated globotriaosylceramide induces mechanical allodynia via activation of signaling through proNGF p75NTR but not mature NGF TrkA. Eur. J. Pharmacol. 895. Application: Neutralising ( in-vivo ). Ryu JC et al. (2018). Role of proNGF/p75 signaling in bladder dysfunction after spinal cord injury. J Clin Invest. [Epub ahead of print]. Application: Western Blotting.
Specificity:
The specificity of this antibody has been confirmed by WB. It does NOT crossreact with proBDNF, proNT-3 or mature NGF. Confirmed to react with purified human proNGF and crossreact with mouse and rat proNGF
Storage:
Maintain lyophilized antibody at 2-8°C for up to 12 months after date of receipt. After reconstitution keep undiluted aliquots at -20°C for up to 6 months for higher stability or at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
PROPEP1 (cleaved and matured) act as elicitor of plant defense. Induces the production of plant defensin (PDF1.2) and of hydrogen peroxide (components of the innate immune response), which promote resistance to the root fungal pathogen P.irregulare.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store at -20 °C; make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabidopsis thaliana
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana C-terminal of PROPEP1, UniProt: Q9LV87-1, TAIR: At5g64900 The peptide has 84 % homology to PROPE2.
Prostate Cocktail is a combination of Cytokeratin 1, Cytokeratin 5, Cytokeratin 10, Cytokeratin 14, and p63. These four high molecular weight cytokeratins are found in basal epithelia of the prostate gland. p63 is a tumour suppressor protein found in basal epithelial nuclei of the normal prostate, while being negative in malignant tumours associated with the prostate gland. It is therefore useful in differentiating between benign and malignant prostate lesions.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC653
GMDN Code:
57548
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Prostate
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Prostate Cocktail is a combination of Cytokeratin 1, Cytokeratin 5, Cytokeratin 10, Cytokeratin 14, and p63. These four high molecular weight cytokeratins are found in basal epithelia of the prostate gland. p63 is a tumour suppressor protein found in basal epithelial nuclei of the normal prostate, while being negative in malignant tumours associated with the prostate gland. It is therefore useful in differentiating between benign and malignant prostate lesions.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC653
GMDN Code:
57548
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Prostate
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Prostate Cocktail is a combination of Cytokeratin 1, Cytokeratin 5, Cytokeratin 10, Cytokeratin 14, and p63. These four high molecular weight cytokeratins are found in basal epithelia of the prostate gland. p63 is a tumour suppressor protein found in basal epithelial nuclei of the normal prostate, while being negative in malignant tumours associated with the prostate gland. It is therefore useful in differentiating between benign and malignant prostate lesions.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC653
GMDN Code:
57548
UKCA Status:
UKCA
CE-IVD Status:
IVDD
Positive Control:
Prostate
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Prostate-Specific Antigen (PSA) is a serine protease of the kallikrein family that is produced by the prostate epithelium and epithelial lining of the periurethral glands. Although considered prostate-specific, PSA has also been detected in breast tissue, breast tumours, endometrium, adrenal neoplasms, and renal cell carcinomas. Anti-PSA can be used for differentiating high-grade prostate adenocarcinoma from high-grade urothelial carcinoma, as well as for determining the prostatic origin of carcinomas in non-prostate tissues. Anti-PSA recognizes primary and metastatic prostatic neoplasms, but not tumours of nonprostatic origin, and can be useful as an aid to confirm prostatic acinar cell origin in primary and metastatic carcinomas.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC720
GMDN Code:
57548
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Prostate, Prostate Carcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Prostate-Specific Antigen (PSA) is a serine protease of the kallikrein family that is produced by the prostate epithelium and epithelial lining of the periurethral glands. Although considered prostate-specific, PSA has also been detected in breast tissue, breast tumours, endometrium, adrenal neoplasms, and renal cell carcinomas. Anti-PSA can be used for differentiating high-grade prostate adenocarcinoma from high-grade urothelial carcinoma, as well as for determining the prostatic origin of carcinomas in non-prostate tissues. Anti-PSA recognizes primary and metastatic prostatic neoplasms, but not tumours of nonprostatic origin, and can be useful as an aid to confirm prostatic acinar cell origin in primary and metastatic carcinomas.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Concentrate
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC720
GMDN Code:
57548
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Prostate, Prostate Carcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Prostate-Specific Antigen (PSA) is a serine protease of the kallikrein family that is produced by the prostate epithelium and epithelial lining of the periurethral glands. Although considered prostate-specific, PSA has also been detected in breast tissue, breast tumours, endometrium, adrenal neoplasms, and renal cell carcinomas. Anti-PSA can be used for differentiating high-grade prostate adenocarcinoma from high-grade urothelial carcinoma, as well as for determining the prostatic origin of carcinomas in non-prostate tissues. Anti-PSA recognizes primary and metastatic prostatic neoplasms, but not tumours of nonprostatic origin, and can be useful as an aid to confirm prostatic acinar cell origin in primary and metastatic carcinomas.
Product Type:
Primary Antibody
Antibody Type:
Monoclonal
Format:
Predilute
Storage Temp:
2-8 degrees Celsius
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant Protein
Applications:
IHC
Clone number:
IHC720
GMDN Code:
57548
UKCA Status:
UKCA
CE-IVD Status:
RUO
Positive Control:
Prostate, Prostate Carcinoma
Purification:
Affinity Purification
Buffer:
Tris Buffer pH7.6 with BSA, and sodium azide as preservative
Rabbit anti-Protein painting of fourth Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
Protein painting of fourth (Pof) is a probable RNA-binding protein that binds to the fourth chromosome and may bind a RNA that spreads the fourth chromosome (Ref: Swissprot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS (pH 7.4) with 0.02% Sodium azide added
Host Animal:
Rabbit
Species Reactivity:
Drosophila
Immunogen:
A synthetic peptide from Drosophila melanogaster Protein painting of fourth (22-36 aa) conjugated to KLH.
Applications:
ELISA
Antibody Isotype:
IgG
Application Details:
ELISA. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Zeste-interacting protein 16; Zip16; Pof;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Protein painting of fourth ;Zeste-interacting protein 16;
Storage:
Store lyophilized product at -20°C or below. After reconstitution, keep aliquots for 2-3 weeks at 2-8°C or at -20°C for up to 12 months. Avoid repetitive freeze/thaw cycles.
Chicken anti-Proto-oncogene tyrosine-protein kinase receptor Ret (RET) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
The RET proto-oncogene is a receptor tyrosine kinase for members of the glial cell line-derived neurotrophic factor family of extracellular signalling molecules
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid: Concentrated ammonium sulphate in PBS pH 7.4
Host Animal:
Chicken
Species Reactivity:
Human
Immunogen:
Recombinant His-tagged extracellular fragment of human RET protein produced using CHO cell line. The extracellular fragment of hRET was expressed and secreted to the cell culture supernatant. Protein was purified by Ni-affinity chromatography following gel-filtration from cell culture supernatant.
Applications:
ICC,WB
Antibody Isotype:
IgY
Application Details:
WB, ICC. A dilution of 1:5 000 to 1:10 000 is recommended for Western blot and 1:250 to 1:500 for immunocytochemistry. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Cadherin family member 12; Ret;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human RET
Storage:
Store at 2-8°C upon receipt; DO NOT FREEZE. As product is (NH4)2SO4 (ammonium sulfate) precipitate, mix well by pipetting or vortexing prior to use. See reconstitution instructions for more information.
Purification:
Affinity purified
Target:
Proto-oncogene tyrosine-protein kinase receptor Ret (RET)
PRP39a (pre-mRNA-processing factor 39) is involved in RNA processing, mRNA 5'-splice site recognition, regulation of timing of transition from vegetative to reproductive phase.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica rapa Species of your interest not listed? Contact us
Immunogen:
Recombinant, full length PRP39a of Arabidopsis thaliana , UniProt: F4I448, TAIR: At1g04080
PRP40B (pre-mRNA-processing protein 40B) protein that binds the carboxyl-terminal domain (CTD) of the largest subunit of RNA polymerase II and functions as a scaffold for RNA processing machineries. Ubiquitously expressed and localized to the nucleus.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica rapa Species of your interest not listed? Contact us
Peroxiredoxins (EC=1.11.1.15) belong to the enzyme family which is ubiquitous in all kingdoms of life. Prx Q enzyme acting by reducing hydroperoxides. Peroxiredoxins have no heme group, unlike the other peroxidases, but perform their enzymatic activity using cysteine residues with redox-active thiol groups. The ability of peroxiredoxins to hydrolyze hydroperoxides suggests that this protein family has a general function in oxidant defence.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Marchantia polymorpha, Populus sp. , Triticum aestivum, Oryza sativa Species of your interest not listed? Contact us
Immunogen:
His-tagged full length protein (with presequence) of Arabidopsis thaliana was overexpressed in in E.coli. Isolated with HiTrap column (GE Healthcare) Q9LU86, At3g26060
In stroma fractions a weak background reaction at 28 kDa is visible, No crossreactivity in any thylakoid fractions
Application Details:
1 : 5000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 200 l of sterile water
Molecular Weight:
16 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Yoshida et al. (2018). Thioredoxin-like2/2-Cys peroxiredoxin redox cascade supports oxidative thiol modulation in chloroplasts. Proc Natl Acad Sci U S A. 2018 Aug 13. pii: 201808284. doi: 10.1073/pnas.1808284115.Yoshida et al. (2016). Hisabori T1.Two distinct redox cascades cooperatively regulate chloroplast functions and sustain plant viability. Proc Natl Acad Sci U S A. 2016 Jul 5;113(27):E3967-76. doi: 10.1073/pnas.1604101113. Epub 2016 Jun 22.Yoshida et al. (2015). Thioredoxin Selectivity for Thiol-Based Redox Regulation of Target Proteins in Chloroplasts. J Biol Chem. 2015 Apr 15. pii: jbc.M115.647545.Feifei et al. (2014). Comparison of Leaf Proteomes of Cassava (Manihot esculenta Crantz) Cultivar NZ199 Diploid and Autotetraploid Genotypes. PLoS One. 2014 Apr 11;9(4):e85991. doi: 10.1371/journal.pone.0085991. eCollection 2014.Wu et al. (2013). Proteomic and Phytohormone Analysis of the Response of Maize (Zea mays L.) Seedlings to Sugarcane Mosaic Virus. PLoS One. July 23;8(7).
Special application note:
This product can be sold containing proclin if requested
PSA2 (Photosystem I assembly factor 2) is a protein coded by a gene belonging to the "Green Cut" set, found only in green algae and plants but not in non-photosynthetic organisms. PSA2 is localized in thylakoid lumen.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica rapa Species of your interest not listed? Contact us
Immunogen:
recombinant protein corresponding to amino acids 87 to 186 of Arabidopsis thaliana PSA2, UniProt:O64750, TAIR: AT2G34860
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Fristedt et al. (2014). A Thylakoid Membrane Protein Harboring a DnaJ-type Zinc Finger Domain is Required for Photosystem I Accumulation in Plants. J Biol Chem. 2014 Sep 16. pii: jbc.M114.587758.
PSA3 (Photosystem I Assembly 3) is involved in promotion of photosystem I biogenesis in angiosperms. It is a nucleus-encoded protein.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles,Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Zea mays
Immunogen:
Recombinant PSA3, amino acids 110 to 269 derived from Zea mays Zm00001d013295
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Shen J, Williams-Carrier R, and Barkan A. (2017) PSA3, a protein on the stromal face of the thylakoid membrane, promotes photosystem I accumulation in cooperation with the assembly factor PYG7. Plant Physiol. 2017 Jul;174(3):1850-1862. doi: 10.1104/pp.17.00524.
PsaA is a core protein of photosystem I. In plants and cyanobacteria, the primary step in oxygenic photosynthesis, the light induced charge separation, is driven bytwo large membrane intrinsic protein complexes, the photosystems I and II. Synonym: Photosystem I P700 chlorophyll a apoprotein A1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Immunogold localization has been done in leaf material of Arabidopsis thaliana.
Application Details:
1 : 20 (IG), 1 : 1000-1 : 5000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
82 | 55-60 kDa
Not reactive in:
Chromera velia
Selected references:
Ivanov et al. (2022) The decreased PG content of pgp1 inhibits PSI photochemistry and limits reaction center and light-harvesting polypeptide accumulation in response to cold acclimation. Planta 255, 36 (2022). https://doi.org/10.1007/s00425-022-03819-0Lim et al (2022). Arabidopsis guard cell chloroplasts import cytosolic ATP for starch turnover and stomatal opening. Nat Commun. 2022 Feb 3;13(1):652. doi: 10.1038/s41467-022-28263-2. PMID: 35115512; PMCID: PMC8814037.Lim et al (2022) Arabidopsis guard cell chloroplasts import cytosolic ATP for starch turnover and stomatal opening. Nat Commun. 2022 Feb 3;13(1):652. doi: 10.1038/s41467-022-28263-2. PMID: 35115512; PMCID: PMC8814037.Spaniol et al. (2022) Complexome profiling on the Chlamydomonas lpa2 mutant reveals insights into PSII biogenesis and new PSII associated proteins, Journal of Experimental Botany, Volume 73, Issue 1, 5 January 2022, Pages 245–262Rogowski et al. (2021) Light as a substrate: migration of LHCII antennas in extended Michaelis-Menten model for PSI kinetics. J Photochem Photobiol B. 2021 Dec;225:112336. doi: 10.1016/j.jphotobiol.2021.112336. Epub 2021 Oct 19. PMID: 34736069.
Special application note:
PsaA is a hydrophobic protein and we recommend to use PVDF membrane for transfer to assure best results.This product can be sold containing ProClin if requested.
Photosystem I (PSI) of chloroplasts is a multisubunit membrane-protein complex that catalyzes the electron transfer from the reduced plastocyanin (or cytochrome c6) in the thylakoid lumen to the oxidized ferredoxin (or flavodoxin) in the chloroplast stroma. PsaB is a core protein of PSI complex. Synonymes: Photosystem I P700 chlorophyll a apoprotein A2, PSI-B
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
This product can be sold containing ProClin if requested
Application Details:
1 : 1000 (BN-PAGE), (WB)
Purity:
Antigen affinity purified in PBS pH 7.4
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
82,7 | 55-60 kDa
Not reactive in:
Chlamydomonas reinhardtii, dinoflagellate
Selected references:
Shukla et al. (2020). A novel method produces native LHCII aggregates from the photosynthetic membrane revealing their role in non-photochemical quenching. J Biol Chem. 2020 Oct 20:jbc.RA120.016181. doi: 10.1074/jbc.RA120.016181. Epub ahead of print. PMID: 33082138.Grieco et al. (2020). Adjustment of photosynthetic activity to drought and fluctuating light in wheat. Plant Cell Environ. 2020 Mar 16. doi: 10.1111/pce.13756. Liu et al. (2020). Acid treatment combined with high light leads to increased removal efficiency of Ulva prolifera. Algal Research,Volume 45, January 2020, 101745Frede et al. (2019). Light quality-induced changes of carotenoid composition in pak choi Brassica rapa ssp. chinensis. J Photochem Photobiol B. 2019 Apr;193:18-30. doi: 10.1016/j.jphotobiol.2019.02.001.Lima-Melo et al. (2019). Consequences of photosystem-I damage and repair on photosynthesis and carbon use in Arabidopsis thaliana. Plant J. 2018 Nov 29. doi: 10.1111/tpj.14177.
Prostate-Specific Antigen (PSA) is a serine protease of the kallikrein family that is produced by the prostate epithelium and epithelial lining of the periurethral glands. Although considered prostate-specific, PSA has also been detected in breast tissue, breast tumours, endometrium, adrenal neoplasms, and renal cell carcinomas. Anti-PSA can be used for differentiating high-grade prostate adenocarcinoma from high-grade urothelial carcinoma, as well as for determining the prostatic origin of carcinomas in non-prostate tissues. Anti-PSA recognizes primary and metastatic prostatic neoplasms, but not tumours of nonprostatic origin, and can be useful as an aid to confirm prostatic acinar cell origin in primary and metastatic carcinomas.
Prostate-Specific Antigen (PSA) is a serine protease of the kallikrein family that is produced by the prostate epithelium and epithelial lining of the periurethral glands. Although considered prostate-specific, PSA has also been detected in breast tissue, breast tumours, endometrium, adrenal neoplasms, and renal cell carcinomas. Anti-PSA can be used for differentiating high-grade prostate adenocarcinoma from high-grade urothelial carcinoma, as well as for determining the prostatic origin of carcinomas in non-prostate tissues. Anti-PSA recognizes primary and metastatic prostatic neoplasms, but not tumours of nonprostatic origin, and can be useful as an aid to confirm prostatic acinar cell origin in primary and metastatic carcinomas.
PsaC is a conserved, chloroplast-encoded, Fe-S binding protein of approximately 10kDa, present in all known Photosystem I complexes. It is located on the stromal side of the thylacoid membranes. PsaC coordinates the Fe–S clusters FA and FB through two cysteine-rich domains.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
In some species minor cross reactions with some larger proteins are seen. These may contain related iron-sulfur binding motifs. Therefore size verification of the reacting band is required. Due to the small size of the protein, care should be taken to differentiate between chemiluminescent signal from PsaC and non-specific signals from chlotophylls or lipids if pigment is retained near the bottom of the blot.For the most optimal results use:thylakoid membranes or PSI particles, solubilized in a SDS sample buffer (final concentrations: 63 mM Tris HCl, 10% glycerol, 2% SDS, 0.0025% bromophenol blue) with 2.5% beta-mercaptoethanol at 85C for 2 minutes. The samples were spun softly, then the supernatant loaded. This product can be sold containing ProClin if requested.
Application Details:
1 : 5000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
9 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Burlacot et al. (2022) Alternative photosynthesis pathways drive the algal CO2-concentrating mechanism. Nature 605, 366–371 (2022). https://doi.org/10.1038/s41586-022-04662-9Ye et al. (2022) Effect of increased CO2 on iron-light-CO2 co-limitation of growth in a marine diatom, ASLO, Limnol. Oceanogr. 2022, 172-176Rogowski et al. (2021) Light as a substrate: migration of LHCII antennas in extended Michaelis-Menten model for PSI kinetics. J Photochem Photobiol B. 2021 Dec;225:112336. doi: 10.1016/j.jphotobiol.2021.112336. Epub 2021 Oct 19. PMID: 34736069.Levitan et al. (2019). Structural and functional analyses of photosystem II in the marine diatom Phaeodactylum tricornutum. Proc Natl Acad Sci U S A. 2019 Aug 27;116(35):17316-17322. doi: 10.1073/pnas.1906726116.Zavrel et al. (2019). Quantitative insights into the cyanobacterial cell economy. Elife. 2019 Feb 4;8. pii: e42508. doi: 10.7554/eLife.42508.
Special application note:
Peptide target used to elicit this antibody is well conserved in all photoautotrophs except some cyanobacteria, some red algae and Cyanophora paradoxa, which contain a conserved substitution of a valine to an isoleucine. The performance of the antibodies has been confirmed against taxa containing both the valine and isoleucine variants.Example of a simulataneous western blot detection with RbcL, PsbA and PsaC antibodies. More information about quantitative western blot using PsaC antibody can be found here.
PsaC is a conserved, chloroplast-encoded, Fe-S binding protein of approximately 10kDa, present in all known Photosystem I complexes. It is located on the stromal side of the thylacoid membranes. PsaC coordinates the Fe–S clusters FA and FB through two cysteine-rich domains.This product is a recombinant protein standard, source: Synechocystis PCC 6803.The PsaC protein standard can be used in combination with global anti-PsaC antibodies to quantitate PsaC from a wide range of species. Global antibodies are raised against highly conserved amino acid sequences in the PsaC protein.Quantitative western blot: detailed method description, video tutorial
Product Type:
Antibody
Format:
Lyophilized in glycerol.
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Protein standard buffer composition: Protein standard buffer composition: Glycerol 10%, Tris Base 141 mM, Tris HCl 106 mM, LDS 2%, EDTA 0.51 mM, SERVA Blue G250 0.22 mM, Phenol Red 0.175 mM, pH 8.5, 0.1mg/ml PefaBloc protease inhibitor (Roche), 50mM DTT.
Application Details:
Positive control: a 2 μL load per well is optimal for most chemiluminescent detection systems. Standard curve: 3 loads are recommended (eg. 0.5, 2 and 4μL). For most applications a sample load of 0.2 μg of chlorophyll will give a PsaC signal in this range. Exact loads can vary with the sensitivity of your system and the abundance of the target protein in your samples. Note: Optimal quantitation is achieved using moderate sample loads/well, generally 1 to 5 ug total protein. A trial experiment may be required i) to bring your sample load within the standard curve range and ii) to obtain a signal that is strong enough to reliably quantify but not so strong as to consume ECL reagents too quickly or saturate your detection system. These goals may achieved by adjusting both sample and standard loads.
Reconstitution:
For reconstitution add 95 l of sterile water. Note that due to glycerol in buffer, the lyophilized product appears as a dense liquid rather than a powder. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently. Avoid vigorous vortexing, as buffer contains detergent. Upon reconstitution, this standard is ready-to-load and does not require any additions or heating. See additional Handling Instructions below. PsaC standard protein concentration: 0.10 pmol/ l.
Molecular Weight:
11,5 kDa (larger than native protein due to the addition of His-tag), In most gels PsaC migrates between 9 and 14 kDa
Selected references:
Pipitone et al. (2021). A multifaceted analysis reveals two distinct phases of chloroplast biogenesis during de-etiolation in Arabidopsis. Elife. 2021 Feb 25;10:e62709. doi: 10.7554/eLife.62709. PMID: 33629953; PMCID: PMC7906606.Rogowski et al. (2021) Light as a substrate: migration of LHCII antennas in extended Michaelis-Menten model for PSI kinetics. J Photochem Photobiol B. 2021 Dec;225:112336. doi: 10.1016/j.jphotobiol.2021.112336. Epub 2021 Oct 19. PMID: 34736069.Levitan et al. (2019). Structural and functional analyses of photosystem II in the marine diatom Phaeodactylum tricornutum. Proc Natl Acad Sci U S A. 2019 Aug 27;116(35):17316-17322. doi: 10.1073/pnas.1906726116.Li et al. (2016). A Hard Day's Night: Diatoms Continue Recycling Photosystem II in the Dark. Front. Mar. Sci., 08 November 2016 | http://dx.doi.org/10.3389/fmars.2016.00218Vandenhecke et al. (2015). Changes in the Rubisco to photosystem ratio dominates photoacclimation across phytoplankton taxa. Photosynth Res. 2015 Apr 11.
Special application note:
Handling Instructions*IMPORTANT: In our experience, viscous liquids are surprisingly stable; insufficient mixing is the most common reason for unsatisfactory results. Following mixing, briefly pulse in a microcentrifuge to collect material from cap.Standard needs to be fully thawed and thoroughly mixed before each use. Proteins tend to stratify with the more dense layer after freezing. We recommend bringing the product to room temperature and either mixing by inverting or flicking tube 5-10 times. Pipetting up and down may also provide sufficient mixing, provided the tip is moved within the tube while taking up and expelling the liquid.
PsaD (PSI-D) is a core subunit of photosystem I highly conserved in all photosynthetic organisms (including bacteria with Fe-S type reaction centers). In eukaryots its encoded by 1 to 2 nuclear gene(s) and imported as a precursor into the chloroplast. In the thylakoid membrane it associates with PsaA and PsaB on the stromal site of the PSI core forming the Fd-docking site. PsaD is also required for the stable assembly of PsaC.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Alge, Dicots, Catalpa bungei, Cucumis melo, Conifers, Cyanidioschyzon merolae, Bigelowiella natans, Nannochloropsis sp. , Phaeodactylum tricornutum, Phyla dulcis, Zosteria marinaSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide 100% conserved in all known plant PsaD sequences including Arabidopsis thaliana PSI-D1 UniProt:Q9S7H1 , TAIR: At4g02770 and PSI-D2 UniProt: Q9SA56 , TAIR At1g03130 as well as Physcomitrella patens. The conservation in Chlamydomonas reinhardtii is high (14 of 16 aminoacids are identical).
Applications:
Clear-native PAGE (CN-PAGE), Immunoprecipitation (IP), Western blot (WB)
This antibody is a replacement for former product, anti-PsaD AS04 046 Contains 0.1% ProClin.
Application Details:
1: 10 000 (CN-PAGE), 1 : 1000 - 1: 5 000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
17.9 | 20 (for Arabidopsis thaliana)
Not reactive in:
Synechococcus elongatus sp. PCC 7942
Selected references:
Ivanov et al. (2022) The decreased PG content of pgp1 inhibits PSI photochemistry and limits reaction center and light-harvesting polypeptide accumulation in response to cold acclimation. Planta 255, 36 (2022). https://doi.org/10.1007/s00425-022-03819-0Fukura et al. (2021) Enrichment of chlorophyll catabolic enzymes in grana margins and their cooperation in catabolic reactions. J Plant Physiol. 2021 Nov;266:153535. doi: 10.1016/j.jplph.2021.153535. Epub 2021 Sep 25. PMID: 34607178.Fattore et al. (2021). Acclimation of photosynthetic apparatus in the mesophilic red alga Dixoniella giordanoi. Physiol Plant. 2021 Nov;173(3):805-817. doi: 10.1111/ppl.13489. Epub 2021 Jul 5. PMID: 34171145; PMCID: PMC8596783.Chen et al. (2021)Degradation of the photosystem II core complex is independent of chlorophyll degradation mediated by Stay-Green Mg2+ dechelatase in Arabidopsis,Plant Science,Volume 307,2021,110902,ISSN 0168-9452,https://doi.org/10.1016/j.plantsci.2021.110902. Pipitone et al. (2021). A multifaceted analysis reveals two distinct phases of chloroplast biogenesis during de-etiolation in Arabidopsis. Elife. 2021 Feb 25;10:e62709. doi: 10.7554/eLife.62709. PMID: 33629953; PMCID: PMC7906606.
Special application note:
PsaD has frequently been used as a marker for intact PSI reaction centers.This product can be sold containing proclin if requested.
PsaD (PSI-D subunit of photosystem I) can form complexes with ferredoxin and ferredoxin-oxidoreductase in photosystem I (PS I) reaction center. Alternative names: Photosystem I 20 kDa subunit, PSI-D.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles, Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Immunogen:
PsaD of Chlamydomonas reinhardtii, UniProt: Q39615
PsaE is a nucleus encoded subunit of the Photosystem I reaction center. It is located on the stroma side and interacts with PsaF. PsaE may be involved in Fd reduction.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Hordeum vulgare
Expected Species:
Chlamydomonas reinhardtii, Chlorella, Oryza sativa, Populus canadensis, Solanum lycopersicum, Spinacia oleracea, Zea mays Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from PsaE N-terminal part, conserved in di and monocots and some green algae PsaE protein (not Chlamydomonas), including Arabidopsis thaliana PSI-E A Q9S831, At4g28750 and PSI-E B Q9S714, At2g20260
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Simakawa et al. (2020). Near-infrared in Vivo Measurements of Photosystem I and Its Lumenal Electron Donors With a Recently Developed Spectrophotometer. Photosynth Res. , 144 (1), 63-72 Li et al. (2018). Modulating plant growth-metabolism coordination for sustainable agriculture. Nature. 2018 Aug 15. doi: 10.1038/s41586-018-0415-5.Yang et al. (2017). Tetratricopeptide repeat protein Pyg7 is essential for photosystem I assembly by interacting with PsaC in Arabidopsis. Plant J. 2017 Jun 21. doi: 10.1111/tpj.13618.
PsaE (PSI-E subunit of photosystem I) assists in docking of the ferredoxin to PSI and stabilizes the interaction between PsaC and the PSI core. Alternative names: P30 protein, Photosystem I 8.1 kDa protein,Photosystem I reaction center subunit IV, chloroplastic, PSI-E.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles, Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Immunogen:
PsaE of Chlamydomonas reinhardtii, UniProt: P12352
PsaE is a nucleus encoded subunit of the Photosystem I reaction center. It is located on the stroma side and interacts with PsaF. PsaE may be involved in Fd reduction. Alternative name: Photosystem I 10.8 kDa polypeptide
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Hordeum vulgare, Oryza sativa
Expected Species:
Catalpa bungei, Nicotiana sylvestris, Zea mays Species of your interest not listed? Contact us
Immunogen:
10 kDa PSI-E protein purified from barley thylakoids corresponding to PSI-E protein of Horderum vulgare, UniProt: P13194
Yoshida et al. (2016). Hisabori T1.Two distinct redox cascades cooperatively regulate chloroplast functions and sustain plant viability. Proc Natl Acad Sci U S A. 2016 Jul 5;113(27):E3967-76. doi: 10.1073/pnas.1604101113. Epub 2016 Jun 22.Ye et al. (2012). A Mutation of OSOTP 51 Leads to Impairment of Photosystem I Complex Assembly and Serious Photo-damage in Rice. J Integr Plant Biol. Feb 2012.Yadavalli et al. (2012). Differential degradation of photosystem I subunits under iron deficiency in rice. J Plant Physiol. March 22.
PsaF (PSI-F subunit of photosystem I) is a plastocyanin-docking protein, involved in electron transfer from plastocyanin to c553. Alternative names: PSI-F.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles, Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Immunogen:
PsaF of Chlamydomonas reinhardtii, UniProt: A8J4S1
PsaF (PSI-F) is a conserved subunit of type I photosynthetic reaction centers (Photosystem I, PSI). PSI is an integral membrane multi-protein complex that catalyzes the electron transfer from plastocyanin (or cytochrome c6) to ferredoxin (or flavodoxin). PsaF has been shown to be involved in the orientation of the soluble electron donor. In plants PSI-F is nuclear encoded and imported post-translationally into the chloroplast where it inserts into the thylakoid membrane.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Catalpa bungei, Micromonas sp. , Populus trichocarpa, Physcomitrium patens, Ricinus communisSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from the PsaF protein sequence of Arabidopsis thaliana (At1g31330). This peptide sequence is not completely conserved in mono- and dicots.
Schmid et al. (2018). PUMPKIN, the sole Plastid UMP Kinase, Associates with Group II Introns and Alters Their Metabolism. Plant Physiol. 2018 Nov 8. pii: pp.00687.2018. doi: 10.1104/pp.18.00687.Patil et al. (2018). FZL is primarily localized to the inner chloroplast membrane however influences thylakoid maintenance. Plant Mol Biol. 2018 Jul;97(4-5):421-433. doi: 10.1007/s11103-018-0748-3.Myouga et al. (2018). Stable accumulation of photosystem II requires ONE-HELIX PROTEIN1 (OHP1) of the light harvesting-like family. Plant Physiol. 2018 Feb 1. pii: pp.01782.2017. doi: 10.1104/pp.17.01782.Kanazawa et al. (2017). Chloroplast ATP Synthase Modulation of the Thylakoid Proton Motive Force: Implications for Photosystem I and Photosystem II Photoprotection. Front Plant Sci. 2017 May 3;8:719. doi: 10.3389/fpls.2017.00719.Qin et al. (2014). Isolation and characterization of a PSI-LHCI super-complex and its sub-complexes from a siphonaceous marine green alga, Bryopsis Corticulans. Photosynth Res. 2014 Sep 12.
PsaG (PSI-G subunit of photosystem I) is a 11-kDa membrane protein that plays an important role in electron transport between plastocyanin and PSI and is involved in the stability of the PSI complex. PSI-G subunit is bound to PSI-B and is in contact with Lhca1. The protein inserts into thylakoids by a direct or "spontaneous" pathway that does not involve the activities of any known chloroplast protein-targeting machinery. PSI-G appears to be directly or indirectly involved in the interaction between Photosystem I and plastocyanin.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Chicken
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Medicago truncatula, Spinacia oleracea, Vitis viniferaSpecies of your interest not listed? Contact us
PsaG is subunit located in the Photosystem I complex. It plats a role in stablizing the binding of the peripheral antenna. PsaG, together with PsaH and PsaN, are unique to higher plants and algae. Alternative names: PSI-G, light-harvesting complex I 10 kDa protein, P35 protein
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Expected Species:
Chlamydomonas reinhardtii
Immunogen:
fusion protein between DHFR and the mature part of Chlamydomonas PsaG, UniProt: P14224
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Nama et al. (2018). Non-photochemical quenching-dependent acclimation and thylakoid organization of Chlamydomonas reinhardtii to high light stress. Photosynth Res. 2018 Jul 7. doi: 10.1007/s11120-018-0551-7.
PsaH (PSI-H) is a conserved subunit of type I photosynthetic reaction centers (Photosystem I, PSI). PSI is an integral membrane multi-protein complex that catalyzes the electron transfer from plastocyanin (or cytochrome c6) to ferredoxin (or flavodoxin). Psa-H has been suggested to be involved in regulation of state1-state2 transitions. In plants and green algae Psa-H is nuclear encoded and imported post-translationally into the chloroplast where it inserts into the thylakoid membrane.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Nama et al. (2018). Non-photochemical quenching-dependent acclimation and thylakoid organization of Chlamydomonas reinhardtii to high light stress. Photosynth Res. 2018 Jul 7. doi: 10.1007/s11120-018-0551-7.Winck (2011). Nuclear proteomics and transcription factor profiling. Dissertation, University of Posdam.
PsaH (PSI-H) is a conserved subunit of type I photosynthetic reaction centers (Photosystem I, PSI). PSI is an integral membrane multi-protein complex that catalyzes the electron transfer from plastocyanin (or cytochrome c6) to ferredoxin (or flavodoxin). Psa-H has been suggested to be involved in regulation of state1-state2 transitions. In plants and algae Psa-H is nuclear encoded and imported post-translationally into the chloroplast where it inserts into the thylakoid membrane.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Arachis hypogaea, Brassica rapa, Medicago truncatula, Nicotiana sylvestris, Nicotiana tabaccum, Populus trichocarpa, Ricinus communis Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from the protein sequence of Arabidopsis thaliana for PsaH1(At3g16240) and PsaH2 (At1g52230). This peptide sequence is quite conserved in some dicots but not in monocots.
Wang et al. (2017). The Phytol Phosphorylation Pathway Is Essential for the Biosynthesis of Phylloquinone, which Is Required for Photosystem I Stability in Arabidopsis.Mol Plant. 2017 Jan 9;10(1):183-196. doi: 10.1016/j.molp.2016.12.006.Schwarz et al. (2017). Photosystem I-LHCII megacomplexes respond to high light and aging in plants. Photosynth Res. 2017 Oct 3. doi: 10.1007/s11120-017-0447-y.Tiwari et al. (2016). Photodamage of iron–sulphur clusters in photosystem I induces non-photochemical energy dissipation. Nature Plants Article number: 16035 (2016) doi:10.1038/nplants.2016.35.
PsaK is a subunit of photosystem I. It has a role in organizing the peripheral light-harvesting complexes on the core antenna of photosystem I. Alternative names: photosystem I subunit X, PSI-K
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Bock (2012). The plastid genome-encodedYcf4 protein functions as a non-essential assembly factor for photosystem I in higher plants. Plant Physiol. ahead of print.
PsaL (PSI-L) is a conserved subunit of type I photosynthetic reaction centers (Photosystem I, PSI). PSI is an integral membrane multi-protein complex that catalyzes the electron transfer from plastocyanin (or cytochrome c6) to ferredoxin (or flavodoxin). Psa-L is binding pigments and has been shown to be involved in trimerization of PSI in cyanobacteria (but not in plants) and bind pigments in plants and cyanobacteria.In plants and algae Psa-L is nuclear encoded and imported post-translationally into the chloroplast where it inserts into the thylakoid membrane.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Nicotiana benthamiana, Monocots (Zea mays)Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from PsaL protein sequence from Arabidopsis thaliana (At4g12800). This sequence is well conserved in most mono- and dicots but not in Physcomitrella patens.
Wang et al. (2020). Post-translational coordination of chlorophyll biosynthesis and breakdown by BCMs maintains chlorophyll homeostasis during leaf development. Nat Commun. 2020; 11: 1254. Koh et al. (2019). Heterologous synthesis of chlorophyll ? b ? in ? Nannochloropsis salina ? enhances growth and lipid production by increasing photosynthetic efficiency. Biotechnol Biofuels. ? 2019 May 14;12:122. doi: 10.1186/s13068-019-1462-3. eCollection 2019.Sch ttler et al. (2017). The plastid-encoded PsaI subunit stabilizes photosystem I during leaf senescence in tobacco. J Exp Bot. ? 2017 Feb 1;68(5):1137-1155. doi: 10.1093/jxb/erx009.Sook Seok et al. (2013). AtFKBP16-1, a chloroplast lumenal immunophilin, mediates response to photosynthetic stress by regulating PsaL stability. Physiologia Plantarum, DOI: 10.1111/ppl.12116.Bock (2012). The plastid genome-encodedYcf4 protein functions as a non-essential assembly factor for photosystem I in higher plants. Plant Physiol. ahead of print.
Photosystem I (PSI) of chloroplasts is a multisubunit membrane-protein complex that catalyzes the electron transfer from the reduced plastocyanin (or cytochrome c6) in the thylakoid lumen to the oxidized ferredoxin (or flavodoxin) in the chloroplast stroma. PsaN is necessary for docking plastocyanin to the PSI complex. PSI-N is the only subunit located entirely on the lumenal side of PSI.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophikized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Hansson et al. (2007). Knock-out of the chloroplast encoded PSI-J Subunit of Photosystem I in Nicotiana tabacum: PSI-J is required for efficient electron transfer and stable accumulation of photosystem I. FEBS J. 274: 1734-1746.
PsaO - photosystem I subunit O. The mature PsaO is a 10-kDa protein with two transmembrane helices. It has no counterpart in Photosystem I of cyanobacteria but seems to be present in higher plants, in mosses, and in green algae.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Spinacia oleracea
Immunogen:
fusion protein between DHFR and the mature part of PSI-O of Arabidopsis thaliana UniProt: Q949Q5TAIR: At1g08380
Jensen et al. (2004) The PSI-O subunit of plant photosystem I is involved in balancing the excitation pressure between the two photosystems. J. Biol. Chem. 279: 24212-24217.
Prostatic Specific Acid Phosphatase (PSAP) is a prostatic enzyme found in the glandular epithelium of the prostate. PSAP levels are elevated in hyperplastic prostate and prostate carcinoma, with the highest levels being detected in metastasized prostate cancer. Moderate overexpression of PSAP is also characteristic of diseases of the bone (such as Paget's disease or hyperparathyroidism), diseases of blood cells (such as sickle-cell disease), multiple myeloma, or lysosomal storage diseases (such as Gaucher's disease). PSAP is considered more sensitive, yet less specific, than PSA, however Anti-PSAP can act as a useful complement to Anti-PSA under suitable clinical contexts.
Prostatic Specific Acid Phosphatase (PSAP) is a prostatic enzyme found in the glandular epithelium of the prostate. PSAP levels are elevated in hyperplastic prostate and prostate carcinoma, with the highest levels being detected in metastasized prostate cancer. Moderate overexpression of PSAP is also characteristic of diseases of the bone (such as Paget's disease or hyperparathyroidism), diseases of blood cells (such as sickle-cell disease), multiple myeloma, or lysosomal storage diseases (such as Gaucher's disease). PSAP is considered more sensitive, yet less specific, than PSA, however Anti-PSAP can act as a useful complement to Anti-PSA under suitable clinical contexts.
Prostatic Specific Acid Phosphatase (PSAP) is a prostatic enzyme found in the glandular epithelium of the prostate. PSAP levels are elevated in hyperplastic prostate and prostate carcinoma, with the highest levels being detected in metastasized prostate cancer. Moderate overexpression of PSAP is also characteristic of diseases of the bone (such as Paget's disease or hyperparathyroidism), diseases of blood cells (such as sickle-cell disease), multiple myeloma, or lysosomal storage diseases (such as Gaucher's disease). PSAP is considered more sensitive, yet less specific, than PSA, however Anti-PSAP can act as a useful complement to Anti-PSA under suitable clinical contexts.
Prostate-Specific Antigen (PSA) is a serine protease of the kallikrein family that is produced by the prostate epithelium and epithelial lining of the periurethral glands. Although considered prostate-specific, PSA has also been detected in breast tissue, breast tumours, endometrium, adrenal neoplasms, and renal cell carcinomas. Anti-PSA can be used for differentiating high-grade prostate adenocarcinoma from high-grade urothelial carcinoma, as well as for determining the prostatic origin of carcinomas in non-prostate tissues. Anti-PSA recognizes primary and metastatic prostatic neoplasms, but not tumours of nonprostatic origin, and can be useful as an aid to confirm prostatic acinar cell origin in primary and metastatic carcinomas.
Psb27-H1 (Photosystem II repair protein 27) is involved in repair of photodamaged photosystem II (PSII). Localized in the chloroplast lumen, and involved in cellular response to light intensity. Alternative name: Thylakoid lumenal protein PSB27-H1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica oleracea, Brassica rapa,Capsella rubella, Coffea arabica,Camellia sinensis,Cucurbita pepo subsp. pepo, Erythranthe guttata,Gossypium hirsutum, Hevea brasiliensis, Hibiscus syriacu,Morus notabilis, Populus alba, Populus trichocarpa,Raphanus sativus, Quillaja saponaria Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana PSB27-H1 protein sequence, UniProt: Q9LR64, TAIR: At1g03600
Freshly extracted samples are recommended for the analysis. For protein transfer, use a membrane with a pore size of 0.2 m to secure that the protein will transfer correctly, as described here.
Application Details:
1 : 1000 (WB)
Purity:
Antigen affinity purified serum, in PBS pH 7.4
Reconstitution:
For reconstitution, add 50 l, of sterile or deionized water.
Molecular Weight:
18.8 | 11.7 | kDa (due to terminal processing)
Not reactive in:
Chlamydomonas reinhardtii
Selected references:
To be added when available, antibody available in April 2023.
Psb29 (THF1) is a conserved 22 kDa protein which functions in biogenesis of photosystem II complexes. This protein is required for organization of vesicles into mature thylakoid stacks for chloroplast development. Mediates G-protein signalling between the plasma membrane and the plastid.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Nicotiana tabacum, Oryza sativa, Ostreococcus sp., Picea sitcHensis, Populus balsamifera, Physcomitrium patens, Solanum lycopersicum, Solanum tuberosumSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from known sequences of Psb29 including Arabidopsis thaliana Q9SKT0, At2g20890
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Hamel et al. (2016). The chloroplastic protein THF1 interacts with the coiled-coil domain of the disease resistance protein N' and regulates light-dependent cell death. Plant Physiol. 2016 Mar 7. pii: pp.00234.2016Huang et al. (2013). Arabidopsis Thylakoid Formation 1 Is a Critical Regulator for Dynamics ofPSII-LHCII Complexes in Leaf Senescence and Excess Light. Mol Plant. May 13.
PSB33 or TEF5 is a Rieske (2Fe-2S) domain-containing protein located in chloroplast thylakoid membrane. The protein has oxireductase activity and is involved in oxidation reaction.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Oryza sativa
Expected Species:
Species of your interest not listed? Contact us
Immunogen:
part of Arabidopsis thaliana recombinant TEF5 protein, corresponding to epitopes 61-242, UniProt: Q9C9I7 , TAIR: At1g71500
This product can be sold with ProClin if requested
Application Details:
1 : 4000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
31 | 25 kDa (without transit peptide)
Not reactive in:
Chlamydomonas reinhardii
Selected references:
Kato et al. (2017). Deficiency of the Stroma-Lamellar Protein LIL8/PSB33 Affects Energy Transfer Around PSI in Arabidopsis. Plant Cell Physiol. 2017 Nov 1;58(11):2026-2039. doi: 10.1093/pcp/pcx124.Fristedt et al. (2017). PSB33 sustains photosystem II D1 protein under fluctuating light conditions. Journal of Experimental Botany doi:10.1093/jxb/erx218.Dixit (2015). Sulfur alleviates arsenic toxicity by reducing its accumulation and modulating proteome, amino acids and thiol metabolism in rice leaves. Sci Rep. 2015 Nov 10;5:16205. doi: 10.1038/srep16205.Fristedt at al. (2014). PSB33, a protein conserved in the plastid lineage, is associated with the chloroplast thylakoid membrane and provides stability to Photosystem II supercomplexes in Arabidopsis. Plant Physiol. Dec, 2014, open access.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Algae (brown and red), Brassica napus, Conifers, Cyanobacteria, Dictos, Manihot esculenta, Medicago sativa, Nannochloropsis sp., Pisum sativum, Triticum aestivum, cellular [compartment marker] of thylakoid membrane. Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions. In our analysis we have seen both, ca. 24 kDa and ca. 10 kDa fragments from different samples, depending on treatments and isolation procedures.Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e.g. precursor and mature protein as compare to the hen anti-PsbA antibodies AS01 016.This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel.The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43.
Application Details:
1 : 15 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Wada et al. (2021) Identification of a Novel Mutation Exacerbated the PSI Photoinhibition in pgr5/pgrl1 Mutants; Caution for Overestimation of the Phenotypes in Arabidopsis pgr5-1 Mutant. Cells. 2021 Oct 26;10(11):2884. doi: 10.3390/cells10112884. PMID: 34831107; PMCID: PMC8616342.Sorrentino et al. (2018). Performance of three cardoon cultivars in an industrial heavy metal-contaminated soil: Effects on morphology, cytology and photosynthesis. J Hazard Mater. 2018 Jun 5;351:131-137. doi: 10.1016/j.jhazmat.2018.02.044.Kanazawa et al. (2017). Chloroplast ATP Synthase Modulation of the Thylakoid Proton Motive Force: Implications for Photosystem I and Photosystem II Photoprotection. Front Plant Sci. 2017 May 3;8:719. doi: 10.3389/fpls.2017.00719.Li et al. (2016). A Hard Day's Night: Diatoms Continue Recycling Photosystem II in the Dark. Front. Mar. Sci., 08 November 2016
Special application note:
Due to biology of PsbA (D1) protein a number of degradation products can apprear in a sample and may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands.Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
Algae (brown and red), Dictos, Conifers, Cyanobacteria, Medicago sativa, Nannochloropsis sp., Pisum sativum, Triticum aestivum, cellular [compartment marker] of thylakoid membrane Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions. In our analysis we have seen both, ca. 24 kDa and ca. 10 kDa fragments from different samples, depending on treatments and isolation procedures.Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e.g. precursor and mature protein as compare to the chicken anti-PsbA antibodies AS01 016.This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel.The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43.
Application Details:
1 : 15 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to ALP.
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Due to biology of PsbA (D1) protein a number of degradation products can apprear in a sample and may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands.Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
Algae (brown and red), Dictos, Conifers, Cyanobacteria, Medicago sativa, Nannochloropsis sp., Pisum sativum, Triticum aestivum, cellular [compartment marker] of thylakoid membraneSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions. In our analysis we have seen both, ca. 24 kDa and ca. 10 kDa fragments from different samples, depending on treatments and isolation procedures.Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e.g. precursor and mature protein as compare to the chicken anti-PsbA antibodies AS01 016.This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel.The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43.
Application Details:
1 : 15 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to biotin.
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
Due to biology of PsbA (D1) protein a number of degradation products can apprear in a sample and may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands.Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.
The PsbA (D1) protein of Photosystem II is rapidly cycled under illumination in all oxygenic photobionts. Disruption of PsbA cycling or losses of PsbA pools are central to photoinhibition of photosynthesis in cyanobacteria, algae and plants under a wide range of conditions including excess light, low temperature and UV exposure. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4 C; make aliquots to avoid working with a stock. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Algae (brown and red), Conifers, Cryptomonads, Legumes, Stramenopiles, Euglenoids, Prochlorophytes, XantophytesSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions.In our analysis we have seen both, ca. 24 kDa and ca. 10 kDa fragments from different samples, depending on treatments and isolation procedures.This antibody will also detect the phosphorylated form of D1as an alternate band to the main band on a high resolution gel.
Application Details:
1 :4000-1 : 8000, 5 g of total protein, (WB)
Purity:
Purified, total IgY (chicken egg yolk immunoglobulin) in PBS pH 8. Contains 0.02 % sodium azide.
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Vitale et al.(2022) Manipulation of light quality is an effective tool to regulate photosynthetic capacity and fruit antioxidant properties of Solanum lycopersicum L. cv. 'Microtom' in a controlled environment. PeerJ. 2022;10:e13677. Published 2022 Jul 1. doi:10.7717/peerj.13677Toubiana et al. (2020). Correlation-based Network Analysis Combined With Machine Learning Techniques Highlight the Role of the GABA Shunt in Brachypodium Sylvaticum Freezing Tolerance. Sci Rep , 10 (1), 4489Sicora et al. (2019). Regulation of PSII function in Cyanothece sp. ATCC 51142 during a light-dark cycle. Photosynth Res. 2019 Mar;139(1-3):461-473. doi: 10.1007/s11120-018-0598-5,Sevilla et al. (2019). Regulation by FurC in Anabaena links the oxidative stress response to photosynthetic metabolism. Plant Cell Physiol. 2019 May 21. pii: pcz094. doi: 10.1093/pcp/pcz094.Figlioli et al. (2019). Overall plant responses to Cd and Pb metal stress in maize: Growth pattern, ultrastructure, and photosynthetic activity. Environ Sci Pollut Res Int. 2019 Jan;26(2):1781-1790. doi: 10.1007/s11356-018-3743-y.
Special application note:
A number of degradation products may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands. Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.Example of a simulataneous western blot detection with RbcL, PsbA and PsaC antibodies.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7.4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Algae (brown and red), Dictos, Conifers, Cyanobacteria, Medicago sativa, Nannochloropsis sp., Pisum sativum, Triticum aestivum, cellular [compartment marker] of thylakoid membrane.Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions. In our analysis we have seen both, ca, 24 kDa and ca, 10 kDa fragments from different samples, depending on treatments and isolation procedures. Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e.g. precursor and mature protein as compare to the hen anti-PsbA antibodies AS01 016. This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel,The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43.
Application Details:
To be determined by end user
Purity:
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 488.
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known.
Selected references:
To be added when available. Antibody release in May 2023.
Special application note:
Due to biology of PsbA (D1) protein a number of degradation products can apprear in a sample and may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands. Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.DyLight 488 Amax = 493 nm, Emax = 519 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II, PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Algae (brown and red), Dictos, Conifers, Cyanobacteria, Medicago sativa, Nannochloropsis sp., Pisum sativum, Triticum aestivum, cellular [compartment marker] of thylakoid membrane.Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions, In our analysis we have seen both, ca, 24 kDa and ca, 10 kDa fragments from different samples, depending on treatments and isolation procedures,Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e,g, precursor and mature protein as compare to the hen anti-PsbA antibodies AS01 016,This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel,The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43,
Application Details:
To be determined by end user
Purity:
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 594.
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known,
Selected references:
To be added when available. Antibody release in May 2023.
Special application note:
Due to biology of PsbA (D1) protein a number of degradation products can apprear in a sample and may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands,Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.DyLight 594 has Amax = 593 nm, Emax = 618 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria, The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II, PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts, Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples, Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Algae (brown and red), Dictos, Conifers, Cyanobacteria, Medicago sativa, Nannochloropsis sp., Pisum sativum, Triticum aestivum, cellular [compartment marker] of thylakoid membrane.Species of your interest not listed? Contact us
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions, In our analysis we have seen both, ca, 24 kDa and ca, 10 kDa fragments from different samples, depending on treatments and isolation procedures,Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e,g, precursor and mature protein as compare to the hen anti-PsbA antibodies AS01 016,This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel,The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43,
Application Details:
To be determined by end user
Purity:
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 650.
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known,
Selected references:
To be added when available. Antibody released in May 2023.
Special application note:
Due to biology of PsbA (D1) protein a number of degradation products can apprear in a sample and may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands,Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.DyLight 650 has Amax = 652 nm, Emax = 672 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Algae (brown and red), Brassica napus, Conifers, Cyanobacteria, Dictos, Manihot esculenta, Medicago sativa, Nannochloropsis sp., Pisum sativum, Triticum aestivum, cellular [compartment marker] of thylakoid membrane.Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions. In our analysis we have seen both, ca. 24 kDa and ca. 10 kDa fragments from different samples, depending on treatments and isolation procedures.Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e.g. precursor and mature protein as compare to the hen anti-PsbA antibodies AS01 016.This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel.The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43.
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to FITC.
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Special application note:
PsbA | D1 protein of PSII, C-terminal, FITC conjugated
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
Algae (brown and red), Dictos, Conifers, Cyanobacteria, Medicago sativa, Nannochloropsis sp., Pisum sativum, Triticum aestivum, cellular [compartment marker] of thylakoid membrane. Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions. In our analysis we have seen both, ca. 24 kDa and ca. 10 kDa fragments from different samples, depending on treatments and isolation procedures.Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e.g. precursor and mature protein as compare to the hen anti-PsbA antibodies AS01 016.This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel.The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43.
Application Details:
1 : 15 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to HRP.
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Thurotte et al. (2020). DnaK3 Is Involved in Biogenesis and/or Maintenance of Thylakoid Membrane Protein Complexes in the Cyanobacterium Synechocystis Sp. PCC 6803. Life (Basel). 2020 Apr 30;10(5):E55. doi: 10.3390/life10050055.
Special application note:
Due to biology of PsbA (D1) protein a number of degradation products can apprear in a sample and may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands.Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Algae (brown and red), Brassica napus, Conifers, Cyanobacteria, Dictos, Cannabis sativa, Galdieria sulphuraria, Lactuca sativa, Lycopersicum esculentum, Medicago sativa, Nannochloropsis sp., Oryza sativa, Ostreococcus sp. Pisum sativum, Sesamum indicum, Thalassiosira pseudonana, Zosteria marina, Vitis vinifera cellular [compartment marker] of thylakoid membraneSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
Applications:
Immunofluorescence (IF), ImmunoGold (IG), Western blot (WB)
The antibody is appropriate for detecting both, 24 kDa or the 10 kDa C-terminal fragments, whichever is generated under given treatment conditions. In our analysis we have seen both, ca. 24 kDa and ca. 10 kDa fragments from different samples, depending on treatments and isolation procedures.Rabbit anti-PsbA antibody can detect more than one band of PsbA protein, e.g. precursor and mature protein as compare to the hen anti-PsbA antibodies AS01 016.This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel.The antibody will bind to cross-linked proteins: D1/D2, D1/cyt b559, D1/CP43.The peptide is conserved in cyanobacterial D1:1 and D1;2.
Application Details:
1: 500 (IF), 1: 200 (IG), 1 : 10 000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Ivanov et al. (2022) The decreased PG content of pgp1 inhibits PSI photochemistry and limits reaction center and light-harvesting polypeptide accumulation in response to cold acclimation. Planta 255, 36 (2022). https://doi.org/10.1007/s00425-022-03819-0Byeon et al. (2022) Canopy height affects the allocation of photosynthetic carbon and nitrogen in two deciduous tree species under elevated CO2. J Plant Physiol. 2022 Jan;268:153584. doi: 10.1016/j.jplph.2021.153584. Epub 2021 Dec 2. PMID: 34890847.Ye et al. (2022) Effect of increased CO2 on iron-light-CO2 co-limitation of growth in a marine diatom, ASLO, Limnol. Oceanogr. 2022, 172-176Pavlovic & Kocab. (2021) Alternative oxidase (AOX) in the carnivorous pitcher plants of the genus Nepenthes: what is it good for? Ann Bot. 2021 Dec 18:mcab151. doi: 10.1093/aob/mcab151. Epub ahead of print. PMID: 34922341.Cano-Ramirez et al. (2021) M. Plasma Membrane Fluidity: An Environment Thermal Detector in Plants. Cells. 2021 Oct 17;10(10):2778. doi: 10.3390/cells10102778. PMID: 34685758; PMCID: PMC8535034.
Special application note:
Due to biology of PsbA (D1) protein a number of degradation products can apprear in a sample and may be observed when using anti-PsbA antibodies, including products having apparent molecular weights of 24kDa and 16kDa. D1 degradation is a complex set of events and the products observed can be influenced by both the extraction procedure and the physiology of the cells prior to harvest. Third, cross-linking may occur between D1 and cytochrome b559, shifting the protein higher in the gel. In cyanobacteria (PCC7942), three different bands were competed out by preincubating the antibody with the PsbA free peptide, indicating that all bands are indeed PsbA and its precursors or breakdown products. Competition assays were also performed with spinach and Chlamydomonas, confirming the identity of PsbA bands.Anti-PsbA antibodies will not detect D2 protein, as the peptide used to generate PsbA antibodies has no homology to the D2 sequence.This product can be sold containing ProClin if requested.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Cucumis sativus, Glycine max, Nannochloropsis sp., Oryza sativa, Populus balsamifera, Ricinus communis, Zea mays, Vitis viniferaSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide, amino acids 234-242 of Arabidopsis thaliana D1 protein UniProt: P83755, TAIR:AtCg00020
Antibody is recognizing a 23 kDa fragment in spinach and Arabidopsis thylakoidsfor usage on total cell extracts the dilution needs to be determined experimentally
Application Details:
1 : 10 000, thylakoid fraction (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Lu et al. (2021). Role of an ancient light-harvesting protein of PSI in light absorption and photoprotection. Nat Commun. 2021 Jan 29;12(1):679. doi: 10.1038/s41467-021-20967-1. PMID: 33514722; PMCID: PMC7846763. (blue-native PAGE)Mazur et al. (2021) The SnRK2.10 kinase mitigates the adverse effects of salinity by protecting photosynthetic machinery. Plant Physiol. 2021 Dec 4;187(4):2785-2802. doi: 10.1093/plphys/kiab438. PMID: 34632500; PMCID: PMC8644180.Rantala et al. (2020). PGR5 and NDH-1 systems do not function as protective electron acceptors but mitigate the consequences of PSI inhibition. Biochim Biophys Acta Bioenerg. 2020 Jan 11;1861(3):148154. doi: 10.1016/j.bbabio.2020.148154.Grieco et al. (2020). Adjustment of photosynthetic activity to drought and fluctuating light in wheat. Plant Cell Environ. 2020 Mar 16. doi: 10.1111/pce.13756. Rantala and Tikkanen et al. (2018). Phosphorylation?induced lateral rearrangements of thylakoid protein complexes upon light acclimation. Plant Direct Vol. 2, Issue 2.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Algae (brown and red), Conifers, Cyanobacteria, Brassica napus, Diatoms, Glycine max, Manihot esculenta, Medicago truncatula, Nicotiana tabacum, Oryza sativa, Phaseolus vulgaris, Pisum sativum, Solanum lycopersicum, Solanum tuberosum, Spinacia oleracea, Triticum aestivum, Zea mays, Vitis vinifera Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from N-terminal of available plant, algal and cyanobacterial PsbA sequences, including Arabidopsis thaliana UniProt: A4QJR4, TAIR: AtCg00020 , Oryza sativa P0C434, Populus alba Q14FH6, Physcomitrella patens Q6YXN7, Chlamydomonas reinhardtii P07753, Synechocystis sp. P14660 and many others
This antibody will detect the phosphorylated form of D1 as an alternate band to the main band on a high resolution gel
Application Details:
1 : 1000-1 : 10 000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Chen et al. (2021)Degradation of the photosystem II core complex is independent of chlorophyll degradation mediated by Stay-Green Mg2+ dechelatase in Arabidopsis,Plant Science,Volume 307,2021,110902,ISSN 0168-9452,https://doi.org/10.1016/j.plantsci.2021.110902. Fukura et al. (2021) Enrichment of chlorophyll catabolic enzymes in grana margins and their cooperation in catabolic reactions. J Plant Physiol. 2021 Nov;266:153535. doi: 10.1016/j.jplph.2021.153535. Epub 2021 Sep 25. PMID: 34607178.Terentyev (2020: The Main Structural and Functional Characteristics of Photosystem-II-Enriched Membranes Isolated From Wild Type and cia3 Mutant Chlamydomonas reinhardtii. Life (Basel). 2020 May 14;10(5):E63. doi: 10.3390/life10050063..G recka et al. (2019). Photosystem II 22kDa protein level a prerequisite for excess light-inducible memory, cross-tolerance to UV-C, and regulation of electrical signalling. Plant Cell Environ. 2019 Nov 23. doi: 10.1111/pce.13686.Liu et al. (2018). Effects of PSII Manganese-Stabilizing Protein Succinylation on Photosynthesis in the Model Cyanobacterium Synechococcus sp. PCC 7002. Plant Cell Physiol. 2018 Jul 1;59(7):1466-1482. doi: 10.1093/pcp/pcy080.
Special application note:
Peptide target used for antibody production comes from Helix 1 of PSII, lumenal exposed loop. Antibodies are going to recognize the target in a wide range of species.This product can be sold containing ProClin if requested.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples. Alternative names: 32 kDa thylakoid membrane protein, photosystem II protein D1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Dictos, Conifers, Monocts Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from available plant PsbA sequences with phosphorylated (T), including Arabidopsis thaliana UniProt: P83755, TAIR:AtCg00020, Oryza sativa P0C434 and other higher plant PsbA sequences
This antibody is detecting phosphorylated PsbA protein.Antibodies are purified on a non-phosphorylated peptide.
Application Details:
1 : 10 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
38 | 28-30 kDa
Not reactive in:
Cyanobacteria
Selected references:
Mazur et al. (2021) The SnRK2.10 kinase mitigates the adverse effects of salinity by protecting photosynthetic machinery. Plant Physiol. 2021 Dec 4;187(4):2785-2802. doi: 10.1093/plphys/kiab438. PMID: 34632500; PMCID: PMC8644180.Upadhyaya and Jagadeeshwar Rao (2019). Reciprocal regulation of photosynthesis and mitochondrial respiration by TOR kinase in Chlamydomonas reinhardtii. Plant Direct Volume 3, Issue 11.Xing et al. (2017). Deletion of CGLD1 Impairs PSII and Increases Singlet Oxygen Tolerance of Green Alga Chlamydomonas reinhardtii. Front. Plant Sci., 15 December 2017. https://doi.org/10.3389/fpls.2017.02154.Li et al. (2015). Effect of hydrogen sulfide on D1 protein in wheat under drought stress. Acta Physiologiae Plantarum November 2015, 37:225.
The psbA gene has been cloned from many species of plants, green algae, and cyanobacteria. The psbA gene is located in the chloroplast genome and encodes for the D1 protein, a core component of Photosystem II. PsbA/D1 is rapidly cycled under illumination in all oxygenic photobionts. Tracking PsbA pools using the Global PsbA antibody can show the functional content of Photosystem II in a wide range of samples.This is a recombinant protein standard, source: Synechocystis PCC 6803.
Product Type:
Antibody
Format:
Lyophilized in glycerol.
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Concentration: after adding 95 l of sterile milliQ water final concentration of the standard is 0.25 pmoles/ lProtein standard buffer composition: Glycerol 10%, Tris Base 141 mM, Tris HCl 106 mM, LDS 2%, EDTA 0.51 mM, SERVA Blue G250 0.22 mM, Phenol Red 0.175 mM, pH 8.5, 0.1mg/ml PefaBloc protease inhibitor (Roche), 50mM DTT.This standard is ready-to-load and does not require any additions or heating. It needs to be fully thawed and thoroughly mixed prior to using. Avoid vigorous vortexing, as buffers contain detergent. Following mixing, briefly pulse in a microcentrifuge to collect material from cap.This standard is stabilized and ready and does not require heating before loading on the gel. Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Application Details:
Standard curve: 3 loads are recommended (0.5, 2 and 4μl).For most applications a sample load of 0.2 μg of chlorophyll will give a PsbA signal in this range.Positive control: a 2 μl load per well is optimal for most chemiluminescent detection systems.Non-disulphie dependent dimers and complexes can be also detected using standard western blot methods with more sensitive detection reagents as ECL Advance or West Pico when loading per well more standard than recommended. They have not been included in the standard calibration.This standard is stabilized and ready and does not require heating before loading on the gel. Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Reconstitution:
For reconstitution add 95 l of sterile water, Please notice that this product contains 10% glycerol and might appear as liquid but is provided lyophilized
Molecular Weight:
The standard has an actual MW of 41,5 kDa, The presence of a His6 tag causes it to run ~1,7 kDa higher on the gel than the native protein, Note that in most systems, PsbA migrates with an apparent MW of between 30 and 35 kDa,
Selected references:
Pipitone et al. (2021). A multifaceted analysis reveals two distinct phases of chloroplast biogenesis during de-etiolation in Arabidopsis. Elife. 2021 Feb 25;10:e62709. doi: 10.7554/eLife.62709. PMID: 33629953; PMCID: PMC7906606.Fern ndez-Gonz lez et al. (2020). Effects of Temperature and Nutrient Supply on Resource Allocation, Photosynthetic Strategy, and Metabolic Rates of Synechococcus Sp . J Phycol . 2020 Mar 4. doi: 10.1111/jpy.12983. Levitan et al. (2019). Structural and functional analyses of photosystem II in the marine diatom Phaeodactylum tricornutum. Proc Natl Acad Sci U S A. 2019 Aug 27;116(35):17316-17322. doi: 10.1073/pnas.1906726116.Ryan-Keogh et al. (2018). Seasonal regulation of the coupling between photosynthetic electron transport and carbon fixation in the Southern Ocean. Limnology and Oceanography.Yuan et al. (2018). Combined effects of ocean acidification and warming on physiological response of the diatom Thalassiosira pseudonana to light challenges. Mar Environ Res. 2018 Apr;135:63-69. doi: 10.1016/j.marenvres.2018.01.016.
Special application note:
The PsbA protein standard can be used in combination with global anti-PsbA antibodies to quantitate PsbA from a wide range of species. Global antibodies are raised against highly conserved amino acid sequences in the PsbA protein.Quantitative western blot: detailed method description, video tutorialThe goals when doing quantitative work:The sample PsbA must fall somewhere between the upper and lower standard loads. There should be at least 3 points on the standard curve.if possible, try to make the entire range of the curve around one order of magnitude or less (as in the application example).if possible, load <5 g total sample protein.1pmol of PsbA standard is a strong load for chemiluminescence, but may be appropriate for the less sensitive reagents, for example alkaline phosphatase.
PsbB (CP47) is a chlorophyll-binding protein located in the membrane, where it serves as the core antenna of Photosystem II.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
This product can be sold containing ProClin if requestedin bis-tris gel systems PsbB protein migrates between 40-45 kDa
Application Details:
1: 10 000 (CN-PAGE), 1 : 2000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
56 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Vidal-Meireles, et al. (2023)The lifetime of the oxygen-evolving complex subunit PSBO depends on light intensity and carbon availability in Chlamydomonas. Plant Cell Environ. 2023;46(2):422-439. doi:10.1111/pce.14483Miernicka et al. (2022) The Adjustment Strategy of Venus Flytrap Photosynthetic Apparatus to UV-A Radiation. Cells. 2022;11(19):3030. Published 2022 Sep 27. doi:10.3390/cells11193032Konert et al (2022). High-light-inducible proteins HliA and HliB: pigment binding and protein-protein interactions. Photosynth Res. 2022 Jun;152(3):317-332. doi: 10.1007/s11120-022-00904-z. Epub 2022 Feb 26. PMID: 35218444.Guardini et al. (2022). Loss of a single chlorophyll in CP29 triggers re-organization of the Photosystem II supramolecular assembly. Biochim Biophys Acta Bioenerg. 2022 Jun 1;1863(5):148555. doi: 10.1016/j.bbabio.2022.148555. Epub 2022 Apr 2. PMID: 35378087.Xiong et al. (2022) a chloroplast nucleoid protein of bacterial origin linking chloroplast transcriptional and translational machineries, is required for proper chloroplast gene expression in Arabidopsis thaliana. Nucleic Acids Res. 2022 Jun 23;50(12):6715-34. doi: 10.1093/nar/gkac501. Epub ahead of print. PMID: 35736138; PMCID: PMC9262611.
Special application note:
This antibody can be used as a loading control for studies of PSIi or photosynthetic acclimation in diatoms Blommaert et al. 2017. Limnol. Oceanogr. DOI: 10.1002/lno.10511.This product can be sold containing ProClin if requested.
PsbC (CP43) acts as an antenna to the PSII core and its presence seem to be also necessary for maintaining water splitting activity. This protein is more weakly associated with the PSII reaction centre and can be removed from the isolated core.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
In C4 plants like Echinochloa crus-galli and Zea mays antibody detects 2 bands.
Application Details:
1 : 3 000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
45 | 43 kDa
Not reactive in:
diatoms
Selected references:
Beckova et al. (2022). Photosystem II antenna modules CP43 and CP47 do not form a stable 'no reaction centre complex' in the cyanobacterium Synechocystis sp. PCC 6803. Photosynth Res. 2022 Jan 11. doi: 10.1007/s11120-022-00896-w. Epub ahead of print. PMID: 35015206.Cecchin et al (2021) LPA2 protein is involved in photosystem II assembly in Chlamydomonas reinhardtii. Plant J. 2021 Jul 4. doi: 10.1111/tpj.15405. Epub ahead of print. PMID: 34218480.Okegawa et al (2021) Maintaining the Chloroplast Redox Balance Through the PGR5-Dependent Pathway and the Trx System is Required for Light-Dependent Activation of Photosynthetic Reactions. Plant Cell Physiol. 2021 Oct 8:pcab148. doi: 10.1093/pcp/pcab148. Epub ahead of print. PMID: 34623443.Sakuraba at al. (2020). Multilayered regulation of membrane-bound ONAC054 is essential for abscisic acid-induced leaf senescence in rice. Plant Cell. 2020 Jan 6. pii: tpc.00569.2019. doi: 10.1105/tpc.19.00569.Dong et al. (2020). Plastid ribosomal protein LPE2 is involved in photosynthesis and the response to C/N balance in Arabidopsis thaliana. J Integr Plant Biol. 2020 Jan 15. doi: 10.1111/jipb.12907.
D2 protein (PsbD) forms the reaction core of PSII (Photosystem II) as a heterodimer with the D1 protein (PsbA). PsbD is homologous to the D1 protein, with slightly higher molecular mass of about 39.5 kDa. Accumulation of D2 protein is an important step in the assemply of the PSII reaction centre complex.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
There is a confirmed cross-reaction with TLA1 protein in Chlamydomonas reinhardtii.For samples with a very low PSII content theremight be detection problems independent of the antibody. PSII proteins can vary in level depending upon liquid culture conditions. When the cells are in a stationary phase PSII content can drop to a very low level.
Application Details:
1: 10 000 (CN-PAGE), 1: 5000 - 1 : 50 000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
39,4 | 28-30 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Burlacot et al. (2022) Alternative photosynthesis pathways drive the algal CO2-concentrating mechanism. Nature 605, 366–371 (2022). https://doi.org/10.1038/s41586-022-04662-9Bychkov et al. (2022) The role of PAP4/FSD3 and PAP9/FSD2 in heat stress responses of chloroplast genes. Plant Sci. 2022 Sep;322:111359. doi: 10.1016/j.plantsci.2022.111359. Epub 2022 Jun 20. PMID: 35738478.Mazur et al. (2021) The SnRK2.10 kinase mitigates the adverse effects of salinity by protecting photosynthetic machinery. Plant Physiol. 2021 Dec 4;187(4):2785-2802. doi: 10.1093/plphys/kiab438. PMID: 34632500; PMCID: PMC8644180.von Bismarck et al. (2021) Light acclimation interacts with thylakoid ion transport to govern the dynamics of photosynthesis. Research Square; 2021. DOI: 10.21203/rs.3.rs-948381/v1.Cecchin et al (2021) LPA2 protein is involved in photosystem II assembly in Chlamydomonas reinhardtii. Plant J. 2021 Jul 4. doi: 10.1111/tpj.15405. Epub ahead of print. PMID: 34218480.
Special application note:
The peptide used to elicit this antibody has a perfect conservation across all full-length PsbD sequences from higher plants, lower plants, cyanobacteria and unicellular algae except: minor substitutions in some Prochlorococcus & Dinoflagellate sequences, The antibody should still work against these taxa, but it has not been tested yet, This antibody does not detect PsbA protein (D1),This product can be sold containing ProClin if requested
D2 protein (PsbD) forms the reaction core of PSII (Photosystem II) as a heterodimer with the D1 protein (PsbA). PsbD is homologous to the D1 protein, with slightly higher molecular mass of about 39,5 kDa. Accumulation of D2 protein is an important step in the assemply of the PSII reaction centre complex.This product is a recombinant protein standard, source Synechocystis strain PCC 6803.
Product Type:
Antibody
Format:
Lyophilized in glycerol
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Concentration: after adding 225 l of milliQ water final concentration of the standard is 0.25 pmoles/ulProtein standard buffer composition: Glycerol 10%, Tris Base 141 mM, Tris HCl 106 mM, LDS 2%, EDTA 0.51 mM, SERVA Blue G250 0.22 mM, Phenol Red 0.175 mM, pH 8.5, 0.1mg/ml PefaBloc protease inhibitor (Roche), 50mM DTT.This standard is ready-to-load and does not require any additions or heating. It needs to be fully thawed and thoroughly mixed prior to using. Avoid vigorous vortexing, as buffers contain detergent. Following mixing, briefly pulse in a microcentrifuge to collect material from cap.This standard is stabilized and ready and does not require heating before loading on the gel. Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Application Details:
Standard curve: 3 loads are recommended (0.5, 2 and 4μl).For most applications a sample load of 0.2 μg of chlorophyll will give a PsbD signal in this range.Positive control: a 2 μl load per well is optimal for most chemiluminescent detection systems. This standard is stabilized and ready and does not require heating before loading on the gel.Please note that this product contains 10% glycerol and might appear as liquid but is provided lyophilized. Allow the product several minutes to solubilize after adding water. Mix thoroughly but gently Take extra care to mix thoroughly before each use, as the proteins tend to settle with the more dense layer after freezing.
Reconstitution:
For reconstitution add 225 l of sterile water, Please notice that this product contains 10% glycerol and might appear as liquid but is provided lyophilized
Molecular Weight:
In most gel systems PsbD migrates around 28-30 kDa
Selected references:
Partensky et al. (2018). Comparison of photosynthetic performances of marine picocyanobacteria with different configurations of the oxygen-evolving complex. Photosynth Res. 2018 Jun 25. doi: 10.1007/s11120-018-0539-3.Li et al. (2016). A Hard Day's Night: Diatoms Continue Recycling Photosystem II in the Dark. Front. Mar. Sci., 08 November 2016Li et al. (2014). The nitrogen costs of photosynthesis in a diatom under current and future pCO2. New Phytol. 2014 Sep 25. doi: 10.1111/nph.13037.
Special application note:
The PsbD protein standard can be used in combination with global anti-PsbD antibodies to quantitate PsbD from a wide range of species. Global antibodies are raised against highly conserved amino acid sequences in the PsbD protein.Quantitative western blot: detailed method description, video tutorial
Cytochrome b559 (Cyt b559) is encoded by the chloroplast genes psbE and psbF and is comprised of two low molecular mass polypeptides, a and h subunits, with molecular masses of 9 and 4 kDa, respectively. The Cyt b559 is closely associated with PSII in all oxygenic photosynthetic organisms. The a and h subunits of the Cyt b559 are components of the minimal PSII reaction center complex that is still capable of primary charge separation In summary, both PsbE and PsbF are essential components for PSII assembly, and they are probably involved in electron transport mechanisms that help to protect PSII from photodamage. Alternative protein name: PSII reaction center subunit V
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Hackett et al. (2017). An Organelle RNA Recognition Motif Protein Is Required for Photosystem II Subunit psbF Transcript Editing. Plant Physiol. 2017 Apr;173(4):2278-2293. doi: 10.1104/pp.16.01623.Yang-Er Chen et al. (2017). Responses of photosystem II and antioxidative systems to high light and high temperature co-stress in wheat. J. of Exp. Botany, Volume 135, March 2017, Pages 45–55.Nishimura et al. (2016). The N-terminal sequence of the extrinsic PsbP protein modulates the redox potential of Cyt b559 in photosystem II. Sci Rep. 2016 Feb 18;6:21490. doi: 10.1038/srep21490.Grieco et al. (2015). Light-harvesting II antenna trimers connect energetically the entire photosynthetic machinery - including both photosystems II and I. Biochim Biophys Acta. 2015 Jun-Jul;1847(6-7):607-19. doi: 10.1016/j.bbabio.2015.03.004. Epub 2015 Apr 3.Hojka et al. (2014). Inducible repression of nuclear-encoded subunits of the cytochrome b6f complex in tobacco reveals an extraordinarily long lifetime of the complex. Plant Physiol. 2014 Jun 24. pii: pp.114.243741.
Special application note:
Cellular [compartment marker] of thylakoid membraneThis product can be sold containing ProClin if requested.
PsbE (Cytochrome b559 subunit alpha) is tightly associated with the reaction center of photosystem II (PSII). Alternative name: PSII reaction center subunit V
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Synechocystis PCC 6803
Expected Species:
Bathycoccus prasinos, Capsosiphon fulvescens, Chlamydomonas sp., Gonium pectorale,Mesostigma viride, Microglena monadina, Nannochloropsis granulata,Neglectella solitaria, Ostreococcus tauri, Pandorina morum, Planctonema lauterbornii, Thermosynechococcus vulcanus, Tupiella akineta, Ulva lactuca, Volvulina compacta, Volvox africanus, Yamagishiella unicoccaSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from algal PsbE sequences, including Chlamydomonas reinhardtii PsbE UniProt: P48268
Cytochrome b559 (Cyt b559) is encoded by the chloroplast genes psbE and psbF and is comprised of two low molecular mass polypeptides, α and subunits, with molecular masses of 9 and 4 kDa, respectively. The Cyt b559 is closely associated with PSII in all oxygenic photosynthetic organisms. The α and subunits of the Cyt b559 are components of the minimal PSII reaction center complex that is still capable of primary charge separation In summary, both PsbE and PsbF are essential components for PSII assembly, and they are probably involved in electron transport mechanisms that help to protect PSII from photodamage.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
This antibody works better on thylakoid and chloroplast fractions than on a total cell extract
Application Details:
1 : 1000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 200 l of sterile water
Molecular Weight:
4 kDa
Not reactive in:
Chlamydomonas reinhardtii, cyanobacteria
Selected references:
Hackett et al. (2017). An Organelle RNA Recognition Motif Protein Is Required for Photosystem II Subunit psbF Transcript Editing. Plant Physiol. 2017Yang-Er Chen et al. (2017). Responses of photosystem II and antioxidative systems to high light and high temperature co-stress in wheat. J. of Exp. Botany, Volume 135, March 2017, Pages 45–55.Nishimura et al. (2016). The N-terminal sequence of the extrinsic PsbP protein modulates the redox potential of Cyt b559 in photosystem II. Sci Rep. 2016 Feb 18;6:21490. doi: 10.1038/srep21490.Lucinski et al. (2011). Involvement of Deg5 protease in wounding-related disposal of PsbF apoprotein. Plant Physiol Biochem. 49(3):311-20.Garcia-Cerdan et al. (2008). Antisense inhibition of the PsbX protein affects PSII integrity in the higher plant Arabidopsis thaliana. Plant Cell Physiol 50: 191-202
Special application note:
This product can be sold containing ProClin if requested
The PsbH protein was originally named 10- or 9-kDa phosphoprotein in higher plant chloroplasts. It is encoded by the plastome in algae and higher plants. PsbH is also present in cyanobacteria, where it exhibits 56% amino acid identity with the corresponding protein from Arabidopsis. The protein contains 63–90 amino acids, depending on the species, with molecular masses between 7.0 and 9.9 kDa.PsbH is an intrinsic membrane protein with a single transmembrane helix and its N-terminal region has been suggested to be exposed to the stromal side of the thylakoid membrane. Presence of PsbH already present in etiolated tissue can indicate that the protein may be involved in early stages of PSII assembly.Obtained biochemical data from PSII complexes isolated from spinach suggest that PsbH, together with other PSII phosphoproteins, may be required for D1 protein turnover by regulating dimeric and monomeric PSII transition through their phosphorylation and dephosphorylation.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
LMW proteins can sometimes interfere with chlorophyll, but most chlorophyll can be removed by precipitating sample in acetone before loading on a gel.Protocol: Add acetone to final concentration of 80% ice-cold acetone. Leave 10 minutes. Spin. Rresuspend pellet in solubilisation buffer and load on a gel.
Application Details:
1 : 5000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 100 µl of sterile water
Molecular Weight:
7.7 | 4 (Arabidopsis thaliana)
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Hackett et al. (2017). An Organelle RNA Recognition Motif Protein Is Required for Photosystem II Subunit psbF Transcript Editing. Plant Physiol. 2017 Apr;173(4):2278-2293. doi: 10.1104/pp.16.01623.Levey et al. (2014). Expression of a nuclear-encoded psbH gene complements the plastidic RNA processing defect in the PSII mutant hcf107 in Arabidopsis thaliana. Plant J. 2014 Oct;80(2):292-304. doi: 10.1111/tpj.12632. Epub 2014 Sep 8.Verhoeven et al. (2009). Seasonal changes in abundance and phosphorylation status of photosynthetic proteins in eastern white pine and balsam fir. Tree Physiol. 29:361-374.
Special application note:
This product can be sold containing ProClin if requested
The PsbI protein, previously named the 4.8-kDa protein, is encoded by the plastome. PsbI is a universal component of PSII and is highly conserved (e.g. there is 71% amino acid identicality between the Arabidopsis and Synechocystis 6803 proteins). The protein contains 36 to 38 amino acids in most species, with molecular masses ranging between 4.1 and 4.5 kDa. Synonymes: PSII-I, PSII 4.8 kDa protein
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Hordeum vulgare
Expected Species:
Cannabis sativa, Glycne max, Phaseolus vulgaris, Populus trichocarpa, Spinacia oleracea, Triticum aestivum, Zea mays Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from PsbI protein of Arabidopsis thaliana P62100, AtCg00080
Hackett et al. (2017). An Organelle RNA Recognition Motif Protein Is Required for Photosystem II Subunit psbF Transcript Editing. Plant Physiol. 2017 Apr;173(4):2278-2293. doi: 10.1104/pp.16.01623.
The PsbI protein, previously named the 4.8-kDa protein, is encoded by the plastome. PsbI is a universal component of PSII and is highly conserved (e.g. there is 71% amino acid identicality between the Arabidopsis and Synechocystis 6803 proteins). The protein contains 36 to 38 amino acids in most species, with molecular masses ranging between 4.1 and 4.5 kDa. Synonymes: PSII-I, PSII 4.8 kDa protein
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Synechocystis sp. PCC 6803
Expected Species:
Cyanobacteria Species of your interest not listed? Contact us
Loads higher than 0,5 g of chlorophyll per well are not recommended
Application Details:
1 : 5000-1 : 10 000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 200 l of sterile water
Molecular Weight:
4.3 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Dobakova et. al (2007). Role of the PsbI Protein inPhotosystem II Assembly and Repair in the Cyanobacterium Synechocystis sp. PCC 6803 Plant Physiol 145:1681-1691.
The PsbN protein is chloroplast-encoded, low molecular weight protein annotated as a photosystem II subunit however it seems that it is not a constituent subunit of PSII but is required for PSII repair from photoinhibition.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Nicotiana tabacum
Expected Species:
Arabis alpina, Camelia sp., Canna indica, Cannabis sativa, Costus pulverulentus, Glycine max, Helianthus tuberosus, Hordeum vulgare, Lactuca sativa, Lilium sp., Manihot esculenta, Oryza sativa, Phaseolus vulgaris, Pisum sativum, Populus trichocarpa, Saccharum officinarum, Solanum tuberosum, Sorghum timorense, Spinacia oleracea, Tricitum aestivum, Thaumatococcus daniellii, Vitis vinifera Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide chosen from PsbN protein of Arabidopsis thaliana Uniprot: P62113, TAIR: AtCg00700
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Torabi et al. (2014). PsbN Is Required for Assembly of the Photosystem II Reaction Center in Nicotiana tabacum. Plant Cell. 2014 Mar;26(3):1183-99. doi: 10.1105/tpc.113.120444. Epub 2014 Mar 11.
The PsbO protein is an extrinisic subunit of the water splitting photosystem II (PSII) complex. The protein is exposed on the luminal side of the thylakoid membrane, and is hihgly conserved in all known oxygenic photosynthetic organisms. Alternative names of PsbO1 include 33 kDa subunit of oxygen evolving system of photosystem II, OEC 33 kDa subunit, 33 kDa thylakoid membrane protein, manganese-stabilizing protein 1 and for PsbO2 33 kDa subunit of oxygen evolving system of photosystem II, OEC 33 kDa subunit, 33 kDa thylakoid membrane protein, manganese-stabilizing protein 2.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica napus, Capsella rubella, Triticum aestivum Species of your interest not listed? Contact us
This antibody is specific to PsbO1 and does not react with PsbO2 as confirmed on a deletion mutant
Application Details:
1 : 1000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
33 | 30 kDa
Not reactive in:
Oryza sativa
Selected references:
Shanmugabalaji et al. (2018). Chloroplast Biogenesis Controlled by DELLA-TOC159 Interaction in Early Plant Development. Curr Biol. 2018 Aug 20;28(16):2616-2623.e5. doi: 10.1016/j.cub.2018.06.006.
The PsbO protein is an extrinisic subunit of the water splitting photosystem II (PSII) complex. The protein is exposed on the luminal side of the thylakoid membrane, and is hihgly conserved in all known oxygenic photosynthetic organisms. Alternative names of PsbO1 include 33 kDa subunit of oxygen evolving system of photosystem II, OEC 33 kDa subunit, 33 kDa thylakoid membrane protein, manganese-stabilizing protein 1 and for PsbO2 33 kDa subunit of oxygen evolving system of photosystem II, OEC 33 kDa subunit, 33 kDa thylakoid membrane protein, manganese-stabilizing protein 2.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica napus, Capsella rubella, dinoflagellate, Triticum aestivum Species of your interest not listed? Contact us
This antibody is specific to PsbO2 and does not react with PsbO1 as confirmed on deletion mutant
Application Details:
1 : 1000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
33 | 30 kDa
Selected references:
Pipitone et al. (2021). A multifaceted analysis reveals two distinct phases of chloroplast biogenesis during de-etiolation in Arabidopsis. Elife. 2021 Feb 25;10:e62709. doi: 10.7554/eLife.62709. PMID: 33629953; PMCID: PMC7906606.Pralon et al. (2019). Plastoquinone homoeostasis by Arabidopsis proton gradient regulation 6 is essential for photosynthetic efficiency. Commun Biol. 2019 Jun 20;2:220. doi: 10.1038/s42003-019-0477-4.
The PsbO protein is an extrinisic subunit of the water splitting photosystem II (PSII) complex. The protein is exposed on the luminal side of the thylakoid membrane, and is hihgly conserved in all known oxygenic photosynthetic organisms. Alternative names of PsbO1 include 33 kDa subunit of oxygen evolving system of photosystem II, OEC 33 kDa subunit, 33 kDa thylakoid membrane protein, manganese-stabilizing protein 1 and for PsbO2 33 kDa subunit of oxygen evolving system of photosystem II, OEC 33 kDa subunit, 33 kDa thylakoid membrane protein, manganese-stabilizing protein 2.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Mazur et al. (2021) The SnRK2.10 kinase mitigates the adverse effects of salinity by protecting photosynthetic machinery. Plant Physiol. 2021 Dec 4;187(4):2785-2802. doi: 10.1093/plphys/kiab438. PMID: 34632500; PMCID: PMC8644180.Toubiana et al. (2020). Correlation-based Network Analysis Combined With Machine Learning Techniques Highlight the Role of the GABA Shunt in Brachypodium Sylvaticum Freezing Tolerance. Sci Rep , 10 (1), 4489Wang et al. (2019). YR36/WKS1-mediated Phosphorylation of PsbO, an Extrinsic Member of Photosystem II, Inhibits Photosynthesis and Confers Stripe Rust Resistance in Wheat. Mol Plant. 2019 Oct 14. pii: S1674-2052(19)30330-2. doi: 10.1016/j.molp.2019.10.005.An et al. (2019). Protein cross-interactions for efficient photosynthesis in the cassava cultivar SC205 relative to its wild species. J Agric Food Chem. 2019 Jul 19. doi: 10.1021/acs.jafc.9b00046.Rozp?dek et al. (2018). Acclimation of the photosynthetic apparatus and alterations in sugar metabolism in response to inoculation with endophytic fungi. Plant Cell Environ. 2018 Dec 5. doi: 10.1111/pce.13485.
Special application note:
Loading based on 50-100 ng of chlorophyll is enough to obtain good signal with this antibody
PSII reaction centre components are generating the redox potential required to drive highly oxidizing water splitting reaction. Four Mn atoms are present on a lumenal surface and form the catalyctic site of the water-splitting reaction which is in close association with the 33 kDa (PsbO), 23 kDa (PsbP) and 17 kDa (PsbQ) extrinistic subunits of oxygen evolving complex OEC. A 33-kDa extrinsic protein is also termed the Mn-stabilizing protein (MSP), however recent evidences shown that it is C-terminal domain of PsbA (D1) protein which is involved in in the assembly and stabilization of the OEC.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
This antibody can be used as a loading control for Chlamydomonas reinhardtii while it not so suitable for higher plants as accumulation of these proteins might drop to 12.5-25 % of the WT level in mutants defective for PSII core (Schult et al. 2007).
Application Details:
1 : 2000-1 : 5000 (WB)
Purity:
Total IgG. Protein G purified in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
35 | 33 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Cecchin et al (2021) LPA2 protein is involved in photosystem II assembly in Chlamydomonas reinhardtii. Plant J. 2021 Jul 4. doi: 10.1111/tpj.15405. Epub ahead of print. PMID: 34218480.Loudya et al. (2021) Cellular and transcriptomic analyses reveal two-staged chloroplast biogenesis underpinning photosynthesis build-up in the wheat leaf. Genome Biol. 2021 May 11;22(1):151. doi: 10.1186/s13059-021-02366-3. PMID: 33975629; PMCID: PMC8111775.Terentyev (2020: The Main Structural and Functional Characteristics of Photosystem-II-Enriched Membranes Isolated From Wild Type and cia3 Mutant Chlamydomonas reinhardtii. Life (Basel). 2020 May 14;10(5):E63. doi: 10.3390/life10050063..Tang el al. (2020). OsNSUN2-Mediated 5-Methylcytosine mRNA Modification Enhances Rice Adaptation to High Temperature. Dev Cell. 2020 May 4;53(3):272-286.e7. doi: 10.1016/j.devcel.2020.03.009.Smythers et al. (2019). Characterizing the effect of Poast on Chlorella vulgaris, a non-target organism. Chemosphere Volume 219, March 2019, Pages 704-712.
Special application note:
Total IgG fraction has been purified by 40% ammonium sulpgate precipitation followed by DEAE cellulose chromatographyThis product can be sold containing ProClin if requested
The PsbO protein is an extrinisic subunit of the water splitting photosystem II (PSII) complex. The protein is exposed on the luminal side of the thylakoid membrane, and is hihgly conserved in all known oxygenic photosynthetic organisms.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please, remember to spin tubes briefly prior to opening them to avoid any losses that might occur from lyophilized material adhering to the cap or sides of the tubes.
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Expected Species:
Halomicronema hongdechloris, Synechocystissp., Synechococcus elongatusSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated peptide derived from Chlamydomonas reinhardtii PsbO protein sequence, UniProt: P12853
PSII reaction centre components are generating the redox potential required to drive highly oxidizing water splitting reaction. Four Mn atoms are present on a lumenal surface and form the catalyctic site of the water-splitting reaction which is in close association with the 33 kDa (PsbO), 23 kDa (PsbP) and 17 kDa (PsbQ) extrinistic subunits of oxygen evolving complex OEC. A 33-kDa extrinsic protein is also termed the Mn-stabilizing protein (MSP), however recent evidences shown that it is C-terminal domain of PsbA (D1) protein which is involved in in the assembly and stabilization of the OEC.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Sorghum bicolor, Zea mays
Expected Species:
Hordeum vulgare, Oryza sativa Species of your interest not listed? Contact us
PsbP - 23 kDa extrinsic protein of photosystem II (PSII). Processing of the protein results in a protein with molecular mass of around 20 kDa. PsbP is required to optimize water splitting process in PSII, by probab y by optimisation of calcium and Cl- levels. The protein is found in higher plants and algae but is not conserved in cyanobacteria. Synonymes:Oxygen-evolving enhancer protein 2-1, chloroplastic, OEE2, 23 kDa subunit of oxygen evolving system of photosystem II, OEC 23 kDa subunit, OEC23, 23 kDa thylakoid membrane protein
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Mazur et al. (2021) The SnRK2.10 kinase mitigates the adverse effects of salinity by protecting photosynthetic machinery. Plant Physiol. 2021 Dec 4;187(4):2785-2802. doi: 10.1093/plphys/kiab438. PMID: 34632500; PMCID: PMC8644180.Tamburino et al. (2017). Chloroplast proteome response to drought stress and recovery in tomato (Solanum lycopersicum L.). BMC Plant Biol. 2017 Feb 10;17(1):40. doi: 10.1186/s12870-017-0971-0.Pavlovi? et al. (2016). Light-induced gradual activation of photosystem II in dark-grown Norway spruce seedlings. Biochim Biophys Acta. 2016 Feb 18. pii: S0005-2728(16)30028-7. doi: 10.1016/j.bbabio.2016.02.009.Albanese et al. (2016). Isolation of novel PSII-LHCII megacomplexes from pea plants characterized by a combination of proteomics and electron microscopy. Photosynth Res. 2016 Jan 9.Grassl et al. (2012). Early events in plastid protein degradation in stay-green Arabidopsis reveal differential regulation beyond the retention of LHCII and chlorophyll. J. Proteome Res. October 2.
Special application note:
This product can be sold containing ProClin if requested
PSII reaction centre components are generating the redox potential required to drive highly oxidizing water splitting reaction. Four Mn atoms are present on a lumenal surface and form the catalyctic site of the water-splitting reaction which is in close association with the 33 kDa (PsbO), 23 kDa (PsbP) and 17 kDa (PsbQ) extrinistic subunits of oxygen evolving complex OEC. A 33-kDa extrinsic protein is also termed the Mn-stabilizing protein (MSP), however recent evidences shown that it is C-terminal domain of PsbA (D1) protein which is involved in in the assembly and stabilization of the OEC.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Load per well on cell extract of Pinus banksiana (Jack Pine) was 7 g.This antibody can be used as a loading control for Chlamydomonas reinhardtii while it not so suitable for higher plants as accumulation of these proteins might drop to 12.5-25 % of the WT level in mutants defective for PSII core (Schult et al. 2007).
Application Details:
1 : 2000-1 : 5000 (WB)
Purity:
Total IgG. Protein G purified in PBS pH 7.4.
Reconstitution:
For reconstitution add 200 l of sterile water
Molecular Weight:
28 | 23 kDa
Not reactive in:
Synechococcus sp. PCC 7942
Selected references:
Lim et al (2022). Arabidopsis guard cell chloroplasts import cytosolic ATP for starch turnover and stomatal opening. Nat Commun. 2022 Feb 3;13(1):652. doi: 10.1038/s41467-022-28263-2. PMID: 35115512; PMCID: PMC8814037.Lim et al (2022) Arabidopsis guard cell chloroplasts import cytosolic ATP for starch turnover and stomatal opening. Nat Commun. 2022 Feb 3;13(1):652. doi: 10.1038/s41467-022-28263-2. PMID: 35115512; PMCID: PMC8814037.Cecchin et al (2021) LPA2 protein is involved in photosystem II assembly in Chlamydomonas reinhardtii. Plant J. 2021 Jul 4. doi: 10.1111/tpj.15405. Epub ahead of print. PMID: 34218480.Jiang et al. (2020). Plastid chaperone HSP90C guides precursor proteins to the SEC translocase for thylakoid transport. J Exp Bot. 2020 Aug 27;eraa399.doi: 10.1093/jxb/eraa399. Nama et al. (2018). Non-photochemical quenching-dependent acclimation and thylakoid organization of Chlamydomonas reinhardtii to high light stress. Photosynth Res. 2018 Jul 7. doi: 10.1007/s11120-018-0551-7.
PsbP-like protein (sll1418) is a cyanobacterial homologue of plant PsbP-like protein. It is localized in the thylakoid membrane and associated with photosystem II. Synonymes: Sll1418 protein
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Synechocystis sp. PCC 6803
Expected Species:
Anabaena variabilis, Arthrospira maxima, Lyngbya sp. PCC 8106, Microcoleus chthonoplastes, Ostreococcus lucimarinus, Trichodesmium erythraeum, Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from PsbP -like protein of Synechocystis sp. PCC 6803, UniProt: P73952
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Gandini et al. (2017). The transporter SynPAM71 is located in the plasma membrane and thylakoids, and mediates manganese tolerance in Synechocystis PCC6803. New Phytol. 2017 Mar 20. doi: 10.1111/nph.14526.Sveshnikov et al. (2007) The PsbP-like protein (sll1418) of Synechocystis sp. PCC 6803 stabilises the donor side of Photosystem II, Photosynth. Res. 93, 101-109.Ishikawa et al. . (2005) Functional analysis of the PsbP-like protein (sll1418) in Synechocystis sp. PCC 6803, Photosynth. Res. 84, 257-262.
PsbR protein is found in plant Photosystem II and anticipate to play a role in water oxidation, yet the physiological significance of PsbR has remained obscure.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Yang-Er Chen et al. (2017). Responses of photosystem II and antioxidative systems to high light and high temperature co-stress in wheat. J. of Exp. Botany, Volume 135, March 2017, Pages 45–55.Shen et al. (2016). The existence of C4-bundle-sheath-like photosynthesis in the mid-vein of C3 rice. Rice (N Y). 2016 Dec;9(1):20. doi: 10.1186/s12284-016-0094-5. Epub 2016 May 10.Albanese et al. (2016). Isolation of novel PSII-LHCII megacomplexes from pea plants characterized by a combination of proteomics and electron microscopy. Photosynth Res. 2016 Jan 9.Dixit (2015). Sulfur alleviates arsenic toxicity by reducing its accumulation and modulating proteome, amino acids and thiol metabolism in rice leaves. Sci Rep. 2015 Nov 10;5:16205. doi: 10.1038/srep16205.Ido et al. (2014). Cross-Linking Evidence for Multiple Interactions of the PsbP and PsbQ Proteins in a Higher Plant Photosystem II Supercomplex. J Biol Chem. 2014 Jul 18;289(29):20150-7. doi: 0.1074/jbc.M114.574822. Epub 2014 Jun 9.
Special application note:
This product can be sold containing proclin if requested
The 22 kDa PsbS protein of photosystem II functions in the regulation of photosynthetic light harvesting. Along with a low thylakoid lumen pH and the presence of de-epoxidized xanthophylls, PsbS is necessary for photoprotective thermal dissipation of excess absorbed light energy in plants, measured as non-photochemical quenching of chlorophyll fluorescence.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4 C; make aliquots to avoid working with a stock. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
KLH-conjugated synthetic peptide derived from available di and monocot PsbS sequences, including Arabidopsis thaliana (At1g44575). This sequence is even conserved in conifers.
Purified, total IgY (chicken egg yolk immunoglobulin) in PBS pH 8. Contains 0.02 % sodium azide.
Molecular Weight:
28 | 22 kDa for Arabidopsis thaliana
Not reactive in:
Chlamydomonas reinhardtii, Chlorella sp.
Selected references:
Hubbart et al. (2012). The photoprotective protein PsbS exerts control over CO2 assimilation rate in fluctuating light in rice. The Plant J. March 2012.
The 22 kDa PsbS protein of photosystem II functions in the regulation of photosynthetic light harvesting. Along with a low thylakoid lumen pH and the presence of de-epoxidized xanthophylls, PsbS is necessary for photoprotective thermal dissipation of excess absorbed light energy in plants, measured as non-photochemical quenching of chlorophyll fluorescence. Synonymes: NPQ4 (NONPHOTOCHEMICAL QUENCHING).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Chlamydomonas reinhardtii, Cucumis sativus, Medicago truncatula, Physcomitrium patens, Picea sitchensis, Pinus radiata, Pinus taeda, Populus balsamifera, Solanum lycopersicum, Tarenaya hassleriana, Zosteria marina, Vitis viniferaSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide located in solubilized part of the protein, derived from available di- and monocot PsbS sequences, including Arabidopsis thaliana UniProt:Q9XF91, TAIR:At1g44575
This product can be sold containing proclin if requested
Application Details:
1 : 2000 - 1: 10 000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
28 | 22 kDa for Arabidopsis thaliana
Not reactive in:
Lobosphaera incisa
Selected references:
Jiang et al. (2020). Plastid chaperone HSP90C guides precursor proteins to the SEC translocase for thylakoid transport. J Exp Bot. 2020 Aug 27;eraa399.doi: 10.1093/jxb/eraa399. Barbato et al. (2020). Higher Order Photoprotection Mutants Reveal the Importance of ?pH-dependent Photosynthesis-Control in Preventing Light Induced Damage to Both Photosystem II and Photosystem I. Sci Rep . 2020 Apr 21;10(1):6770. doi: 10.1038/s41598-020-62717-1.Nikkanen et al. (2018). Multilevel regulation of non-photochemical quenching and state transitions by chloroplast NADPH-dependent thioredoxin reductase. Physiol Plant. 2018 Dec 22. doi: 10.1111/ppl.12914.Chen et al. (2018). Exogenous melatonin enhances salt stress tolerance in maize seedlings by improving antioxidant and photosynthetic capacity. Physiol Plant. 2018 Apr 6. doi: 10.1111/ppl.12737.Glowacka et al. (2018). Photosystem II Subunit S overexpression increases the efficiency of water use in a field-grown crop. Nat Commun. 2018 Mar 6;9(1):868. doi: 10.1038/s41467-018-03231-x.
PsbTn (Tn protein of PSII) nuclear encoded protein involved in photosynthesis. Alternative names: photosystem II 5 kDa protein, chloroplastic, PSII-T, Nuclear encoded psbT.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Cicer arietinum, Glycine soja, Helianthus annuus, Medicago truncatula, Nicotiana attenuata, Nicotiana tabacum, Nicotiana sylvestris, Noccaea caerulescens, Petunia hybrida, Populus trichocarpa, Solanum chacoense, Solanum tuberosum Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide, derived from Arabidopsis thaliana PsbTn protein sequence, UniProt:Q39195, TAIR: AT3G21055
LMW proteins can sometimes interfere with chlorophyll, but most chlorophyll can be removed by precipitating sample in acetone before loading on a gel.Protocol: Add acetone to final concentration of 80% ice-cold acetone. Leave 10 minutes. Spin. Rresuspend pellet in solubilisation buffer and load on a gel.
Application Details:
1: 1000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 200 l of sterile water
Molecular Weight:
11 | 5 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Chen et al. (2019). The Low Molecular Mass Photosystem II Protein PsbTn is Important for Light Acclimation. Plant Physiol. Apr;179(4):1739-1753. doi: 10.1104/pp.18.01251.
PsbW is a nuclear-encoded protein located in the thylakoid membrane of the chloroplast. It is a core component of Photosystem II. Altrnative name: PSII 6.1 kDa protein
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Hackett et al. (2017). An Organelle RNA Recognition Motif Protein Is Required for Photosystem II Subunit psbF Transcript Editing. Plant Physiol. 2017 Apr;173(4):2278-2293. doi: 10.1104/pp.16.01623.
Plant PsbX is a nucelar encoded small 4 kDa protein associated with Photosystem II and found in all classes of oxygenic organisms.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Dictos, Oryza sativa, Zea mays Species of your interest not listed? Contact us
For an image of antibody detection in a western blot application see Garcia-Cerdan et al. (2008).
Application Details:
1 : 2500, 1 g of chlorophyll/lane (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 200 l of sterile water
Molecular Weight:
4 kDa
Not reactive in:
Cyanobacteria
Selected references:
Hackett et al. (2017). An Organelle RNA Recognition Motif Protein Is Required for Photosystem II Subunit psbF Transcript Editing. Plant Physiol. 2017 Apr;173(4):2278-2293. doi: 10.1104/pp.16.01623.
Special application note:
PsbX is a small (4 kDa) and very hydrophobic subunit of PSII, Immunoblots from SDS-gels (especially with high loading) may show higher molecular weight signals from PsbX not fully detached from other subunits of PSII, The use of 15% SDS-PAGE gels with 2-4 M urea is recommended when working with this antibody
PsbY (Small subunit Y of PSII) is a manganese-binding polypeptide with L-arginine metabolizing enzyme activity. It is a component of the core of photosystem II. Alternative names: psbY-A1, L-AME, L-arginine.metabolizing enzyme.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Glycne soja , Medicago truncatula, Morus notabilis, Oryza sativa, Populus trichocarpa, Ricinus communi, Solanum chacoense, Spinacia oleracea, Theobroma cacao , Zea mays, Zostera marina Species of your interest not listed? Contact us
Von Sydow et al. (2016). The PsbY protein of Arabidopsis Photosystem II is important for the redox control of cytochrome b559. Biochim Biophys Acta. 2016 May 21. pii: S0005-2728(16)30536-9. doi: 10.1016/j.bbabio.2016.05.004.
Psc is a polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development. Alternative names: Protein posterior sex combs
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Lyophilized antibody can be stored at -20 °C for up to 3 years. Re-constituted antibody can be stored at 4°Cfor several days to weeks. Once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Drosophila melanogaster
Immunogen:
GST-conjugated, full length Psc protein of Drosophila melanogaster, UniProt: P35820
Phosphorylation is a post-translational modification of proteins in which a phosphate group is covalently bound to a serine, threonine or a thyrosine residue by a protein kinase. Phosphorylation of a protein can result in activation or inhibition of a proteins function and is thereby a regulatory mechanisms of protein activation.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at 2-8 C; add sodium azide to 0,05% for porlonged storage, Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Immunoglobulin Protein A purified in a 10 mM ammonium bicarbonate buffer, with 2 mg of BSA.
Reconstitution:
Recommended antibody concentration: 0.5 mg/ml (when dissolved at 0.5 mg/ml, the BSA concentration will be 1%). Recommended to dissolve in; 100 mM PBS or Tris-HCl, pH 7.0 Additional sodium azide ( up to 0.05%) is recommended for long term storage. For a 0.5 mg/ml antibody concentration in 1% BSA, dissolve in 200 μl buffer.
PSY (Phytoene synthase) is a rate-limiting enzyme in the carotenoid biosynthetic pathway.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Cerda et al. (2020). Functional characterisation and in silico modelling of MdPSY2 variants and MdPSY5 phytoene synthases from Malus domestica. J Plant Physiol . 2020 Jun;249:153166.doi: 10.1016/j.jplph.2020.153166.
Phosphate acetyltransferase (PTA) - EC=2.3.1.8 is an enzyme from transferase family which participates in three metabolic pathways: taurine and hypotaurine metabolism, pyruvate metabolism and propanoate metabolism. Alternative names: acetyl-CoA:phosphate acetyltransferase, phosphotransacetylase, phosphoacylase.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Expected Species:
Volvox carteri Species of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide conjugated derived from PTA2 of Chlamydomonas reinhardtii A8IZZ9
PTEN (phosphatase and tensin homolog) is a tumor suppressor that negatively regulates the PI3KAKT signaling pathway. Loss of PTEN function has been implicated in the pathogenesis of a number of different tumors, particularly endometrial cancer.
PTEN (phosphatase and tensin homolog) is a tumor suppressor that negatively regulates the PI3KAKT signaling pathway. Loss of PTEN function has been implicated in the pathogenesis of a number of different tumors, particularly endometrial cancer.
PTEN (phosphatase and tensin homolog) is a tumor suppressor that negatively regulates the PI3KAKT signaling pathway. Loss of PTEN function has been implicated in the pathogenesis of a number of different tumors, particularly endometrial cancer.
PTOX (plastid terminal oxidase) is a component of electron transfer chain responsible for desaturation of phytoene, which prevents the generation of reactive oxygen species. It is involved in the differentiation of plastids: chloroplasts, amyloplasts, and etioplasts. PTOX is expressed ubiquitously in plant tissues and is located in the lumen.Synonymes: IM, IM1, immutants, AOX4, alternative oxidase 4, ubiquinol oxidase 4, chloroplastic/chromoplastic
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
In most plants it is a minor polypeptide and consequently enrichment by analyzing membrane fractions for example is recommended
Application Details:
1 : 4000 (WB)
Purity:
Serum
Reconstitution:
For reconstitution add 100 µl of sterile water
Molecular Weight:
30 | 37-41 kDa (Arabidopsis thaliana)
Not reactive in:
Galdieria sulphuraria, Phaeodactylum tricornutum
Selected references:
Urban, Rogowski & Romanowska (2022), Crucial role of the PTOX and CET pathways in optimizing ATP synthesis in mesophyll chloroplasts of C3 and C4 plants, Environmental and Experimental Botany, Volume 202, October 2022, 105024, https://doi.org/10.1016/j.envexpbot.2022.105024Pralon et al. (2020). Mutation of the Atypical Kinase ABC1K3 Partially Rescues the PROTON GRADIENT REGULATION 6 Phenotype in Arabidopsis thaliana. Front. Plant Sci., 25 March 2020Bolte et al. (2020). Dynamics of the localization of the plastid terminal oxidase PTOX inside the chloroplast. J Exp Bot. 2020 Feb 15. pii: eraa074. doi: 10.1093/jxb/eraa074.Cournac et al. (2000b). Flexibility in photosynthetic electron transport: a newly identified chloroplast oxidase involved in chlororespiration. Philos Trans R Soc Lond B Biol Sci. 2000 Oct 29;355(1402):1447-54Cournac et al. (2000a). Electron flow between photosystem II and oxygen in chloroplasts of photosystem I-deficient algae is mediated by a quinol oxidase involved in chlororespiration. J Biol Chem. 2000 Jun 9;275(23):17256-62.
Special application note:
This product can be sold containing proclin if requested
Tyrosine phosphorylation is considered to be one of the key steps in signal transduction and regulation of enzymatic activity. Phosphotyrosine antibodies are helpful in facilitating the identification of tyrosine kinase substrates.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Liquid
Storage Temp:
Store at -20 °C for one year; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Mouse
Species Reactivity:
Antibody reacts with phosphotyrosine and detects the presence of phosphotyrosine in proteins of both unstimulated and stimulated cell lysated, Does not cross react with phosphoserine or phosphothreonine
Immunogen:
Phosphotyrosine, alanine and glyceine in a 1:1:1 ratio polymerized in the presence of keyhole limpet hemocyanin KLH with 1-ethyl-3-(3’-dimentrylaminopropyl) carbodiimide
Applications:
Immunoprecipitation (IP), Immunofluorescence (IF), Immunohistochemistry (IHC), Western blot (WB)
1 g/ml of this antibody is sufficient for detection of phosphorylated tyrosine residues in 10 g of rat tissue lysate by colorimetric immunoblot analysis
Application Details:
1 : 1000 (WB)
Conjugation:
IgG1
Isotype:
IgG1
Purity:
Total IgG.
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Garton & Tonks (1999). Regulation of fibroblast motility by the protein tyrosine phosphatase PTP-PEST. J Biol Chem 6:3811-3818.Tiganis et al. (1999). The protein-tyrosine phosphatase TCPTP regulates epidermal growth factor receptor-mediated and phosphatidylinositol 3-kinase-dependent signaling. J Biol Chem 39: 27768-27775.(IF):Garton et al. (1996). Identification of p130(cas) as a substrate for the cytosolic protein tyrosine phosphatase PTP-PEST. Mol and Cell Bio 11:6408-6418.(IP):
Special application note:
Protein G purified IgG1 in PBS, pH 7,4 with 0,09 % sodium azide and 50 % glycerol at concentration 1 mg/ml
Exosomes are small endosome derived lipid nanoparticles (50-120 nm) actively secreted by exocytosis by most living cells. Exosome release occurs either constitutively or upon induction, under both normal and pathological conditions, in a dynamic, regulated and functionally relevant manner. Both amount and molecular composition of released exosomes depend on the state of a parent cell. Exosomes have been isolated from diverse cell lines (hematopoietic cells, tumor lines, primary cultures, virus infected cells) as well as from biological fluids in particular blood (e.g. serum and plasma from cancer patients) and other body fluids (bronchoalveolar lavage fluid, pleural effusions, synovial fluid, urine, amniotic fluid, semen, saliva etc). Exosomes have pleiotropic physiological and pathological functions and an emerging role in diverse pathological conditions such as cancer, infectious and neurodegenerative diseases.
Exosomes are small endosome derived lipid nanoparticles (50-120 nm) actively secreted by exocytosis by most living cells. Exosome release occurs either constitutively or upon induction, under both normal and pathological conditions, in a dynamic, regulated and functionally relevant manner. Both amount and molecular composition of released exosomes depend on the state of a parent cell. Exosomes have been isolated from diverse cell lines (hematopoietic cells, tumor lines, primary cultures, virus infected cells) as well as from biological fluids in particular blood (e.g. serum and plasma from cancer patients) and other body fluids (bronchoalveolar lavage fluid, pleural effusions, synovial fluid, urine, amniotic fluid, semen, saliva etc). Exosomes have pleiotropic physiological and pathological functions and an emerging role in diverse pathological conditions such as cancer, infectious and neurodegenerative diseases.
Product Type:
Concentrator | EV purification
Storage Temp:
+ 4 C
Applications:
Concentrator | EV purification
Additional Info:
TFF-MV is a filter cartridge in hollow fibers made of polysulfone. The filter is very useful for separating different EVs by size. Indeed, microvesicles bigger than 150 nm are retained inside the hollow fibers, while small EVs and molecules easily permeate the filter. Microvesicles can be recovered with a syringe in PBS buffer without additional purification steps.
Filter cartridge: Polysulfone hollow fibres
Sample volume per reaction: Recommended sample volume from 10 ml up to several liters if connected to mechanical pump
Exosomes are small endosome derived lipid nanoparticles (50-120 nm) actively secreted by exocytosis by most living cells. Exosome release occurs either constitutively or upon induction, under both normal and pathological conditions, in a dynamic, regulated and functionally relevant manner. Both amount and molecular composition of released exosomes depend on the state of a parent cell. Exosomes have been isolated from diverse cell lines (hematopoietic cells, tumor lines, primary cultures, virus infected cells) as well as from biological fluids in particular blood (e.g. serum and plasma from cancer patients) and other body fluids (bronchoalveolar lavage fluid, pleural effusions, synovial fluid, urine, amniotic fluid, semen, saliva etc). Exosomes have pleiotropic physiological and pathological functions and an emerging role in diverse pathological conditions such as cancer, infectious and neurodegenerative diseases.
Exosomes are small endosome derived lipid nanoparticles (50-120 nm) actively secreted by exocytosis by most living cells. Exosome release occurs either constitutively or upon induction, under both normal and pathological conditions, in a dynamic, regulated and functionally relevant manner. Both amount and molecular composition of released exosomes depend on the state of a parent cell. Exosomes have been isolated from diverse cell lines (hematopoietic cells, tumor lines, primary cultures, virus infected cells) as well as from biological fluids in particular blood (e.g. serum and plasma from cancer patients) and other body fluids (bronchoalveolar lavage fluid, pleural effusions, synovial fluid, urine, amniotic fluid, semen, saliva etc). Exosomes have pleiotropic physiological and pathological functions and an emerging role in diverse pathological conditions such as cancer, infectious and neurodegenerative diseases.
Store up to 1 year at 4°C >>> Storage of reconstituted exosomes: Stored at -20°C for up to one month or at -80°C for up to 6 months. Recommended to avoid repeated freeze-and-thraw cycles.. Avoid repeated freeze-and-thaw cycles.
Assay calibration. Control (spike-in) for exosome quantification. Protein marker analysis using different techniques. Extraction and analysis of exosome nucleic acid. Standardized positive controls for immunocapture performance evaluation. Flow cytometry. Electron microscopy.
Store up to 1 year at 4°C >>> Storage of reconstituted exosomes: Stored at -20°C for up to one month or at -80°C for up to 6 months. Recommended to avoid repeated freeze-and-thraw cycles.. Avoid repeated freeze-and-thaw cycles.
Assay calibration. Control (spike-in) for exosome quantification. Protein marker analysis using different techniques. Extraction and analysis of exosome nucleic acid. Standardized positive controls for immunocapture performance evaluation. Flow cytometry. Electron microscopy.
Store up to 1 year at 4°C >>> Storage of reconstituted exosomes: Stored at -20°C for up to one month or at -80°C for up to 6 months. Recommended to avoid repeated freeze-and-thraw cycles.. Avoid repeated freeze-and-thaw cycles.
Assay calibration. Control (spike-in) for exosome quantification. Protein marker analysis using different techniques. Extraction and analysis of exosome nucleic acid. Standardized positive controls for immunocapture performance evaluation. Flow cytometry. Electron microscopy.
10 mM Sodium Phosphate, 0.5 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
PYK10 is the main component of ER bodies. It has hydrolase activity, hydrolyzing O-glycosyl compounds It may produce defense compounds when plants are damaged by insects or wounding. Cellular localisation: ER bodies.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid at 2 mg/ml.
Storage Temp:
Store at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Species of your interest not listed? Contact us
Immunogen:
Conjugated peptide, derived from Arabidopsis thaliana C-terminal of PYK10, UniProt: A0A178VCN3, TAIR: At3g08880.
N-terminal signal peptide including 24 amino acis and ER retention signal is removed from the mature protein
Application Details:
1:500-1:1000 (IHC), 1: 5000- 1: 20 000 (WB)
Purity:
Total IgG. Protein A purified in PBS, 50% glycerol. Filter sterilized.
Molecular Weight:
59,7 | 56 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Matsushima et al. (2003). A novel ER-derived compartment, the ER body, selectively accumulates a beta-glucosidase with an ER-retention signal in Arabidopsis. Plant J. 2003 Feb;33(3):493-502. doi: 10.1046/j.1365-313x.2003.01636.x.
PYK10 is the main component of ER bodies. It has hydrolase activity, hydrolyzing O-glycosyl compounds It may produce defense compounds when plants are damaged by insects or wounding.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid at 2 mg/ml.
Storage Temp:
Store at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Species of your interest not listed? Contact us
Immunogen:
Conjugated peptide, derived from Arabidopsis thaliana internal part of PYK10, UniProt: A0A178VCN3, TAIR: At3g08880.
Applications:
Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western blot (WB)
Total IgG. Protein A purified in PBS, 50% glycerol. Filter sterilized.
Molecular Weight:
59,7 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Yamada et al. (2013). Identification of Two Novel Endoplasmic Reticulum Body-Specific Integral Membrane Proteins. Plant Physiol. 2013 Jan;161(1):108-20. doi: 10.1104/pp.112.207654. (Western blot, Arabidopsis thaliana) Nagano et al. (2005). Activation of an ER-body-localized -Glucosidase via a Cytosolic Binding Partner in Damaged Tissues of Arabidopsis thaliana. Plant Cell Physiol. 2005 Jul;46(7):1140-8. doi: 10.1093/pcp/pci126. (Immunoprecipiation, Western blot, Arabidopsis thaliana)Matshushima et al. (2003). A novel ER-derived compartment, the ER body, selectively accumulates a beta-glucosidase with an ER-retention signal in Arabidopsis. Plant J . 2003 Feb;33(3):493-502. doi: 10.1046/j.1365-313x.2003.01636.x. Immunofluorescence, Immunohistochemistry, Western blot, Arabidopsis thaliana)
PYR1 (Abscisic acid receptor RCAR11) is a member of PYR (pyrabactin resistance) family, which function as abscisic acid sensors. Alternative names: ABI1-binding protein 6, Protein PYRABACTIN RESISTANCE 1, Regulatory components of ABA receptor 11.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica sp. Species of your interest not listed? Contact us
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Barghetti et al. (2017). Heat-shock protein 40 is the key farnesylation target in meristem size control, abscisic acid signaling, and drought resistance. Genes Dev. 2017 Nov 15;31(22):2282-2295. doi: 10.1101/gad.301242.117.
X
We use cookies to help personalise and improve your web experience.
By using our website you consent to our use of cookies, some of which may have already been set on your device.
View our Cookie Policy to learn more.