CA125 antigen is usually associated with ovarian epithelial malignancies. Serum assays are widely used to detect this protein in the monitoring of ovarian cancers. CA125 antigen may also be detected by immunohistochemistry and expression has been found in neoplasms such as seminal vesicle carcinoma and anaplastic lymphoma. CA125 antigen is not found exclusively in malignant tumors. CA125 is also known as MUC16.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
Ov185:1
Concentration:
Greater than or equal to 12.5 mg/L
Storage buffer:
Purified in PBS, 1% BSA and 15 mM sodium azide
Storage:
2-8°C
References 1:
Weng D et al. Int. Journal of Cancer. 2011; 129:1990-2001
References 2:
Gabriel M et al. Gynakol Geburtshilfliche Rundsch. 2000; 40(3-4):140-144
References 3:
Gabriel M et al. Ginekol Pol. 1999; 70(11):819-823
Chromogranin A is a 68 kD acidic protein which is reported to be widely expressed in neural tissues and in secretory granules of human endocrine cells, for example, parathyroid gland, adrenal medulla, anterior pituitary gland, islet cells of the pancreas and C cells of the thyroid. Chromogranin A expression has been reported in neuroendocrine tumors such as pituitary adenomas, islet cell tumors, phaeochromocytomas, medullary thyroid carcinomas, Merkel cell tumors and carcinoids.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
5H7
Concentration:
Greater than or equal to 13 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Khandeparker SGS et al. Journal of Pediatric Neurosciences. 2013; 8(3): 239-242.
References 2:
Marcu M et al. Current Health Sciences Journal. 2010; 32: 37-42
The CD34 antigen is a single chain transmembrane glycoprotein with a molecular weight of 110 kD. The CD34 protein is selectively expressed on human lymphoid and myeloid hemopoietic progenitor cells. The CD34 antigen is also expressed on vascular enothelium. Enzyme digestion of paraffin sections is recommended with clone QBEnd/10 in perference to heat induced epitope retrieval as it produces stronger staining and reduces background elastin staining
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
QBEnd/10
Concentration:
Greater than or equal to 261 mg/L
Storage buffer:
Tissue culture supernatant with Sodium azide
Storage:
2-8°C
References 1:
Tornoczky T et al. Journal of Clinical Pathology. 2003; 56(5):363367
References 2:
Cox G et al. Lung Cancer. 2000; 29(3):169177
References 3:
Dhillon AP et al. Journal of Pathology. 1990; 162:274
References 4:
Ramani P et al. Histopathology. 1990; 17(3):237242
References 5:
Watanabe T et al. Journal of Clinical Pathology. 2001; 54:631636.
Epithelial membrane antigen (EMA), also known as episialin, is reported to be expressed in a variety of normal and neoplastic epithelia. It has been reported that markers to CD45 (LCA) when used in conjunction with markers to EMA are useful in labeling cells of lymphoid origin, whereas the combination of anti-cytokeratin antibodies together with EMA is useful to characterize cells of epithelial origin. EMA is also notably described to be expressed in a subset of Hodgkin's lymphomas.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
GP1.4
Concentration:
Greater than or equal to 11 mg/L
Storage buffer:
Tissue culture supernatant with Sodium azide
Storage:
2-8°C
References 1:
Kim JH et al. The Korean Journal of Pathology. 2002; 36:6669
References 2:
Kim GY et al. The Korean Journal of Pathology. 2002; 36:5154
References 3:
Kojima M et al. Modern Pathology. 2002; 15(7):750758
References 4:
Yokozaki H et al. Japanese Journal of Clinical Oncology. 2000; 30:101104
Gross cystic disease of the breast is a benign premenopausal disorder in which cysts are a predominant pathological lesion. These cysts appear to be formed from excessive apocrine cystic secretions. This fluid is composed of several glycoproteins including a unique 15 kD monomer protein, GCDFP15. It has been reported that cytosolic analysis of normal tissue from all major organs has demonstrated GCDFP15 in apocrine epithelia, lacrimal, ceruminous and Moll's glands and in numerous serous cells of the submandibular, tracheal, bronchial, sublingual and minor salivary glands. Specificity Human gross cystic disease fluid protein (15 kD)
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
23A3
Concentration:
Greater than or equal to 55 mg/L
Storage buffer:
Tissue culture supernatant with Sodium azide
Storage:
2-8°C
References 1:
Sapino A et al. J. of Biol.Regulators & Homeostatic Agents. 2000; 14(4):259262
References 2:
Haagensen DE Jr et al. Annals of the New York Academy of Sciences.1990;586:161173
Melan A, a product of the MART-1 gene, is a melanocyte differentiation marker recognized by autologous cytotoxic T lymphocytes. Other melanoma-associated markers recognized by autologous cytotoxic T cells are reported to include MAGE-1, MAGE-3, tyrosinase, gp100, gp75, BAGE-1 and GAGE-1. The analysis of these different molecules and their expression in individual melanomas may be of help in the study of their particular molecular roles in melanocyte differentiation and tumorigenesis.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
A103
Concentration:
Greater than or equal to 22 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Shidham VB et al. BioMed Central cancer. 2003; 3(1):15
References 2:
Clarkson KS et al. Journal of Clinical Pathology. 2001; 54:196200
References 3:
De Vries TJ et al. Journal of Pathology. 2001; 193:1320
References 4:
Fang D et al. American Journal of Pathology. 2001; 158(6):21072115
References 5:
Chen YT et al. Proceedings of the National Academy of Sciences USA. 1996; 93:59155919
Recombinant prokaryotic fusion protein corresponding to approximately 100 amino acids which are present in the membrane-bound form of the mesothelin molecule.
Mesothelin is a glycosyl-phosphatidylinositol-linked (GPI) glycoprotein of 40kD present on the surface of mesothelial cells, mesotheliomas, epithelial ovarian cancers and some squamous cell carcinomas. It is synthesized as a 69 kD precursor which is enzymatically processed into an N-terminal secreted form of 30 kD and the GPI-linked membrane-bound form of 40 kD. The secreted form is identical to the megakaryocyte potentiating factor, but it is the GPI-linked membrane-bound form which has generated interest. Mesothelin is abundantly expressed in the kidney and in occasional epithelial cells of the trachea, tonsil and fallopian tube. The function of mesothelin is unclear but it may have a role in cellular adhesion. Mesothelin is reported to be abundant in the normal mesothelial cells from which malignant mesotheliomas and ovarian cystadenocarcinomas are derived.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
5B2
Concentration:
Greater than or equal to 40 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Ordonez NG. American Journal of Surgical Pathology. 2003; 27(11):14181428
References 2:
Ordonez NG. Modern Pathology. 2003; 16(3):192197
References 3:
Argani P et al. Clinical Cancer Research. 2001; 7(12):38623868
Microphthalmia transcription factor (MITF) gene product, a nuclear transcription factor of the basic-helix-loop-helix type, is thought to play a role in the regulation of genes encoding the enzymes necessary for melanogenesis. These include tyrosinase, TRP-1 and TRP-2. MITF is critical for the embryonic development and postnatal viability of melanocytes. The melanocyte-specific isoform of microphthalmia transcription factor MITF-M, is reported to be expressed in normal and malignant melanocytes. The other isoforms, MITF-A, MITF-C and MITF-H, differ structurally at the N-terminus from MITF-M.
Antibody Isotype:
IgG1, kappa
Monosan Range:
MONXtra
Clone:
34CA5
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with 15mM Sodium azide
Storage:
2-8°C
References 1:
Fang D and Setaluri V. Biochem. and Biophys. Research Comm. 256 (3): 657663 (1999)
References 2:
King R et al. American Journal of Pathology. 155 (3): 731738 (1999)
References 3:
Amae S et al. Biochem.and Biophys.Research Comm. 247: 710715 (1998)
References 4:
Watanabe A et al. Nature Genetics. 18: 283286 (1998)
Rhabdomyosarcomas are a class of myoblast-derived soft tissue sarcomas that usually express a number of muscle-specific genes and primarily affect children and young adults. Differentiation of myogenic cells is controlled by a set of regulatory genes including MyoD1, myogenin, Myf-5 and Myf-6. Myf-4 is the human homolog of myogenin. Its gene product, together with that of Myf-3, accumulates in the nucleus of differentiated cells.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
LO26
Concentration:
Greater than or equal to 13 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Den Bakker MA et al. Histopathology. 2003; 43(3):297299
References 2:
Ingeholm P et al. APMIS. 2002; 110(9):639645
References 3:
Kumar S et al. Modern Pathology. 2000; 13(9):988993
References 4:
Gilpin BJ et al. Journal of Biological Chemistry. 1998; 273(1):157166
Placental alkaline phosphatase (PLAP) is a membrane-associated sialoglycoprotein enzyme normally present at high concentration in syncytiotrophoblasts within the placenta during the third trimester of gestation. The expression of PLAP was originally thought to be restricted to term placenta but a human PLAP-like variant has been described which shares more than 85% homology with PLAP itself. This high degree of homology between PLAP and PLAP-like enzyme together with cross-reacting antibodies has led to some confusion of the distribution of PLAP and PLAP-like enzyme in various tissues. PLAP is reported to be expressed only in normal term placenta, endocervix and fallopian tube and also in ovarian and proximal gastrointestinal tumors. PLAP expression is rare in malignant germ cell tumors. PLAP-like enzyme is reported to be predominantly found in normal fetal and neonatal testis, and in thymus. It is also commonly expressed in germ cell tumors and more recently described in seminomas.
Antibody Isotype:
IgG1, kappa
Monosan Range:
MONXtra
Clone:
8A9
Concentration:
Greater than or equal to 26 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Bartkova J et al. Oncogene. 2000; 19: 4146-4150
References 2:
Franke FE et al. Human Pathology 2000; 31(12), 14661476
References 3:
Hoei-Hansen CE et al. Molecular Cancer. 2007; 6:12
References 4:
McCann-Crosby B et al. International Journal of Pediatric Endocrinology 2015; 1:14
Prostate specific antigen (PSA) is a 34 kD protein belonging to the kallikrein family of serine proteases and was originally isolated and purified from human seminal plasma. It was found to be immunologically identical and biologically similar to a protein isolated from the prostate gland. PSA is distinct from prostatic acid phosphatase. Low levels of expression of PSA have been reported in non-prostatic tissues and tumors such as breast carcinomas.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
35H9
Concentration:
Greater than or equal to 43 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Watt KWK et al. Proceedings of the National Academy of Sciences USA. 1986; 83:3166-3170
Prostatic acid phosphatase (PAP) is an isoenzyme of acid phosphatase found in large amounts in the prostate and seminal fluid. The precise function of PAP is unknown, but it may act as a hydrolase to split phosphoryl choline in semen and also function as a transferase. Elevated serum levels of the enzyme are reported in metastatic prostatic carcinoma.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
PASE/4LJ
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with 15mM sodium azide
Storage:
2-8°C
References 1:
Haines AMR et al. British Journal of Cancer. 60: 887892 (1989)
References 2:
Haines AMR et al. Biochemical Society Transactions. 15: 11791180 (1987)
Thyroid Transcription Factor-1 (TTF-1) is a member of the homeodomain transcription factor family and plays a role in regulating genes expressed within the thyroid, lung and brain. These include thyroglobulin, thyroid peroxidase, Clara cell secretory protein and surfactant proteins. Human TTF-1 (38 kD) is a single polypeptide of 371 amino acids sharing 98% homology with the equivalent rat and mouse proteins. TTF-1 functions by binding to specific recognition sites in a manner that may be regulated by both the redox and phosphorylation status of the protein. In addition to its role as a tissue-specific transcriptional activator in adult organs, TTF-1 may also function in organogenesis. Gene targeting studies have shown TTF-1 to be essential for the proper development of the thyroid and lungs and abnormal expression may underline a number of congenital abnormalities.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
SPT24
Concentration:
Greater than or equal to 108 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Unal B et al. Turkish Journal of Pathology. 2014; 30(3): 201-205
References 2:
Klingen TA et al. Diagnostic Pathology. 2013; 8: 80-86
References 3:
Berghmans T et al. Lung Cancer. 2006; 52(2): 219-224
References 4:
Penman D et al. Journal of Clinical Pathology. 2006; 59:663-664.
References 5:
Comperat E et al. Modern Pathology. 2005; 18(10):1371-1376
The biosynthesis of melanin in melanocytes involves a family of enzymes, a key member of which is tyrosinase. Tyrosinase deficiency is associated with various forms of albinism and in particular oculocutaneous albinism. L-tyrosinase is the initial substrate for melanin biosynthesis and its conversion to dopaquinone is catalyzed by tyrosinase, whose expression is reported in melanocytes and melanomas.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
T311
Concentration:
Greater than or equal to 89 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Shidham VB et al. BMC Cancer. 2003; 3(1):15
References 2:
Lohmann CM et al. American Journal of Surgical Pathology. 2002; 26(10):13511357
References 3:
Clarkson KS et al. Journal of Clinical Pathology. 2001; 54(3):196200
References 4:
de Vries TJ et al. Journal of Pathology. 2001; 193(1):1320
References 5:
Jungbluth AA et al. Pathol Res Pract. 2000; 196(4):235242
Human von Willebrand factor (or factor VIII-related antigen) is a 270 kD multimeric plasma glycoprotein. It mediates platelet adhesion to injured vessel walls and serves as a carrier and stabilizer for coagulation factor VIII. The von Willebrand factor has functional binding domains to platelet glycoprotein Ib, glycoprotein Ib/IIIa, collagen and heparin. Von Willebrand factor is synthesized by endothelial cells and is reported to be expressed in a number of tumors of vascular origin.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
36B11
Concentration:
Greater than or equal to 21 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Zhang Y et al. Human Pathology. 2005; 36:797-805
References 2:
Su H et al. Proceedings of the National Academy of Sciences, USA. 2000; 97(25):13801-13806
Granzymes are neutral serine proteases which are stored in specialized lytic granules of cytotoxic T lymphocytes (CTL) and in natural killer (NK) cells. These CTL and NK cells are heavily involved in the elimination of neoplastic and virally infected cells. Secretory granules containing perforin and granzymes are instrumental in undertaking cytolytic activity. Granzyme B is understood to enter a target cell through a perforin pore-formed channel to induce DNA fragmentation and apoptosis. Granzyme B has also been described in neoplastic CTL and NK cells.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
11F1
Concentration:
Greater than or equal to 47 mg/L
Storage buffer:
Tissue culture supernatant with Sodium azide
Storage:
2-8°C
References 1:
Lee HK et al. J Korean Med Sci. 2003; 18:272276
References 2:
Theate I et al.European Journal of Haematology. 2002; 69(4):248253
Prokaryotic recombinant protein corresponding to a region which spans the tyrosine kinase catalytic domain and part of the C-terminus of the NPM-ALK transcript (419-520??).
Anaplastic large cell lymphoma (ALCL) is usually composed of large pleomorphic cells which are reported to express CD30 antigen and epithelial membrane antigen (EMA). These tumor cells tend to occur in younger individuals and may be associated with cutaneous and extranodal involvement. A proportion of these cases contain a chromosomal translocation t(2;5) (p23;q35). This results in a hybrid gene encoding part of the nucleophosmin (NPM) gene joined to the cytoplasmic domain of the anaplastic lymphoma kinase (ALK) gene, giving rise to the protein, p80. Large cell lymphomas account for approximately 25% of all non-Hodgkin's lymphomas in children and young adults, of which one third carry the NPM-ALK gene translocation.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
5A4
Concentration:
Greater than or equal to 32 mg/L
Storage buffer:
Tissue culture supernatant with 15mM sodium azide
Storage:
2-8°C
References 1:
Liu A et al. Acta Histochemica et Cytochemica. 2004; 37(1):21-30
Terminal deoxynucleotidyl transferase (TdT) is a DNA polymerase of 58 kD located in the cell nucleus which catalyzes the polymerization of deoxynucleotides at the 3' hydroxyl ends of oligo or polydeoxynucleotide initiators and functions without a template. TdT is reported to be expressed in primitive T and B lymphocytes of the normal thymus and bone marrow. The identification of TdT-positive cell populations in primary and secondary lymphoid organs during maturation of the immune system is one area of interest but it is the reported occurrence of high levels of enzyme activity in white blood cells and bone marrow in certain leukemias which is of particular interest.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
SEN28
Concentration:
Greater than or equal to 30 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Tai YC and Peh SC. FSingapore Medical Journal. 2003; 44(5):250-255
Cytoplasmic actins are part of the microfilament system of cytoskeletal proteins. Smooth muscle actin is found in vascular walls, intestinal muscularis mucosae and muscularis propria and in the stroma of various tissues. Enzyme pretreatment may enhance staining in some cases. Human alpha smooth muscle actin. Reactive with smooth muscle cells in blood vessel walls, gut wall, myometrium and arrectores pili of skin. Myoepithelial cells such as those in breast and salivary gland also contain actin.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
alpha sm-1
Concentration:
Greater than or equal to 4,5 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Skalli O et al. The Journal of Cell Biology. 1986; 103:2787-2796
References 2:
Ramos JG et al. Endocrinology. 2003; 144(7):3206-3215
References 3:
Suárez-Vilela D and Izquierdo-Garcia FM. Histopathology. 2003; 43(4):398-400
References 4:
Vicario JH et al. Rev Fed Arg Cardiol. 2002; 31:441-449
References 5:
Barry-Lane PA et al. Journal of Clinical Investigation. 2001; 108(10):1513-1522
DES-DERII reacts with an 18 kD rod piece of the intermediate filament protein desmin (53 kD) in muscle cells. The antibody does not appear to recognize other intermediate filament proteins. In normal tissues, Clone DE-R-11 reacts with both striated (skeletal and cardiac) and smooth muscle cells. The labeling is confined to the Z bands in skeletal and cardiac muscle giving a characteristic striated appearance.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
DE-R-11
Concentration:
Greater than or equal to 27 mg/L
Storage buffer:
Tissue culture supernatant with Sodium azide
Storage:
2-8°C
References 1:
Beaton LJ et al. Journal of Physiology. 2002; 544(Pt3):849-859
References 2:
Barber A et al.The FASEB Journal. 2001; 15:1158-1168
References 3:
Debus E et al.The EMBO Journal. 1983; 2(12):2305-2312
References 4:
Baghdiguian S et al. Nature Medicine. 1999; 5(5):503-511
References 5:
Lyall F et al. American Journal of Pathology. 2001; 159(5):1827-1838
Cytokeratins are a large family of cytoskeletal proteins found in epithelial cells. They are co-ordinately synthesized in pairs so that at least one member of each family is expressed in each epithelial cell. Cytokeratins assemble into obligatory heteropolymers composed of type I (acidic) and type II (basic) polypeptides to form higher order tetramers and protofilaments. Basal cells of human epidermis express acidic keratin 14 and basic cytokeratin 5. Cytokeratin 5 is a 58 kD protein that is closely related to cytokeratin 6. Point mutations in the cytokeratin 5 gene at locus 12q11-q13 can cause various types of epidermolysis bullosa simplex. Cytokeratin 5 is also reported to be expressed in most epithelial and biphasic mesotheliomas. Clone XM26 is specific for the 58 kD intermediate filament protein known as cytokeratin 5. It is not cross-reactive with cytokeratin 6.
Antibody Isotype:
IgG1, kappa
Monosan Range:
MONXtra
Clone:
XM26
Concentration:
Greater than or equal to 21 mg/L
Storage buffer:
Tissue culture supernatant with Sodium azide
Storage:
2-8°C
References 1:
Bhargava R et al. The American Journal of Clinical Pathology . 2008; 130:724-730
References 2:
Laakso M e al. Clinical Cancer Research. 2006; 12(14):4185-4191
References 3:
Miettinen M et al. American Journal of Surgical Pathology. 2003; 27(2):150158
References 4:
Zhang RR et al. Breast Cancer Research. 2003; 5:R151R156
Cytokeratins are intermediate filament proteins present in epithelial cells. They are expressed in a tissue-specific manner in normal organs and the tumors that arise from them. Cytokeratin 7 belongs to the neutral basic type B subfamily of cytokeratins. Its distribution is confined to glandular and transitional epithelia. Cytokeratin 7 is reported to be expressed in abundance in cultured bronchial and mesothelial cells but only at lower levels in cultured epidermal cells. The predicted amino acid sequence of this keratin has revealed a striking difference between this keratin and the type II keratins expressed in epidermal cells. Cytokeratin 7 has been reported in adenocarcinomas of the lung, breast, endometrium, ovary, thyroid as well as in carcinomas of the bladder and chromophobe renal cell carcinoma. Cytokeratin 7 and Cytokeratin 20 expression have been reported to show characteristic patterns on primary and metastatic lung and colorectal adenocarcinomas.
Antibody Isotype:
IgG1, kappa
Monosan Range:
MONXtra
Clone:
OV-TL 12/30
Concentration:
Greater than or equal to 67 mg/L
Storage buffer:
Tissue culture supernatant with Sodium azide
Storage:
2-8°C
References 1:
van de Molengraft FJJM et al.Histopathology. 1993; 22:35-38
References 2:
van Niekerk CC et al. Journal of Pathology. 1991; 165(2):145-15
Cytokeratins 14 and 5 are useful to distinguish stratified epithelial cell types from simple epithelial cell types. Cytokeratin 14 has been reported to be expressed in neoplasms of squamous cell origin.Clone LL002 reacts with the human cytokeratin intermediate filament protein (50 kD) identified as cytokeratin 14.
Antibody Isotype:
IgG3
Monosan Range:
MONXtra
Clone:
LL002
Concentration:
Greater than or equal to 24 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Reis-Filho JS et al. Journal of Clinical Pathology. 2004; 57:83-86
References 2:
Sivard P et al. Experimental Dermatology. 2003; 12(4):346355
References 3:
Fong LYY et al. Cancer Research. 2003; 63:186195
References 4:
Nagao T et al. Histopathology. 2001; 38(1):3036
References 5:
Nakayama H et al. Japanese Journal of Clinical Oncology. 1997; 27(6):427432
Cytokeratin 20 has been demonstrated to be almost entirely confined to the gastric and intestinal epithelium, urothelium and Merkel cells of the skin. Cytokeratin 20 is less acidic than other type I cytokeratins and is of interest due to its restricted tissue expression. In normal tissue, cytokeratin 20 is expressed in intestinal epithelium, gastric foveolar epithelium, a number of endocrine cells in the upper portions of the pyloric glands, urothelium and Merkel cells in epidermis. In tumors it is reported, there is a marked difference in the expression of cytokeratin 20 within different carcinomas. Neoplasms expressing cytokeratin 20 are derived from normal epithelia which themselves expressed cytokeratin 20. Colorectal carcinomas consistently express cytokeratin 20, while gastric adenocarcinomas express cytokeratin 20 to a lesser degree. Adenocarcinomas of the gall bladder and bile duct, ductal cell adenocarcinomas of the pancreas, mucinous ovarian tumors, Merkel cell tumors and transitional cell carcinomas have also been reported to express cytokeratin 20.
Antibody Isotype:
IgG2a, kappa
Monosan Range:
MONXtra
Clone:
Ks20.8
Concentration:
Greater than or equal to 9,26 mg/L
Storage buffer:
PBS (pH 7.6) with 1% BSA and sodium azide
Storage:
2-8°C
References 1:
Botta MC et al. Pathologica. 2001; 93(6):640-644
References 2:
Leech SN et al. Journal of Clinical Pathology. 2001; 54:727-729
References 3:
Tan J et al. Human Pathology. 1998; 29(4):390-396
References 4:
Longatto Filho A et al. Acta Cytol. 1997; 41(4):961-971
References 5:
Moll R et al. American Journal of Pathology. 1992; 140(2):427-447
Clone 5D3 reacts with human cytokeratin intermediate filament proteins of 52.5 kD and 45 kD, identified as cytokeratins 8 and 18, respectively. Clone 5D3 shares similar specificities to clone CAM5.2 (Angus B et al. Journal of Pathology. 153: 377-384 (1987)).
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
5D3
Concentration:
Greater than or equal to 420 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Nadji M, Morales AR. Laboratory Medicine. 1983; 14:767
References 2:
Omata M et al. Am.J.of Clin. Pathol. 1980; 73:626
References 3:
Angus B et al. J.of Pathology. 1988; 155(1):7175
References 4:
Martin CA et al. Appl Immunohistochem Mol Morphol. 2001; 9(1):7073
References 5:
Mehes G et al. Am. J.of Pathol. 2001; 159(1):1720
Cytokeratins 5, 6 and 18 are reported to be expressed in a broad range of human epithelial tissues, from simple glandular epithelia to stratified squamous epithelia. These include epithelial cells that are ectodermal, mesodermal, or endodermal in origin. These cytokeratins have been reported to be expressed in tumor cells of epithelial origin and less commonly of mesothelial origin. Non-epithelial tumors such as lymphomas do not express these cytokeratins. The recognition of cytokeratin 18 on formalin fixed paraffin embedded sections using clone LP34 may be variable.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
LP34
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Lyall F et al. The American Journal of Pathology. 2001;159(5):1827-1838
References 2:
Yokozaki H et al. Japanese Journal of Clinical Oncology. 2000;30(2):101-104
References 3:
Lyall F et al. The American Journal of Pathology. 1999;154(4):1105-1114
Clones AE1 and AE3 are specific for the 56.5, 50, 50', 48 and 40 kD acidic cytokeratins as well as the 65 to 67, 64, 59, 58, 56 and 52 kD basic cytokeratins. The cocktail of clones AE1 and AE3 exhibit broad reactivity with two families of cytokeratin, acidic and basic.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
AE1/AE3
Concentration:
Greater than or equal to 225 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Nadji M, Morales AR. Laboratory Medicine. 1983; 14:767
References 2:
Omata M et al. Am.J.of Clin. Pathol. 1980; 73:626
References 3:
Su T et al. Diagnostic Pathology. 2014; 9: 179
References 4:
Zhao W et al. Int.J. of Clin. and Exp.Pathol. 2014; 7(11): 7951-7956
References 5:
Hammers HJ et al. Molecular Cancer Therapeutics. 2010; 9(6): 1525-1535
NCL-CK5/6/8/18, NCL-L-CK5/6/8/18 and RTU-CK5/6/8/18 react with human cytokeratins 5, 6, 8 and 18. These products are cocktails of monoclonal antibodies designed to recognize cytokeratins reported to be expressed in almost all epithelial tissues.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
5D3/LP34
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with 15 mMsodium azide
Storage:
2-8°C
References 1:
Hatzfeld M and Weber K. Journal of Cell Biology. 116: 157166 (1992)
References 2:
Angus B et al. Journal of Pathology. 155: 7175 (1988)
References 3:
Ghosh A K et al. British Journal of Haematology. 61: 2130 (1985)
References 4:
Gatter KC et al. Journal of Clinical Pathology. 35: 12531267 (1982)
Alpha-synuclein is a protein of 140 amino acids and a member of the synuclein family. It shares 61% sequence homology with beta-synuclein and is highly conserved between vertebrate species. It does not possess a signal sequence suggesting that it is an intracellular protein. All synucleins have an unusual organization based around the eleven residue repeating motif and an alpha-helical secondary structure resembling those found in the lipid-binding domain of exchangeable apolipoproteins, including Apo E. This homology suggests a direct interaction of alpha-synuclein with membranes consistent with its affinity for synaptosomes.Clone KM51 is specific for alpha-synuclein and is unreactive with beta-synuclein. Pretreatment of tissue sections with 98-100% formic acid is also recommended.
Antibody Isotype:
IgG1, kappa
Monosan Range:
MONXtra
Clone:
KM51
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with 15mM sodium azide
Storage:
2-8°C
References 1:
Baba M et al. American Journal of Pathology. 152 (4): 879884 (1998)
References 2:
Polymeropoulos MH et al. Science. 276: 20452047 (1997)
References 3:
Spillantini MG et al. Nature. 388: 839840 (1997)
References 4:
Weinreb PH et al. Biochemistry. 35 (43): 1370913715 (1996)
Neurofilaments constitute the main structural elements of neuronal axons and dendrites. Neurofilaments are composed of three major subunits referred to as the neurofilament triplet, with molecular weights of 68 kD, 160kD and 200 kD. Within tumors, only neoplastic cells of neural origin or those exhibiting neuronal differentiation, have been reported to express neurofilaments. NF-H (200 kD) polypeptide of human neurofilament. This antibody reacts with both phosphorylated and unphosphorylated forms of NF-H.
Protein gene product (PGP) 9.5 is a neuron-specific protein, structurally and immunologically distinct from neuron specific enolase. The protein which has a molecular weight of 27 kD was first identified by high resolution two dimensional PAGE. PGP9.5 expression has been reported in neurons and nerve fibers at all levels of the central and peripheral nervous system, in many neuroendocrine cells, in segments of the renal tubules, in spermatogonia and Leydig cells of the testis, in ova and in some cells of both the pregnant and non-pregnant corpus luteum. PGP9.5 is a member of the ubiquitin C-terminal hydroxylase family and is also concentrated within inclusion bodies suggesting that such structures may be metabolically active regions of the cells.
Antibody Isotype:
IgG2b
Monosan Range:
MONXtra
Clone:
10A1
Concentration:
Greater than or equal to 35 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Beresford L et al. Immunology. 2004; 111(1):118125
Synaptophysin is an integral membrane glycoprotein with a molecular weight of 38 kD. It is reported to occur in presynaptic vesicles of neurons in brain, spinal cord, retina, in similar vesicles of the adrenal medulla as well as in neuromuscular junctions. Synaptophysin may be involved in synaptic vesicle formation and exocytosis. Synaptophysin is reported to be expressed in a wide spectrum of neuroendocrine tumors including neuroblastomas, ganglioneuroblastomas, phaeochromocytomas, chromaffin and non-chromaffin paragangliomas. Synaptophysin is also reported to be expressed in neuroendocrine tumors of epithelial type including pituitary adenomas, islet cell tumors, medullary carcinomas of thyroid, parathyroid adenomas, carcinoids of the bronchopulmonary and gastrointestinal tracts, neuroendocrine carcinomas of the bronchopulmonary and gastrointestinal tract and neuronendocrine carcinomas of the skin.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
27G12
Concentration:
Greater than or equal to 42 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Takeda S et al. Neuropathology. 2003; 23(4):254261
NCL-b-DG is a lyophilized tissue culture supernatant containing sodium azide as a preservative. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
43DAG1/8D5
Concentration:
n/a
Storage buffer:
Lyophilized
Storage:
2-8°C
References 1:
Hess J et al. Molecular and Cellular Biology. 21 (5): 15311539 (2001)
References 2:
Muschen M et al. Cancer Research. 61 (5): 20802084 (2001)
References 3:
Luo Y and Roeder R G. Molecular and Cellular Biology. 15 (8): 41154124 (1995)
This antibody reacts with full-size calpain 3 (94 kD) plus an additional fragment at 30 kD in human skeletal muscle. A band of 94 kD is seen with rabbit and dog muscle while extracts of hamster muscle show reactivity with the 94 kD band and a larger species of approximately 110 kD. This 110 kD band is the principal immunoreactive species seen in rat muscle extracts. This antibody produces no bands with mouse, pig or chicken muscle. Reconstitute with the volume of sterile distilled water indicated on the vial label.
Antibody Isotype:
IgG2b
Monosan Range:
MONXtra
Clone:
Calp3d/2C4
Concentration:
n/a
Storage buffer:
Lyophilized
Storage:
2-8°C
References 1:
Anderson LVB et al. American Journal of Pathology. 153 (4): 11691179 (1998)
References 2:
Topaloglu H et al. Neuropediatrics. 28: 212216 (1997)
This antibody reacts with full-size calpain 3 (94 kD) plus an additional breakdown product at 60 kD in human skeletal muscle. The 94 kD band can be seen in muscle extracts from rabbit, mouse, dog, chicken, hamster, pig and rat. Degraded calpain 3 bands starting at approximately 60 kD are also usually present. Additional bands corresponding in size to calpains 1 and/or 2 can be detected in skeletal muscle from mouse, rat, chicken and hamster. Reconstitute with the volume of sterile distilled water indicated on the vial label.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
Calp3c/12A2
Concentration:
n/a
Storage buffer:
Lyophilized
Storage:
2-8°C
References 1:
Anderson LVB et al. American Journal of Pathology. 153 (4): 11691179 (1998)
References 2:
Topaloglu H et al. Neuropediatrics. 28: 212216 (1997)
Analyte Specific Reagent. Analytical and performance characteristics are not established. The product is a lyophilized tissue culture supernatant containing sodium azide as a preservative. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
Ham1/7B6
Concentration:
n/a
Storage buffer:
Lyophilized
Storage:
2-8°C
References 1:
Marafioti T et al. American Journal of Pathology. 162 (3): 861871 (2003
References 2:
Hess J et al. Molecular and Cellular Biology. 21 (5): 15311539 (2001)
References 3:
Re D et al. Cancer Research. 61 (5): 20802084 (2001)
References 4:
Luo Y and Roeder R G. Molecular and Cellular Biology. 15 (8): 41154124 (1995)
Analyte Specific Reagent. Analytical and performance characteristics are not established. The product is a lyophilized tissue culture supernatant containing sodium azide as a preservative. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label.
Antibody Isotype:
IgG2b
Monosan Range:
MONXtra
Clone:
Ham3/17B2
Concentration:
n/a
Storage buffer:
Lyophilized
Storage:
2-8°C
References 1:
Marafioti T et al. American Journal of Pathology. 162 (3): 861871 (2003
References 2:
Hess J et al. Molecular and Cellular Biology. 21 (5): 15311539 (2001)
References 3:
Re D et al. Cancer Research. 61 (5): 20802084 (2001)
References 4:
Luo Y and Roeder R G. Molecular and Cellular Biology. 15 (8): 41154124 (1995)
Dystrophin is the 427kD protein product of the DMD gene located on the X chromosome at position Xp21. Analyte Specific Reagent. Analytical and performance characteristics are not established. Product is a lyophilized tissue culture supernatant containing sodium azide as a preservative. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label. Reacts strongly with the rod domain (between amino acids 1181 and 1388) of human dystrophin. Also reacts with skeletal, cardiac and smooth muscle dystrophin from normal mouse, rat, rabbit, dog, hamster and pig. No reactivity with mdx mouse tissue of DMD/BMD patients who have a gene deletion which removes the antibody binding site. No reaction is seen with chicken dystrophin.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
Dy4/6D3
Concentration:
n/a
Storage buffer:
Lyophilized
Storage:
2-8°C
References 1:
Marafioti T et al. American Journal of Pathology. 162 (3): 861871 (2003
References 2:
Hess J et al. Molecular and Cellular Biology. 21 (5): 15311539 (2001)
References 3:
Re D et al. Cancer Research. 61 (5): 20802084 (2001)
References 4:
Luo Y and Roeder R G. Molecular and Cellular Biology. 15 (8): 41154124 (1995)
Dystrophin is the 427kD protein product of the DMD gene located on the X chromosome at position Xp21. Analyte Specific Reagent. Analytical and performance characteristics are not established. Product is a lyophilized tissue culture supernatant containing sodium azide as a preservative. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label. Reacts strongly with the carboxy terminus (between amino acids 3669 and 3685) of human dystrophin. Also crosssreacts strongly with skeletal, cardiac and smooth muscle dystrophin from normal mouse, rat, rabbit, dog, chicken and hamster. No crossreactivity with mdx mouse tissue. Crossreacts very weakly with pig dystrophin.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
DY8/6C5
Concentration:
n/a
Storage buffer:
Lyophilized
Storage:
2-8°C
References 1:
Marafioti T et al. American Journal of Pathology. 162 (3): 861871 (2003
References 2:
Hess J et al. Molecular and Cellular Biology. 21 (5): 15311539 (2001)
References 3:
Re D et al. Cancer Research. 61 (5): 20802084 (2001)
References 4:
Luo Y and Roeder R G. Molecular and Cellular Biology. 15 (8): 41154124 (1995)
Dystrophin is the 427kD protein product of the DMD gene located on the X chromosome at position Xp21. Analyte Specific Reagent. Analytical and performance characteristics are not established. Product is a lyophilized tissue culture supernatant containing sodium azide as a preservative. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label. Reacts strongly with the amino terminal domain (between amino acids 321 and 494) of human dystrophin. Patient immunoreactivity indicates epitope is near exons 10 to 12. Epitope mapping suggests that sequences from amino acids 308 to 351 are involved in antibody binding. This region spans the junction of exons 9 and 10 and the epitope recognised may be part of a hinge region joining the amino domain to the central rod domain. No reactivity with DMD/BMD patients deleted for exons 10 to 12. No crossreaction is observed with mouse (high background only), rat, rabbit, dog, chicken, hamster and pig dystrophin.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
DY10/12B2
Concentration:
n/a
Storage buffer:
Lyophilized
Storage:
2-8°C
References 1:
Marafioti T et al. American Journal of Pathology. 162 (3): 861871 (2003
References 2:
Hess J et al. Molecular and Cellular Biology. 21 (5): 15311539 (2001)
References 3:
Re D et al. Cancer Research. 61 (5): 20802084 (2001)
References 4:
Luo Y and Roeder R G. Molecular and Cellular Biology. 15 (8): 41154124 (1995)
Dystrophin is the 427kD protein product of the DMD gene located on the X chromosome at position Xp21. Analyte Specific Reagent. Analytical and performance characteristics are not established. Product is a lyophilized tissue culture supernatant containing sodium azide as a preservative. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label.
Antibody Isotype:
IgG1, kappa
Monosan Range:
MONXtra
Clone:
34C5
Concentration:
n/a
Storage buffer:
Lyophilized
Storage:
2-8°C
References 1:
Blake DJ et al. Physiological Reviews. 82 (2): 291329 (2002)
References 2:
Oliveira AS et al. Arq Neuropsiquiatr. 50 (4): 478485 (1992
References 3:
Haginoya K et al. Journal of Neurology. 238 (7): 375378 (1991)
Analyte Specific Reagent. Analytical and performance characteristics are not established. NCL-EMERIN is a lyophilized tissue culture supernatant containing sodium azide as a preservative. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
4G5
Concentration:
n/a
Storage buffer:
Lyophilized
Storage:
2-8°C
References 1:
Muschen M et al. Cancer Research. 61 (5): 20802084 (2001)
References 2:
Luo Y and Roeder R G. Molecular and Cellular Biology. 15 (8): 41154124 (1995)
The muscle-specific form of laminin, merosin, is composed of three chains: alpha 2, beta 1 and gamma 1.Analyte Specific Reagent. Analytical and performance characteristics are not established. Reacts strongly with laminin alpha 2 chain of merosin in human and rabbit skeletal muscle. No reaction is observed in muscle sections from mouse, rat, dog, chicken, hamster or pig. The product is a lyophilized tissue culture supernatant containing sodium azide as a preservative. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
Mer3/22B2
Concentration:
n/a
Storage buffer:
Lyophilized
Storage:
2-8°C
References 1:
Marafioti T et al. American Journal of Pathology. 162 (3): 861871 (2003
References 2:
Hess J et al. Molecular and Cellular Biology. 21 (5): 15311539 (2001)
References 3:
Re D et al. Cancer Research. 61 (5): 20802084 (2001)
References 4:
Luo Y and Roeder R G. Molecular and Cellular Biology. 15 (8): 41154124 (1995)
Myosin is a contractile muscle specific protein composed of two heavy and four light chains. The myosin heavy chain has many isoforms which are specific for different muscles or fiber types, some of which are developmentally regulated. The range of myosin heavy chain antibodies may prove useful for investigating development of intrafusal and extrafusal muscle fibers and the course of muscle fiber regeneration. At the ultrastructural level, antibodies can reveal architectural details of the myofilament as well as the cytoplasmic and membrane sites of new myosin integration. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
RNMy2/9D2
Concentration:
n/a
Storage buffer:
Lyophilized tissue culture supernatant containing 15 mM sodium azide.
Storage:
2-8°C
References 1:
Davis CE et al. Neuromuscular Disorders. 1 (6): 411421 (1991)
References 2:
Ecob-Prince M et al. Journal of Neurological Sciences. 91: 7178 (1989)
Myosin is a contractile muscle specific protein composed of two heavy and four light chains. The myosin heavy chain has many isoforms which are specific for different muscles or fiber types, some of which are developmentally regulated. The range of myosin heavy chain antibodies may prove useful for investigating development of intrafusal and extrafusal muscle fibers and the course of muscle fiber regeneration. At the ultrastructural level, antibodies can reveal architectural details of the myofilament as well as the cytoplasmic and membrane sites of new myosin integration. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label. Rabbit myosin fast type heavy chain. Crossreacts with human myosin fast type heavy chain. The antibody also reacts with type II myosin heavy chain (both IIa and IIb) in rat, mouse, dog, sheep, pig and goat muscle.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
WB-MHCf
Concentration:
n/a
Storage buffer:
Lyophilized tissue culture supernatant containing 15 mM sodium azide.
Storage:
2-8°C
References 1:
Sheriffs IN et al. Journal of Clinical Pathology. 54: 517520 (2001)
References 2:
Ecob-Prince M et al. Journal of Neurological Sciences. 91: 7178 (1989)
References 3:
Carson NE et al. The Journal of Histotechnology. 21 (1): 1924 (1998)
References 4:
Hoh JFY and Hughes A. Journal of Muscle Research and Cellular Motility. 10: 312325 (1989)
Myosin is a contractile muscle specific protein composed of two heavy and four light chains. The myosin heavy chain has many isoforms which are specific for different muscles or fiber types, some of which are developmentally regulated. The range of myosin heavy chain antibodies may prove useful for investigating development of intrafusal and extrafusal muscle fibers and the course of muscle fiber regeneration. At the ultrastructural level, antibodies can reveal architectural details of the myofilament as well as the cytoplasmic and membrane sites of new myosin integration. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label. Rabbit myosin fast type heavy chain. Crossreacts with human myosin fast type heavy chain. Rabbit myosin neonatal type heavy chain. Crossreacts with human myosin neonatal type heavy chain. Note that this antibody recognises a myosin heavy chain present during the neonatal period in rabbit limb muscle. The temporal appearance of an equivalent epitope may differ in different species and consequently it may not be correct to label the epitope as neonatal in some circumstances.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
WB-MHCN
Concentration:
n/a
Storage buffer:
Lyophilized tissue culture supernatant containing 15 mM sodium azide.
Storage:
2-8°C
References 1:
Ecob-Prince M et al. Journal of Neurological Sciences. 90: 167177 (1989)
References 2:
Ecob-Prince M et al. Journal of Neurological Sciences. 91: 7178 (1989)
Myosin is a contractile muscle specific protein composed of two heavy and four light chains. The myosin heavy chain has many isoforms which are specific for different muscles or fiber types, some of which are developmentally regulated. The range of myosin heavy chain antibodies may prove useful for investigating development of intrafusal and extrafusal muscle fibers and the course of muscle fiber regeneration. At the ultrastructural level, antibodies can reveal architectural details of the myofilament as well as the cytoplasmic and membrane sites of new myosin integration. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label. Rabbit myosin slow type heavy chain. Crossreacts with human myosin slow type heavy chain.The antibody also reacts with type I myosin heavy chain in rat, mouse, dog, sheep, pig and goat muscle.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
WB-MHCS
Concentration:
n/a
Storage buffer:
Lyophilized tissue culture supernatant containing 15 mM sodium azide.
Storage:
2-8°C
References 1:
Sheriffs IN et al. Journal of Clinical Pathology. 54: 517520 (2001)
References 2:
Ecob-Prince M et al. Journal of Neurological Sciences. 91: 7178 (1989)
References 3:
Carson NE et al. The Journal of Histotechnology. 21 (1): 1924 (1998)
References 4:
Ecob-Prince M et al. Journal of Neurological Sciences. 90: 167177 (1989)
References 5:
Vivarelli E et al. Journal of Cellular Biology. 107: 21912197 (1988)
Reconstitute with 1 mL or 0.1 mL of sterile distilled water as indicated on vial label. The myotilin gene on chromosome 5q31 encodes a 498 amino acid polypeptide with a molecular weight of 57kD. Myotilin is a structural protein of sarcomeric Z discs and sarcolemma in human skeletal and cardiac muscle. It is homologous to palladin and titin in the two C-terminal lg-domains and also to palladin in its unique serine-rich N-terminal region. Myotilin interacts with alpha-actinin, actin and gamma-filamin. Mutations in the myotilin gene are associated with limb-girdle muscular dystrophy 1 A (LGMD1A) and one form of Myofibrillar Myopathy. It is highly conserved between human and mouse with its expression being more widespread in the embryo than in the adult. Expression of myotilin has been reported in adult skeletal and cardiac muscle with variable expression reported in the peripheral nervous system, lung, liver and kidney. NCL-MYOTILIN will be of use in studies to determine the expression of myotilin in normal and pathological tissues.
Antibody Isotype:
IgG1, kappa
Monosan Range:
MONXtra
Clone:
RSO34
Concentration:
n/a
Storage buffer:
Lyophilized
Storage:
2-8°C
References 1:
Mologni L et al. Mechanisms of Development. 103: 121125 (2001)
References 2:
Mykkänen OM et al. Mol. Biol. Cell. 12 (10): 30603073 (2001)
References 3:
Hauser MA et al. Human Molecular Genetics. 9 (14): 21412147 (2000)
References 4:
van der Ven PFM et al. Journal of Cell Biology. 151 (2): 235247 (2000)
References 5:
Salmikangas P et al. Human Molecular Genetics. 8 (7): 13291336 (1999
Human alpha-sarcoglycan, also known as adhalin. Also crossreacts strongly with alpha-sarcoglycan in sections of muscle from mouse, rat, rabbit, hamster and pig. Does not react with chicken muscle.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
Ad1/20A6
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Marafioti T et al. American Journal of Pathology. 162 (3): 861871 (2003)
References 2:
Hess J et al. Molecular and Cellular Biology. 21 (5): 15311539 (2001)
References 3:
Re D et al. Cancer Research. 61 (5): 20802084 (2001)
References 4:
Luo Y and Roeder R G. Molecular and Cellular Biology. 15 (8): 41154124 (1995)
Analyte Specific Reagent. Analytical and performance characteristics are not established. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label. Human delta-sarcoglycan (35 kD). Does not react with delta-sarcoglycan in sections of mouse, rat, rabbit, dog, chicken, hamster or pig muscle. Other animal species not tested.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
dSarc3/12C1
Concentration:
n/a
Storage buffer:
Lyophilized
Storage:
2-8°C
References 1:
Marafioti T et al. American Journal of Pathology. 162 (3): 861871 (2003
References 2:
Hess J et al. Molecular and Cellular Biology. 21 (5): 15311539 (2001)
References 3:
Re D et al. Cancer Research. 61 (5): 20802084 (2001)
References 4:
Luo Y and Roeder R G. Molecular and Cellular Biology. 15 (8): 41154124 (1995)
Analyte Specific Reagent. Analytical and performance characteristics are not established. Human gamma-sarcoglycan (35 kD). The product is a lyophilized tissue culture supernatant containing sodium azide as a preservative. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label.
Antibody Isotype:
IgG2b, kappa
Monosan Range:
MONXtra
Clone:
35DAG/21B5
Concentration:
n/a
Storage buffer:
Lyophilized
Storage:
2-8°C
References 1:
Marafioti T et al. American Journal of Pathology. 162 (3): 861871 (2003
References 2:
Hess J et al. Molecular and Cellular Biology. 21 (5): 15311539 (2001)
References 3:
Re D et al. Cancer Research. 61 (5): 20802084 (2001)
References 4:
Luo Y and Roeder R G. Molecular and Cellular Biology. 15 (8): 41154124 (1995)
Analyte Specific Reagent. Analytical and performance characteristics are not established. The product is a lyophilized tissue culture supernatant containing sodium azide as a preservative. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label.
Antibody Isotype:
IgG2b
Monosan Range:
MONXtra
Clone:
RBC2/3D5
Concentration:
n/a
Storage buffer:
Lyophilized
Storage:
2-8°C
References 1:
Marafioti T et al. American Journal of Pathology. 162 (3): 861871 (2003
References 2:
Hess J et al. Molecular and Cellular Biology. 21 (5): 15311539 (2001)
References 3:
Re D et al. Cancer Research. 61 (5): 20802084 (2001)
References 4:
Luo Y and Roeder R G. Molecular and Cellular Biology. 15 (8): 41154124 (1995)
The CD2 antigen (LFA-2) is a monomeric 45 to 58 kD glycoprotein. It is an accessory molecule important in mediating the adhesion of activated T cells and thymocytes with antigen-presenting cells and target cells.
Antibody Isotype:
IgG1, kappa
Monosan Range:
MONXtra
Clone:
AB75
Concentration:
Greater than or equal to 56 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Leong FJW et al. The Journal of Histotechnology. 2002; 25(4):215227
The neural cell adhesion molecules are a family of closely-related cell surface glycoproteins thought to play a role in embryogenesis, development and contact-mediated interactions between neural cells. The CD56 antigen (NCAM) consists of four major isoforms generated by differential splicing of the RNA transcript from a single gene located on chromosome 5. The CD56 antigen is expressed on neurons, astrocytes, Schwann cells, NK cells and a subset of activated T lymphocytes.
Antibody Isotype:
IgG2b
Monosan Range:
MONXtra
Clone:
CD564
Concentration:
Greater than or equal to 11 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Nakamoto Y et al. Clinical and Experimental Immunology. 2007; 147:296-305
References 2:
Wicherek L et al. Reproductive Biology and Endocrinology. 2006; 4:41
References 3:
Wicherek l et al. Journal of Reproductive Immunology. 2006; 70:119-131
The catenins, (alpha, beta and gamma) are cytoplasmic proteins which bind to the highly conserved tail of the E-cadherin molecule. Beta-catenin is a component of the adherens junction, a multiprotein complex which supports Ca2+ -dependent cell-to-cell contact, which in itself is critical for adhesion, signal transmission and for anchoring the actin cytoskeleton. Beta-catenin's role is as a transcription effector of the wnt-signaling pathway. Immunohistochemistry is the best way to demonstrate nuclear expression of beta-catenin and wnt-pathway activation. This aberrant expression is observed in human tumorigenesis, and especially in colorectal cancer.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
17C2
Concentration:
Greater than or equal to 51 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Curia MC et al. Modern Pathology. 2008; 21:7-14
References 2:
Ortega P et al. Clinical Cancer Research. 2008; 14(14):995-1001
References 3:
Daa T et al. J. of Exp.Clin.Cancer Research. 2005; 24(1):83-87
References 4:
Fadare O et al. World Journal of Surgical Oncology. 2005; 3(38)
References 5:
Gamachi A et al.Modern Pathology. 2003; 16(11):1124-1131
E-cadherin is a Ca2+-dependent, transmembrane cell adhesion molecule. It plays an important role in the growth, development and the intercellular adhesion of epithelial cells. Most tumors have an abnormal architecture and any subsequent loss of adhesiveness is thought to be an important step in the development of local invasion. E-cadherin may have a role in neoplastic progression, particularly as a suppressor of invasion. In prostate cancers, for example, the expression of E-cadherin is reported to be reduced or absent in comparison with its expression in normal prostate which is uniformly strong. Reduced expression or absence of E-cadherin in addition to alpha, beta and gamma-catenin in primary breast carcinomas has also been reported and these four proteins are associated with the development of metastases.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
36B5
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with Sodium azide
Storage:
2-8°C
References 1:
Elston MS et al. J.of Clin.Endocrinology and Metabolism. 2009; 94(4):1436-1442.
References 2:
Munhoz NG et al. The Open Pathology Journal. 2009; 3:10-17
References 3:
Chetty R and Serra S. Histopathology 2008; 52: 325330
References 4:
Schott M et al. Endocrinology and Metabolism 2007; 92(9):3378- 3382
References 5:
Dansranjavin T et al. Oncology Reports. 2006; 15:1125-1131
Human fascin is a 55 to 58 kD actin-bundling protein, whose actin binding ability is regulated by phosphorylation. In normal tissues the detection of fascin is reported to be predominantly restricted to dendritic cells, and in the thymus has been observed only in medullary dendritic cells. In reactive nodes, interdigitating reticulum cells of T cell zones, cells in subcapsular areas, and cells of the reticular network express fascin. Variable expression is seen in follicular dendritic cells and endothelial cells. Lymphoid cells, myeloid cells and plasma cells do not express fascin; however, in cases of Hodgkin's disease, including nodular sclerosis, mixed cellularity lymphocyte depletion and unclassified cases, most or all Reed Sternberg cells are reported to be positive for fascin. Fascin expression may be induced by Epstein-Barr virus (EBV) infection of B cells with the possibility that viral induction of fascin in lymphoid or other cell types must also be considered in EBV-positive cases.
Antibody Isotype:
IgG1, kappa
Monosan Range:
MONXtra
Clone:
IM20
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with 15 mM Sodium azide
Storage:
2-8°C
References 1:
Ishikawa R et al. The Journal of Biological Chemistry. 273 (41): 2699126997 (1998)
References 2:
Ono S et al. The Journal of Biological Chemistry. 272 (4): 25272533 (1997)
References 3:
Pinkus GS et al. American Journal of Pathology. 150 (2): 543562 (1997)
Pax genes are a family of developmental control genes that encode nuclear transcription factors and have been implicated in the control of mammalian development. Pax-5 is a B cell specific transcription factor that is expressed in pro B cells, pre-B and mature B cells, and subsequently in all stages of B cell development until the plasma cell stage in which it is downregulated.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
1EW
Concentration:
Greater than or equal to 29 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Hansson M et al. European Journal of Haematology. 2007; 79:159-165
aveolin-1 is a major structural component of caveolae, which are vesicular invaginations present on the plasma membrane of different cell types. It plays a regulatory role in several signaling pathways and is reported to be most abundantly expressed in terminally differentiated mesenchymal cells such as smooth muscle cells, adipocytes and endothelial cells. High levels are also reported in fibroblasts where a fine granular membranous and diffuse cytoplasmic staining pattern is described.
Antibody Isotype:
IgG2a, kappa
Monosan Range:
MONXtra
Clone:
4D6
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with 15mM sodium azide
Storage:
2-8°C
References 1:
Wiechen K et al. American Journal of Pathology. 158 (3): 833839 (2001).
References 2:
Scherer PE et al. PNAS. 93: 131135 (1996)
References 3:
Lisanti MP et al. Journal of Cellular Biology. 126 (1): 111126 (1994).
CD11c is a member of the leukocyte integrin family of adhesion proteins. It is reported to be expressed in normal tissues, mainly on myeloid cells, for example, in bone marrow myelocytes, premyelocytes, metamyelocytes, non-segmented and segmented neutrophils with high levels reported on tissue macrophages and monocytes and with lowest levels in granulocytes. It is also reported to be expressed on NK cells, activated T cells, lymphoid cell lines, including hairy cell leukemias and a proportion of interdigitating dendritic cells.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
5D11
Concentration:
Greater than or equal to 30 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Barth TFE et al. Journal of Pathology. 2007; 211:305-313
References 2:
Venkatraman L et al. Modern Pathology. 2005; 18: 255A-256A 1183 Supplement 1
CD79b, also known as B29 and Ig-beta is thought to function in the cellular activation and signaling that occurs when surface immunoglobulin (Ig) on B cells binds antigen or becomes cross-linked by anti-Ig antibody. This function occurs with the formation of a membrane signaling complex that is associated with Ig at the surface of B cells. CD79b, together with CD79a, forms the B cell antigen receptor (mlg) complex.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
JS01
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with 15mM sodium azide
Storage:
2-8°C
References 1:
Matutes E. Journal of Clinical Pathology. 55: 180183 (2002)
References 2:
McCarron K F et al. American Journal of Clinical Pathology. 113 (6): 805813 (2000)
References 3:
Moreau E J et al. American Journal of Clinical Pathology. 108: 378382 (1997)
Cytokeratins are intermediate filament proteins present in epithelial cells. They are expressed in a tissue-specific manner in normal organs and the tumors that arise from them. Cytokeratin 7 belongs to the neutral basic type B subfamily of cytokeratins. Its distribution is confined to glandular and transitional epithelia. Cytokeratin 7 is reported to be expressed in abundance in cultured bronchial and mesothelial cells but only at lower levels in cultured epidermal cells. The predicted amino acid sequence of this keratin has revealed a striking difference between this keratin and the type II keratins expressed in epidermal cells. Cytokeratin 7 has been reported in adenocarcinomas of the lung, breast, endometrium, ovary, thyroid as well as in carcinomas of the bladder and chromophobe renal cell carcinoma. Cytokeratin 7 and Cytokeratin 20 expression have been reported to show characteristic patterns on primary and metastatic lung and colorectal adenocarcinomas.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
RN7
Concentration:
Greater than or equal to 17 mg/L
Storage buffer:
Tissue culture supernatant with Sodium azide
Storage:
2-8°C
References 1:
van de Molengraft FJJM et al.Histopathology. 1993; 22:35-38
References 2:
van Niekerk CC et al. Journal of Pathology. 1991; 165(2):145-15
IL-6 is a multifunctional cytokine that is secreted by both lymphoid and non-lymphoid cells. It plays a key role in immune responses, hematopoiesis and is an important cytokine in cell proliferation and differentiation. It may also play an important role as an autocrine growth factor in metastatic prostate cancer. IL-6 has been reported to play a role in secretion or release of pituitary hormone in pituitary hormone secreting cells and adenomas. In addition, IL-6 has been suggested to have a trophic effect in nerve cells and to have a direct pathogenic role in CNS disorders. There are an increasing number of reports that cytokines of the IL-6 family play an important regulatory role in heart physiology.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
10C12
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with 15mM Sodium azide
Storage:
2-8°C
References 1:
Salgado R et al. International Journal of Cancer. 103 (5): 642646 (2003)
References 2:
Kurotani R et al. Modern Pathology. 14 (8): 791797 (2001)
References 3:
Menet E et al. European Cytokine Network. 12 (4): 639646 (2001)
References 4:
Ono S et al. Journal of the Neurological Sciences. 187 (12): 2734 (2001)
References 5:
Yasukawa K et al. The EMBO Journal. 6 (10): 29392945 (1987)
Wilms' tumor protein (WT1) has a role in transcriptional regulation and is expressed in the kidney and a subset of hematopoietic cells. Alteration of transcription factor function is a common mechanism in oncogenesis. The WT1 protein contains a DNA binding domain and any deletions or point mutations of the WT1 gene which destroy this activity result in the development of the childhood nephroblastoma Wilms' tumor and Denys-Drash syndrome. The description of WT1 involvement in nephroblastoma is not clear.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
WT49
Concentration:
Greater than or equal to 44 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Omeroglu A and Omeroglu G. Arch Pathol Lab Med. 2003; 127:e347-e348
References 2:
Lee SB and Haber DA. Experimental Cell Research. 2001; 264:74-99
The CD3 molecule consists of five different polypeptide chains with molecular weights ranging from 16 to 28 kD. The CD3 antigen is first detected in early thymocytes and its appearance probably represents one of the earliest signs of commitment to the T cell lineage. Clone LN10 is specific for the non-glycosylated epsilon chain of the human CD3 molecule. Clone LN10 recognizes T cells in thymus, bone marrow, peripheral lymphoid tissue and blood and is a pan T cell marker.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
LN10
Concentration:
Greater than or equal to 32 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Krynitz B et al. Acta Dermato Venerologica. 2010; 90:379-385
Bcl-6 is a proto-oncogene that encodes a Kruppel-type zinc-finger protein of 95 kD and shares homology with other transcription factors. Bcl-6 protein is mainly expressed in normal germinal center B cells and related lymphomas. It has been shown that the Bcl-6 proto-oncogene is involved in chromosome rearrangements at 3q27 in non-Hodgkin's lymphomas and Bcl-6 rearrangements have also been detected in 33-45% of diffuse large B cell lymphomas. Immunohistochemistry has been reported to show the Bcl-6 gene product to be detectable in follicular lymphomas, diffuse large B cell lymphomas, Burkitt's lymphomas and in nodular, lymphocyte predominant Hodgkin's disease.
Calretinin is a calcium-binding protein of 29 kD that is a member of the family of so-called EF-hand proteins that also includes S-100 proteins. Calretinin is reported to be abundantly expressed in neurons. Outside the nervous system, calretinin is reported to be expressed in a range of cell types including mesothelial cells, steroid producing cells, (for example adrenal cortical cells, Leydig cells, ovarian theca interna cells, Sertoli cells, some neuroendocrine cells, eccrine sweat glands) and other cell types.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
CAL6
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Groves P et al. Acta Biochimica Polonica 2001, 48(1), 113-119
References 2:
Rogers JH .The Journal of Cell Biology 1987, 105, 1343-1353
Prokaryotic recombinant protein corresponding to a 70 amino acid component of the N-terminal region of the cytokeratin 20 intermediate filament protein
Cytokeratin 20 has been demonstrated to be almost entirely confined to the gastric and intestinal epithelium, urothelium and Merkel cells of the skin. Cytokeratin 20 is less acidic than other type I cytokeratins and is of interest due to its restricted tissue expression. In normal tissue, cytokeratin 20 is expressed in intestinal epithelium, gastric foveolar epithelium, a number of endocrine cells in the upper portions of the pyloric glands, urothelium and Merkel cells in epidermis. In tumors it is reported, there is a marked difference in the expression of cytokeratin 20 within different carcinomas. Neoplasms expressing cytokeratin 20 are derived from normal epithelia which themselves expressed cytokeratin 20. Colorectal carcinomas consistently express cytokeratin 20, while gastric adenocarcinomas express cytokeratin 20 to a lesser degree. Adenocarcinomas of the gall bladder and bile duct, ductal cell adenocarcinomas of the pancreas, mucinous ovarian tumors, Merkel cell tumors and transitional cell carcinomas have also been reported to express cytokeratin 20.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
PW31
Concentration:
Greater than or equal to 37 mg/L
Storage buffer:
Tissue culture supernatant with 15 mM sodium azide
Storage:
2-8°C
References 1:
Campbell F and Herrington CS. Current Diagnostic Pathology. 2001; 7:113-122
References 2:
Leech SN et al. Journal of Clinical Pathology. 2001; 54:727-729
References 3:
Ferrari L et al. Anticancer Research. 1999; 19: 3415-3428
Geminin is a protein of 209 amino acids thought to be involved in the control of DNA replication via the interaction with Cdt1. Geminin is not found in the G1 phase of the cell cycle, but is first expressed in the G1 to S transition phase, with expression levels rising through the rest of the cell cycle and levels reaching a maximum during mitosis. It has been proposed that geminin may be a tumor suppressor protein. Geminin is reported to be expressed in proliferating lymphocytes and epithelial cells, for example, germinal centers in tonsil as well as in colon, spermatocytes, seminiferous tubules of the testes, within the basal layers of the squamous epithelium of the skin and breast. Geminin is reported to be upregulated in cancers such as non-Hodgkin's lymphoma, B cell lymphoma, breast carcinoma and colon carcinoma.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
EM6
Concentration:
Greater than or equal to 19 mg/L
Storage buffer:
Tissue culture supernatant with 15mM Sodium azide
Storage:
2-8°C
References 1:
McGarry TJ and Kirschner MW. Cell. 1998; 93:10431053
The CD7 molecule is a membrane-bound glycoprotein of 40 kD and is the earliest T cell specific antigen to be expressed in lymphocytes. CD7 antigen is also the only early marker to persist throughout differentiation. The function and role of the CD7 molecule has not yet been fully identified, although the activation of T cells with gamma/delta receptors has been proposed based on mAb-induced activation. CD7 antigen is reported to be found on the majority of peripheral blood T cells, most natural killer cells and thymocytes.
Antibody Isotype:
IgG2b
Monosan Range:
MONXtra
Clone:
LP15
Concentration:
Greater than or equal to 351 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Leong FJW et al. The Journal of Histotechnology. 2002; 25(4):215-227
References 2:
Ormsby A et al. Journal of the American Academy of Dermatology. 2001; 45(3):405-413
CD33 antigen is reported to appear on myelomonocytic precursor cells after CD34 antigen expression. It then continues to be expressed on both the myeloid and monocyte lineages, although it is reported to be absent on granulocytes. It has been reported that expression of CD33 is restricted to monocytes, premyelocytes, myeloid blasts, some acute undifferentiated leukemias and acute lymphoblastic leukemias.
Antibody Isotype:
IgG2b
Monosan Range:
MONXtra
Clone:
PWS44
Concentration:
Greater than or equal to 417 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Bradshaw EM et al. Nature Neuroscience. 2013, 16(7): 848 852
References 2:
Hoyer JD et al. American Journal of Clinical Pathology. 2008; 129(2): 316 323.
Mismatch repair gene hMLH1 is a ubiquitous gene encoding the mismatch repair protein (MMR) MutL protein homolog 1 (MLH1). MLH1 functions by repairing mutations occurring during DNA replication, in normal proliferating cells.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
ES05
Concentration:
Greater than or equal to 165 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Tamura G et al.World Journal of Gastroenterology 2006; 12(2): 192198
References 2:
Abdel-Rahman W et al. Critical Reviews in Oncology/Hematology 2006; 58: 208220
References 3:
Mitchell R et al. American Journal of Epidemiology 2002; 156:885902
References 4:
Kuismanen S et al. American Journal of Pathology 2000; 156(5): 17731779
Mismatch repair gene MutS Homolog 6 is a ubiquitous gene encoding the mismatch repair protein (MMR) MutS protein homolog 6 (MSH6). MSH6 functions by repairing mutations occurring during DNA replication, in normal proliferating cells.
Antibody Isotype:
IgG
Monosan Range:
MONXtra
Clone:
PU29
Concentration:
Greater than or equal to 200 mg/L
Storage buffer:
Tissue culture supernatant with 15mM sodium azide
Storage:
2-8°C
References 1:
Warren J et al. Molecular Cell. 2007; 26:579-592
References 2:
Marti T et al. Journal of Cellular Physiology. 2002; 191:28-41.
Napsin A has a specific function in normal alveolar epithelium and is proposed to play a role in the proteolytic processing of surfactant precursors. Napsin A is reported to be predominantly expressed in lamellar bodies of type II pneumocytes, secondary lysosomes of alveolar macrophages, respiratory epithelium of terminal and respiratory bronchioles, plasma cells, within a subset of lymphocytes in normal lung, as well as in epithelial cells of renal tubules in normal kidney and is weakly expressed in normal spleen. Studies have reported that Napsin A is expressed in 90% of primary lung adenocarcinomas.
Antibody Isotype:
IgG2b
Monosan Range:
MONXtra
Clone:
IP64
Concentration:
Greater than or equal to 8.3 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Yamashita Y et al. Modern Pathology. 2015; 28: 111-11
References 2:
Kandalaft PL et al. American Journal of Clinical Pathology. 2014; 142: 830-836
Oct-3/4 is a member of the POU homeodomain family of transcription factors, which is expressed by embryonic stem cells and germ cells. A critical amount of Oct-3/4 is required to maintain stem cell self replication. Down regulation of Oct-3/4 levels are associated with loss of pluripotency. Oct-3/4 has been proposed as a useful marker for germ cell tumors which exhibit features of pluripotentiality, including seminoma/dysgerminoma/germinoma and embryonal carcinoma, and establishing a germ cell origin for some metastatic tumors of uncertain primary origin.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
N1NK
Concentration:
Greater than or equal to 69 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Del Sordo R et al. Histology and histopathology. 2014; 29(1):101-106
References 2:
Miettinen M et al. American Journal of Surgical Pathology. 2014; 38(3):410-420
References 3:
Paine SML et al. Neuropathology and applied neurobiology. 2014; 40:544-550
References 4:
Antic T et al. American Journal of Pathology. 2011; 136:872-880
Thyroid peroxidase gene expression is under the regulation of thyroid stimulating hormone. In normal thyroid, expression of thyroid peroxidase (TPO) described immunohistochemically is reported to produce a diffuse, fine, granular cytoplasmic stain in all follicular cells. Some studies have shown qualitative, as well as quantitative differences in thyroid peroxidase expression in thyroid cancer compared to normal tissue.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
AC25
Concentration:
Greater than or equal to 10.8 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Kimura S et al. Proceedings of the National Academy of Science USA 84: 5555-5559 (1987)
References 2:
De Micco C et al. Cancer 67(12): 30363041 (1991)
References 3:
Czarnocka B et al. Breast Journal Cancer 85(6): 875880 (2001)
References 4:
Tanaka T et al. Journal of Pathology 179: 8994 (1996)
Eukaryotic cells contain a number of types of cytoplasmic filamentous proteins, microtubule, microfilaments and intermediate-sized filaments (IF). Vimentin, a 57 kD protein that is an intermediate filament is reported to be expressed in most cells of mesenchymal origin, including fibroblasts, endothelial cells, smooth muscle, melanocytes as well as T and B lymphocytes.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
SRL33
Concentration:
Greater than or equal to 60 mg/L
Storage buffer:
Tissue culture supernatant with 15 mM sodium azide
Storage:
2-8°C
References 1:
Runembert I et al. Journal of Cell Science 115: 71324 (2002)
ZAP-70 is a member of the syk family of proteins. It is expressed on T cells and NK cells and is required for the T cell receptor activation that triggers an immune response. CLL B cells that express the non-mutated immunoglobulin VH genes express levels of ZAP-70 protein that are comparable to those found in the blood T cells of healthy adults. Leukemic cells that express mutated Ig VH genes generally do not express detectable levels of ZAP-70 protein and this is correlated with the high level expression of CD38.
Antibody Isotype:
IgG2b, kappa
Monosan Range:
MONXtra
Clone:
L453R
Concentration:
Greater than or equal to 449 mg/L
Storage buffer:
PBS with sodium azide
Storage:
2-8°C
References 1:
Orchard J et al. Leukaemia and Lymphoma 2005; 46(12):16891698
References 2:
Wang J et al. Applied Immunohistochemistry and Molecular Morphology 2005; 13(4):323332
References 3:
Mustelin T and Tasken K.Biochemical Journal 2003; 371:1527
References 4:
Van Oers N and Weiss A. Seminars in Immunology 1995; 7:227236
Akt-1, also referred to as protein kinase B (PKB) or Rac alpha is a member of the Akt serin/threonine protein kinase family. It plays an important role in many biological responses including metabolism, cell survival and growth by phosphorylation and inactivating several targets including GSK 3 beta, caspase 9, BAD and the forkhead transcription factor. Akt-Phos is not recommended for use with PBS, since the use of PBS-based wash buffers and possibly PBS-based antibody diluents gives increased background staining and decreased staining intensity.
Antibody Isotype:
IgG2b
Monosan Range:
MONXtra
Clone:
LP18
Concentration:
Greater than or equal to 300 mg/L
Storage buffer:
Tissue culture supernatant with 15mM sodium azide
Storage:
2-8°C
References 1:
Brazil D et al. Trends in Biochemical Sciences. 2004; 29(5):233242
References 2:
Nicholson K et al. Cellular Signalling. 2002; 14:381395
References 3:
Lawlor M et al. Journal of Cell Science. 2001; 114:29032910
Carbonic anhydrase (CA) is an enzyme that assists rapid interconversion of carbon dioxide and water into carbonic acid, protons, and bicarbonate ions. Originally named MN/G250, carbonic anhydrase IX (CAIX) is a cell surface transmembrane protein, which is predominantly found in the gastrointestinal tract and gallbladder. The glandular regions of normal colon are reported to be negative, but in the case of adenocarcinoma, the glands are positive. CAIX is also reported to be expressed in common epithelial tumors such as carcinomas of the esophagus, lung, colon, kidney, cervix and non-small cell lung carcinoma.In breast carcinomas, CAIX expression has been reported to be associated with malignant tissue. Expression of CAIX is reported to be absent in normal kidney, chromophobe carcinomas or oncocytomas; however, it is specifically expressed in clear cell renal carcinomas.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
TH22
Concentration:
Greater than or equal to 21 mg/L
Storage buffer:
Tissue culture supernatant with 15mM sodium azide
Storage:
2-8°C
References 1:
Swietach P et al. Cancer and Metastasis Reviews. 2007; 26:299310
References 2:
Potter C and Harris A. Cell Cycle. 2004; 3(2):164167
CD19 is a member of the immunoglobulin superfamily and has two Ig like domains. It is a single chain glycoprotein present on the surface of B lymphocytes and follicular dendritic cells of the hematopoietic system. CD19 is a crucial regulator in B cell development, activation and differentiation. On B cells, CD19 associates with CD21, CD81 and CD225 (Leu-13) forming a signal transduction complex. CD19 is expressed from the earliest recognizable B cell lineage stage, through development to B cell differentiation but is lost on maturation to plasma cells.
Antibody Isotype:
IgG2b
Monosan Range:
MONXtra
Clone:
BT51E
Concentration:
Greater than or equal to 35 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Fujimoto M and Sato S. Journal of Dermatological Science. 2007; 46:1-9
References 2:
Otero D et al. The Journal of Immunology. 2003; 170: 73-83
References 3:
Fujimoto M et al. Seminars in Immunology. 1998; 10:267-277
The CD30 antigen is a single chain glycoprotein with a molecular weight of 120 kD. CD30 antigen is known to act as a receptor for a cytokine ligand, CD30L, and may also play a role in the regulation of cellular growth and transformation. CD30 antigen is reported to be expressed on the surface of multinucleated Reed Sternberg cells, mononuclear Hodgkin's cells and in the majority of anaplastic large cell lymphomas. The CD30 antigen is expressed in non-Hodgkin's lymphoma and virally transformed cells, for example, EBV-transformed B cells.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
JCM182
Concentration:
Greater than or equal to 72 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Kennedy M et al. Immunology. 2006; 118: 143-152
References 2:
Chiarle R et al. Clinical Immunology. 1999; 90(2):157-164
DOG-1, a 986 amino acid protein of unknown function, is expressed predominantly on the plasma membrane of gastrointestinal stromal tumors (GISTs) and is rarely expressed in other soft tissue tumors, which, due to appearance, can be confused with GISTs. Reactivity for DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express KIT antigen. The use of PBS-based diluents may result in increased background staining.
Antibody Isotype:
IgG2b
Monosan Range:
MONXtra
Clone:
K9
Concentration:
Greater than or equal to 12 mg/L
Storage buffer:
Tissue culture supernatant with Sodium azide
Storage:
2-8°C
References 1:
Novelli M et al. Histopathology. 2010; 57, 259-270
References 2:
Miettinen M et al. American Journal of Surgical Pathology, 2009; 33, 1401-1408
Polycomb-group proteins (PcG) such as EZH2 (Enhancer of Zeste Homolog 2 (Drosophila)) form multimeric gene repressing complexes involved in axial patterning, hematopoiesis and cell cycle regulation. PcG proteins ensure correct embryonic development by expressing homeobox genes as well as contributing to the regulation of lymphopoiesis.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
6A10
Concentration:
Greater than or equal to 20 mg/L
Storage buffer:
Tissue culture supernatant with Sodium azide
Storage:
2-8°C
References 1:
Van Kemenade FJ et al. Blood, 97(12): 38963901 (2001)
References 2:
Raaphorst Fm et al.American Journal of Pathology, 157(3): 709715 (2000)
References 3:
Kattan M. Journal of the National Cancer Institute. 95(9): 634635 (2003)
IgA is a member of the antibody class of the immunoglobulin superfamily. There are several classes and subclasses (isotypes) of antibody, the antibody isotype being defined by the immunoglobulin heavy chain present in the molecule. The basic structure of an immunoglobulin molecule consists of two identical heavy chains (gamma , mu, alpha , delta , epsilon) and two identical light chains, either kappa or lambda. IgA contains the alpha -chain and may be present in a serum or secretory form. In serum, 90% of IgA is monomeric, while in its secretory form it is the main immunoglobulin found in secretions including tears, saliva, intestinal and bronchial mucous, sweat, colostrum, and secretions from the prostate and respiratory epithelia, where it has the job of defending exposed external surfaces of the body against attack from micro organisms. Secretory IgA is synthesized locally by plasma cells and dimerized intracellularly with a cysteine-rich J-chain. Clone N1CLA was developed to produce reduced background staining that is associated with polyclonal antibodies on paraffin sections.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
N1CLA
Concentration:
Greater than or equal to 46 mg/L
Storage buffer:
Tissue culture supernatant with Sodium azide
Storage:
2-8°C
References 1:
Merluzzi S et al. Blood Journal. 2010; 115(14):2810-2817
References 2:
Fagarasan S and Honjo T. Current opinion in Immunology. 2004; 16(3):277-283
References 3:
Pilette C et al. European Respiratory Journal. 2001; 18:571-588
Mouse anti-Delta chain of human Immunoglobulin D, clone DRN1C (monoclonal)
Antibody Type:
Monoclonal
Host Animal:
Mouse
Species Reactivity:
human
Immunogen:
Prokaryotic recombinant protein corresponding to 222 amino acids of the N terminus of the delta heavy chain constant region of the human immunoglobulin D molecule.
IgD, together with IgM, are the major immunoglobulins expressed on the surface of B cells where it seems they may operate as mutually interacting antigen receptors for the control of lymphocyte activation and suppression. The greater susceptibility of IgD to proteolysis in combination with antigen could well be implicated in such a function. The use of PBS-based diluents may result in increased background staining. Clone DRN1C was developed to produce reduced background staining that is associated with polyclonal antibodies on paraffin sections.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
DRN1C
Concentration:
Greater than or equal to 133 mg/L
Storage buffer:
Tissue culture supernatant with Sodium azide
Storage:
2-8°C
References 1:
Geisberger R et al. Immunology. 2006; 118:429-437
References 2:
Preudhomme J et al. Molecular Immunology. 2000; 37:871-887
References 3:
Vladutiu A. Clinical and diagnostic laboratory immunology. 2000; 7(2):131-140
IgM, together with IgD, is the major immunoglobulin expressed on the surface of B cells and normally constitutes about 10 per cent of serum immunoglobulin. IgM antibody is prominent in early immune responses to most antigens and predominates in certain antibody responses such as natural blood group antibodies.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
8H6
Concentration:
Greater than or equal to 41 mg/L
Storage buffer:
Tissue culture supernatant with Sodium azide
Storage:
2-8°C
References 1:
Sangaletti S et al. Oncoimmunology. 2014; 3:e28989. doi: 10.4161/onci.28989
References 2:
Carsetti R et al. Immunological Reviews 2004; 197: 179-191
References 3:
Schaffer A et al. Nature Reviews: immunology. 2002; 2: 1-13
Folate is a basic component of cell metabolism and DNA synthesis and repair. It is involved in essential one-carbon transfer reactions and is a vitamin required by both normal and tumor cells. Folate entry into cells is facilitated via two different systems: the reduced folate carrier, which utilizes a bidirectional anion-exchange mechanism, and the folate receptor system. Folate receptor alpha is a membrane-bound member of the folate receptor family, facilitating folate transport via a mechanism termed potocytosis where the receptor is internalized and then recycled back to the cell membrane. Folate receptor alpha expression is reported to be highly restricted in normal tissues and only selectively overexpressed in a limited number of epithelial malignancies.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
BN3.2
Concentration:
Greater than or equal to 67 mg/L
Storage buffer:
Tissue culture supernatant with 15mM Sodium azide
Storage:
2-8°C
References 1:
Smith AE et al. Hybridoma. 2007; 26(5):281288
References 2:
Kelemen L. International Journal of Cancer. 2006; 119:243250
Immunoglobulins are polypeptides and comprise five major classes; immunoglobulin G (IgG), IgA, IgM, IgD and IgE. Each immunoglobulin consists of two identical heavy (H) chains and two identical light (L) chains.These are also subdivided into sub classes eg IgG1. There are two classes of light chain; kappa and lambda. The ratio of kappa chains and lambda chains varies between Ig classes and sub classes, but is also species specific. In humans, approximately 60 percent of light chains are kappa. However, in any particular immunoglobulin molecule the light chain will be either kappa or lambda. B cells contain either kappa or lambda mRNA.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
CH15
Concentration:
Greater than or equal to 125 mg/L
Storage buffer:
Tissue culture supernatant with 15mM Sodium azide
Storage:
2-8°C
References 1:
Ramsland P and Farrugia W. Journal of Molecular Recognition. 2002; 15:248259
The basic structure of an immunoglobulin molecule consists of two identical heavy chains, either gamma, alpha, delta, or epsilon and two identical light chains, either kappa or lambda. Any heavy chain can associate with either light chain but on any immunoglobulin molecule both light chains are of the same type. The ratio of kappa and lambda light chains varies between Ig classes and subclasses. In a polyclonal population the ratio of kappa to lambda bearing B cells is approximately 2:1, with individual B cells thought to express kappa or lambda light chains, never both. The majority of kappa and lambda chains are bound to heavy chain immunoglobulin, however in normal individuals low levels of free light chain are present in serum. The occurrence of a mixture of kappa and lambda chain expressing cells suggests a polyclonal population and a reactive or non-neoplastic proliferation of B cells.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
SHL53
Concentration:
Greater than or equal to 554 mg/L
Storage buffer:
Tissue culture supernatant with 15mM Sodium azide
Storage:
2-8°C
References 1:
Gertz M et al. Kidney International. 2002; 61(1):19
References 2:
Ramsland P and Farrugia W. Journal of Molecular Recognition. 2002; 15:248259
Alpha-methylacyl-CoA racemase (AMACR), also known as p504s, is a mitochondrial and peroxisomal enzyme that is involved in bile acid biosynthesis and beta-oxidation of branched-chain fatty acids. AMACR is essential in lipid metabolism, and is expressed in normal liver (hepatocytes), kidney (tubular epithelial cells) and gall bladder (epithelial cells). Expression has also been found in lung (bronchial epithelial cells) and colon (colonic surface epithelium). Expression is granular and cytoplasmic. AMACR expression can also be found in hepatocellular carcinoma and kidney carcinoma. Past studies have also shown that AMACR is expressed in various colon carcinomas (well, moderately and poorly differentiated) and over expressed in prostate carcinoma.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
EPMU1
Concentration:
Greater than or equal to 84 mg/L
Storage buffer:
Tissue culture supernatant with 15mM sodium azide
Storage:
2-8°C
References 1:
Lloyd M et al.FEBS Journal. 2008: 275;10891102
References 2:
Rubin M et al. J. of the Am. Med.Assoc. 2002: 287(13);16621670
The MUM-1 (multiple myeloma oncogene 1) gene was originally identified because of its involvement in the t(6:14) translocation observed in multiple myeloma, which causes the juxtaposition of the MUM-1 gene to the Ig heavy chain locus. MUM-1 is expressed in late plasma cell directed stages of B cell differentiation and in activated T cells, suggesting that MUM-1 may serve as a marker for lympho-hemopoietic neoplasms derived from these cells. The morphologic spectrum of MUM-1 expressing cells has been found to range from that of a centrocyte to that of a plasmablast/plasma cell. Consequently the histogenic value of MUM-1 may be to provide a marker to aid in the identification of the transition from BCL-6 positive (germinal center B cells) to CD138 positive (immunoblasts and plasma cells).
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
EAU32
Concentration:
Greater than or equal to 263 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Bergsagel P and Kuehl W.Oncogene. 2001: 20(40);5611-5622
Calcitonin (CT) is a 32 amino acid peptide synthesized by the parafollicular C cells of the thyroid. It acts through its receptors to inhibit osteoclast mediated bone resorption, decrease calcium resorption by the kidney and decrease calcium absorption by the intestines. The action of calcitonin is therefore to cause a reduction in serum calcium, an effect opposite to that of parathyroid hormone. The calcitonin gene transcript also encodes the calcitonin gene-related peptide (CGRP), which is thought to be a potent vasodilator. The tissue specificity of the transcript produced depends on alternative splicing of the CT/CGRP gene transcript. In the parafollicular cells of the thyroid 95% of the CT/CGRP is processed and translated to produce CT, however, in neuronal cells 99% of the CT/CGRP RNA is translated into CGRP. The C cells of the thyroid give rise to an endocrine tumor, medullary thyroid carcinoma (MTC), which occurs in a sporadic (75% of cases) and hereditary form (25% of cases). Familial MTC is associated with C cell hyperplasia (CCH), whereas sporadic MTC is thought not to be. However, in the general population CCH is present in 20-30% of thyroid glands, either with normal histology, thyroiditis or follicular tumors.
Antibody Isotype:
IgG2b
Monosan Range:
MONXtra
Clone:
CL1948
Concentration:
Greater than or equal to 29 mg/L
Storage buffer:
Tissue culture supernatant with 15mM sodium azide
Storage:
2-8°C
References 1:
Leboulleux S et al.Clinical Endocrinology. 2004; 61:299310
References 2:
Hirsch P et al. Journal of Musculoskeletal & Neuronal Interactions. 2001; 1(4):299305
References 3:
Pondel M. International Journal of Experimental Pathology. 2000; 81:405422
CD99 is a 32 kDa transmembrane glycoprotein, encoded by the MIC2 gene, which is located in the pseudoautosomal region of the human X and Y chromosomes. Recently, the MIC2 gene has been shown to encode two distinct proteins which are produced by alternative splicing of the CD99 gene transcript and are identified as bands of 30 and 32 kDa (p30/32).
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
PCB1
Concentration:
Greater than or equal to 9,9 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Bühnemann C et al. PLoS ONE. 2014; 9(9): e107105.
References 2:
Bahrami A et al. Archives of Pathology and Laboratory Medicine. 2008; 132:326-348
The CD123 antigen is also known as the alpha subunit of the human interleukin-3 receptor. It is a type I transmembrane glycoprotein and is a member of the cytokine receptor superfamily. CD123 forms a heterodimer with CD131 (the beta subunit of the interleukin-3 receptor) to form the interleukin-3 receptor, where the cytokine specificity is provided by the alpha subunit and the signal transduction function is provided by the beta subunit. The interleukin-3 receptor is reported to be expressed on monocytes, neutrophils, basophils, eosinophils, megakaryocytes, erythroid precursors, mast cells, macrophages and a subpopulation of B cells, where it mediates proliferation and differentiation of these cells. Outside the hematopoietic system CD123 is reported to be expressed in Leydig cells of the testis, some endothelial cells, and cells of the placenta and brain.
Antibody Isotype:
IgG2b
Monosan Range:
MONXtra
Clone:
BR4MS
Concentration:
Greater than or equal to 90 mg/L
Storage buffer:
Tissue culture supernatant with 15mM sodium azide
Storage:
2-8°C
References 1:
GarnacheOttou F et al. British Journal of Haematology. 2007; 136:539548
References 2:
Moretti S et al. J.of Biol.Regulators and Homeostatic Agents. 2001; 15:98100
Tumor cells of epithelial, lymphoid, glial and mesenchymal origin are reported to be negative. This clone is well described in the literature. It is indicated to label an intracytoplasmic antigen in the majority of melanomas and other tumors demonstrating melanoma/melanocytic differentiation.
Inhibins and activins are members of the transforming growth factor beta (TGF?) family of cytokines. Inhibins are heterodimers consisting of a common ?-subunit linked to either a ?A subunit ( ?-?A, forming inhibin A) or a ?B subunit ( ?-?B, forming inhibin B). Activins share the ?-subunit with the inhibins and may be homo or heterodimers of ?-subunits forming activin A (?A-?A), activin AB (?A-?B) or activin B (?B-?B). The expression of the ?-subunit, and therefore of inhibins appears to be more restricted than that of the ?-subunit, and therefore of activins. Inhibins and activins play a role in the regulation of pituitary follicle stimulating hormone (FSH) secretion.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
AMY82
Concentration:
Greater than or equal to 214 mg/L
Storage buffer:
Tissue culture supernatant with 15mM Sodium azide
Storage:
2-8°C
References 1:
Robertson D et al. Endocrine-Related Cancer. 2004; 11:3549
References 2:
Bernard J et al. Recent Progress in Hormone Research. 2001; 56:417450
Mismatch repair gene Postmeiotic segregation Increased 2, also known as PMS1 homolog 2, is a ubiquitous gene encoding the mismatch repair protein (MMR) PMS1 protein homolog 2 (PMS2). PMS2 functions by repairing mutations occurring during DNA replication, in normal proliferating cells.
Antibody Isotype:
IgG
Monosan Range:
MONXtra
Clone:
M0R4G
Concentration:
Greater than or equal to 520 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Silva F et al. Sao Paulo Medical Journal. 2009? 127(1):46- 51
References 2:
Vos M et al. Biochemical Society Transactions. 2005? 33(4):718720
Muscle specific actin (MSA) is a highly conserved, ubiquitous protein found in muscle and some non-muscle cells. Actins can be divided into three subsets, alpha actins found in muscle tissue cells, beta and gamma actins found in non-muscle cells and a small subset of gamma actins also found in muscle tissue cells. In normal tissues, expression is found in striated fibers of skeletal muscle, smooth muscle in arteries, veins and pericytes of smaller arteries, muscle in bowel, myometrium of the uterus, prostatic stroma, capsule cells of liver, kidney, lymph node and spleen, the myoepithelial layers of mammary ducts and glands, eccrine sweat glands and salivary glands. Expression is not found in epithelial cells, lymphoid cells, macrophages, connective tissue and neuronal cells. Human muscle specific alpha- and gamma-actin isomers. Reactive with alpha-actin from skeletal, cardiac and smooth muscle sources. Does not react with non-muscle actin, beta or non-smooth muscle gamma-actin isomers. Crossreacts with porcine, bovine, monkey, rabbit, hamster and rat muscle actin.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
SC28
Concentration:
Greater than or equal to 13 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Tsutsumi Y et al. Pathology International. 1995; 45(2):10
References 2:
Nicolas MM et al. Human Pathology 2010;41:663-671
References 3:
Guillou L. Diagnostic Histopathology 2008;14:527- 535.
The HMB45 antigen has also been identified in retinal pigment epithelium (RPE) but is reported to be reactive only with the transient prenatal and infantile RPE. No reaction is reported to be observed with intradermal nevi and normal adult melanocytes and non-melanocytic cells. Tumor cells of epithelial, lymphoid, glial and mesenchymal origin are reported to be negative. This clone is well described in the literature. It is indicated to label an intracytoplasmic antigen in the majority of melanomas and other tumors demonstrating melanoma/melanocytic differentiation. The clone is also reported to react with junctional and blue nevus cells. (Bacchi CE et al., A Review. Applied Immunohistochemistry. 4:73-85 (1996)).
Antibody Isotype:
IgG1, kappa
Monosan Range:
MONXtra
Clone:
HMB45
Concentration:
Greater than or equal to 10.8 mg/L
Storage buffer:
Tissue culture supernatant with Sodium azide
Storage:
2-8°C
References 1:
Swetter SM et al. Archives of Dermatology. 2004; 140:99-103
References 2:
Kapur RP et al. The Journal of Histochemistry and Cytochemistry. 1992; 40(2):207-212
References 3:
Gown AM et al. American Journal of Pathology. 1986; 123(2):195-203
The Ki67 antigen is a nuclear protein which is expressed in all active parts of the cell cycle (G1, S, G2 and mitosis) but is absent in resting cells (G0). In contrast to many other cell cycle-associated proteins, the Ki67 antigen is consistently absent in quiescent cells and is not detectable during DNA repair processes. Thus, the presence of Ki67 antigen is strictly associated with the cell cycle and confined to the nucleus, suggesting an important role in the maintenance and/or regulation of the cell division cycle.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
K2
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with 15 mM sodium azide
The c-erbB-2 oncoprotein is closely related in structure to the epidermal growth factor receptor and is a member of a large family of cell surface growth factor receptors. c-erbB-2 oncoprotein is reported to be detectable in a proportion of breast and other adenocarcinomas as well as transitional cell carcinomas. c-erbB-2 oncoprotein is present in a wide variety of cell types in a range of normal human fetal and adult tissues, including breast, stomach and ovary. CB11 detects the internal domain of the c-erbB-2 oncoprotein. CBE-356 detects the external domain of the c-erbB-2 oncoprotein.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
10A7
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with 15 mM sodium azide
The c-kit proto-oncogene encodes a transmembrane receptor with tyrosine kinase activity, c-kit (CD117), which is closely-related to the platelet-derived growth factor receptor family. c-kit plays a role during hematopoiesis, gametogenesis and melanogenesis. The expression of CD117 antigen is of particular interest in the study of gastrointestinal stromal tumors (GIST), small lung cell carcinomas and in melanomas.
Antibody Isotype:
IgG
Monosan Range:
MONXtra
Clone:
EP10
Concentration:
Greater than or equal to 13 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Sawyer EJ et al. Journal of Pathology 2003, 200, 59-64
CD15 antigen, also known as X-hapten, is reported to be expressed on 90% of circulating human granulocytes, 30-60% of circulating monocytes and is absent from normal lymphocytes. The CD15 antigen is also expressed on Reed Sternberg cells of Hodgkin's disease and some leukemias.
Antibody Isotype:
IgM
Monosan Range:
MONXtra
Clone:
MMA
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Mao X et al. Translational Oncology. 2009; 2(4): 247-257
References 2:
Wong A et al. The American Journal of Surgical Pathology. 2008; 32(8):1265-1268
References 3:
Pellegrini W et al. Haematalogica. 2007; 92(5):708-709
References 4:
Vassallo J et al. The American Journal of Surgical Pathology. 2006; 30(2):223-229
References 5:
Barry TS et al. The American Journal of Surgical Pathology. 2003; 27(12):1513-1522
CD31 antigen (PECAM-1) is a single chain transmembrane glycoprotein with a molecular weight of 130 to 140 kD. The CD31 molecule is expressed on the surface of platelets, monocytes, granulocytes, B cells and at the endothelial intracellular junction. The molecule has an extracellular domain that contains six Ig-like homology units of C2 subclass, typical of cell to cell adhesion molecules. This domain mediates endothelial cell to cell adhesion, plays a role in endothelial contact and may serve to stabilize the endothelial cell monolayer. The CD31 molecule also has a cytoplasmic domain with potential sites for phosphorylation after cellular activation. The properties of CD31 antigen suggest that it is involved in interactive events during angiogenesis, thrombosis and wound healing. Angiogenesis is essential for tumor growth and metastases.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
JC70A
Concentration:
Greater than or equal to 31 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
DeYoung BR et al. Journal of Clinical Pathology 1995; 22: 215-222
References 2:
Parums DV et al. Journal of Clinical Pathology 1990; 43: 752-757
References 3:
Fox SB et al. Journal of the National Cancer Institute 1997; 89: 1044-1049
References 4:
Engel CJ et al. American Journal of Surgical Pathology 1996; 20: 1260-1265
References 5:
Giatromanolaki A et al. Journal of Pathology 1996; 179: 80-88
The CD71 molecule is a type II membrane glycoprotein with a molecular weight of approximately 180 kD. It is known as the transferrin receptor and is composed of two disulfide-bonded 90 kD subunits. The CD71 molecule plays a critical role in cell proliferation by controlling the supply of iron, an essential component for many metabolic pathways, through the binding and endocytosis of transferrin, the major iron-carrying protein. CD71 protein is reported to be expressed on activated B and T cells, macrophages, proliferating cells and metabolically active cells, for example, neurons.
Antibody Isotype:
IgG2b
Monosan Range:
MONXtra
Clone:
10F11
Concentration:
Greater than or equal to 42 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Dong HY et al. American Journal of Surgical Pathology. 2011; 35(5):723-732
The CD79 complex is a disulfide-linked heterodimer which is non-covalently associated with membrane-bound immunoglobulins on B cells. This complex of polypeptides and immunoglobulin constitute the B cell antigen receptor. The two components of this complex are designated CD79a and CD79b. The CD79a antigen is reported to first appear at the pre-B cell stage, early in maturation, and persist until the plasma cell stage where it is found as an intracellular component. It is not present in myeloid or T cell lines.
Antibody Isotype:
IgG2b
Monosan Range:
MONXtra
Clone:
JCB117
Concentration:
Greater than or equal to 20 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Bhargava P et al. American Journal of Clinical Pathology. 2007; 128(2): 306-313
References 2:
Torlakovic E et al. The American Journal of Surgical Pathology. 2002; 26(10): 1343-1350
References 3:
Blakolmer K et al. Modern Pathology. 2000; 13(7): 766-772
References 4:
Pilozzi E et al. The Journal of Pathology. 1998;186(2):140-143
Carcinoembryonic antigen (CEA),(CD66e) is a heterogeneous cell surface glycoprotein produced by cells of fetal colon. Low levels are also found on normal mucosal epithelia of the adult colon and a variety of other normal tissues. CEA is encoded by the CEA gene, which is located on chromosome 19. It is a member of the CEA gene family, which in turn is a subfamily of the immunoglobulin superfamily. Cell adhesion properties are now well recognized for CEA. It is believed that the expression of this glycoprotein in conjunction with other known adhesion molecules will influence the cell-cell interaction.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
12-140-10
Concentration:
Greater than or equal to 38 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Lee OJ and Lee HC. The Korean Journal of Pathology. 2010; 44: 666-669
References 2:
Chung-Chin Y et al.Archives of Gynecology and Obstetrics 2009;208:3: 405-413
References 3:
Gimelli S et al. Molecular Cancer 2009;8: 52-65
References 4:
Liao CL et al. Journal of Translational Medicine 2009;7:(1): 1-9
References 5:
Raspollini MR et al. Archives of Pathology and Laboratory Medicine 2003;127:1586-1590
Carcinoembryonic antigen (CEA), (CD66e) is a heterogeneous cell surface glycoprotein produced by cells of fetal colon. Low levels are also found on normal mucosal epithelia of the adult colon and a variety of other normal tissues. CEA is encoded by the CEA gene, which is located on chromosome 19. It is a member of the CEA gene family, which in turn is a subfamily of the immunoglobulin superfamily. Cell adhesion properties are now well recognized for CEA. It is believed that the expression of this glycoprotein in conjunction with other known adhesion molecules will influence the cell-cell interaction.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
COL-1
Concentration:
Greater than or equal to 20 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Chhieng DC et al. Human Pathology. 2003; 34(10): 1016-1021
References 2:
Kass ES et al. Cancer Research. 2002; 62(17): 5049-5057
References 3:
Tendler A et al. Human Pathology. 2000; 31(11): 1357-1362
In normal tissues cytokeratin 17 is reported to be expressed in basal cells of complex epithelia, for example, basal cells of pseudostratified epithelium in the trachea, larynx, bronchi, myoepithelial cells in salivary glands and sweat glands. In neoplastic tissue, cytokeratin 17 is reported to be expressed in squamous cell carcinomas of the lung, cervix and oral cavity. CK17 reacts with the human cytokeratin intermediate filament protein (46 kD) identified as cytokeratin 17.
Antibody Isotype:
IgG2b
Monosan Range:
MONXtra
Clone:
E3
Concentration:
Greater than or equal to 8 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Ansai S et al. Journal of Dermatology. 2011; 38(10):951-958
The utrophin gene is located on chromosome 6. Analyte Specific Reagent. Analytical and performance characteristics are not established. Amino terminal domain of the human homolog of human dystrophin, utrophin (also known as dystrophin related protein or DRP). Also crossreacts with utrophin in sections of muscle from rat and dog. Other animals species have not been tested.The product 2 is a lyophilized tissue culture supernatant containing sodium azide as a preservative. The user is required to reconstitute the contents of the vial with the correct volume of sterile distilled water as indicated on the vial label.
Dystrophin is the 427kD protein product of the DMD gene located on the X chromosome at position Xp21. Analyte Specific Reagent. Analytical and performance characteristics are not established. Lyophilized tissue culture supernatant containing 15 mM sodium azide. Reconstitute with the volume of sterile distilled water indicated on the vial label.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
13H6
Concentration:
n/a
Storage buffer:
Lyophilized
Storage:
2-8°C
References 1:
Blake DJ et al. Physiological Reviews. 82 (2): 291329 (2002)
Glial fibrillary acidic protein (GFAP) is an intermediate filament protein of 52kD reported to be expressed in glial cells, for example, astrocytes and ependymal cells. In the peripheral nervous system, GFAP has been reported to be expressed in Schwann cells, enteric glial cells and satellite cells of human sensory ganglia and in neoplastic tissues GFAP has been reported to be expressed in astrocytomas and ependymomas. When using GFAP-GA5 the heat induced epitope retrieval (HIER) technique may improve staining in some cases.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
GA5
Concentration:
Greater than or equal to 70 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Louis ED et al. Brain 7. 2007; 130:3297-3307
References 2:
Barresi V et al. Archives of Pathology and Laboratory 8. Medicine 2006; 130:1208-1211
References 3:
Biondo B et al. Acta Neuropathologica 2004; 108:309-318
Human herpesvirus type 8 (HHV8), is the proposed etiological agent of Kaposi's sarcoma (KS). It is reported that HHV8 has been demonstrated in KS tissues by immunohistochemistry, in situ PCR and also in situ hybridization. HHV8 encodes a latent nuclear antigen (LNA) which is the product of the viral gene ORF73. LNA is capable of forming a complex with retinoblastoma susceptibility gene product which may be related to its oncogenic activity. HHV8 has been reported to be expressed in multicentric Castleman's disease (MCD) and in angioimmunoblastic lymphadenopathies. The localization of HHV8 in subcapsular spindle cell proliferations, which is where early intranodal KS begins, and endothelial cells in Castleman's disease may explain the link between intranodal KS and MCD. In MCD, HHV8 is reported to be expressed in mantle zone large immunoblastic B cells.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
13B10
Concentration:
Greater than or equal to 35 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Pereira PF et al. 2013. Anais Brasileiros de Dermatologia 88;2:243- 46.
References 2:
Urquhart JL et al.The American Journal of Dermatopathology. 2006; 28(4): 317-321
References 3:
Cheuk W et al. American Journal of Clinical Pathology. 2004; 121(3): 335-342
The human immunoglobulins consist of two identical heavy chains (~50 kD) and two identical light chains, which are linked together by disulphide bonds. The light chains can be either kappa or lambda. The five immunoglobulins IgA, IgD, IgE, IgG and IgM differ in their heavy chains, and IgA and IgM differ as they can occur in polymeric forms. The heavy chain of IgG is named the gamma-chain. In humans, IgG consists of four sub classes that differ only marginally in their amino acid composition. Antibodies to IgG have been reported to be useful in the identification of plasma cells, lymphoid cells containing IgG and classifying B cell derived neoplasms. The normal B cell population is polyclonal, expressing a range of different immunoglobulins. In contrast, the majority of B cell neoplasms are characterized by the proliferation of monoclonal cells expressing one type of light chain, whereas more than one type of heavy chain can be expressed by the same cell.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
RWP49
Concentration:
Greater than or equal to 59 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Karamchandani JR et al. American Journal of Clinical Pathology. 2012; 137: 699-711
References 2:
Janeway C et al.Chapter 3. Garland Science. New York and London. 2001
References 3:
Fridman W et al. FASEB Journal. 1991; 5: 2684-2690
Langerin is a type II transmembrane C-type lectin which has mannose-binding specificity. It is a 40 kD protein restricted to Langerhans cells that is involved in the internalization of cell surface material in these immature dendritic cells. Dendritic cells are antigen-presenting cells that are required for initiation of a specific T cell-driven immune response. These cells are found in non-lymphoid tissue as immature cells whose primary function is to capture antigen through specialized surface membrane endocytic structures or through macropinocytosis. The dendritic cells migrate to secondary lymphoid tissue and mature into efficient antigen presenting cells. A part of the maturation process includes the loss of adhesion receptors such as E-cadherin and the disappearance of Birbeck granules.
Antibody Isotype:
IgG2b, kappa
Monosan Range:
MONXtra
Clone:
12D6
Concentration:
Greater than or equal to 20 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Yen EH et al. Journal of Pediatric Gastroenterology and Nutrition 2010;51(5): 584-592
References 2:
Musso T et al. PLoS ONE 2008; 3(9): e3271.1-10
References 3:
Rezk SA et al. American Journal of Surgical Pathology 2008;32(12):1868-1876
References 4:
ODonnell RK et al. Cancer Letters 2007;255(1):145-152
Mismatch repair gene MutS Homolog 2 is a ubiquitous gene encoding the mismatch repair protein (MMR) MutS protein homolog 2 (MSH2). MSH2 functions by repairing mutations occurring during DNA replication, in normal proliferating cells.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
79H11
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Jensen UB et al. Breast Cancer Research and Treatment. 2009; 120 (3): 777-782
The accumulation of p53 protein in response to genotoxic stress in vitro is well established and appears to induce growth arrest and apoptosis by the transcriptional regulation of other genes and possibly by other direct mechanisms.
Monosan Range:
MONXtra
Concentration:
n/a
Storage buffer:
PBS with 1% BSA and sodium azide
Storage:
2-8°C
References 1:
Botchkarev VA et al. American Journal of Pathology. 158 (6): 19131919 (2001)
References 2:
Midgley CA et al. Journal of Cell Science. 108: 18431848 (1995
Cyclin-dependent kinases are positive regulators of cell proliferation. p57 protein acts as a tumor suppressor to counter this. It is closely related to other CDKIs such as p21 protein (CIP1) and p27 protein (Kip1) as they share a common structural N-terminal domain for binding to CDK/cyclin complexes and inhibiting their kinase activity. Human p57 protein is found on chromosome 11p15.5, a region which is reported to be a common site for loss of heterozygosity in certain sarcomas, Wilms tumors and tumors associated with the Beckwith-Wiedermann syndrome. There is increasing interest in p57 as a marker in gestational disease. Gestational trophoblastic disease refers to a spectrum of proliferative disorders of the placental trophoblast, with a wide range of histologic appearances and clinical behaviors.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
25B2
Concentration:
Greater than or equal to 19 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Kanthan R et al.World Journal of Surgical Oncology 2010; 8:10
References 2:
Sharifi N et al.Journal of the Turkish-German Gynecological Association 2009;10:39-42
References 3:
Maggiori MS and Peres LC. European Journal of Obstetrics and Gynecology and Reproductive Biology 2007; 135: 170-176
Polo-Like Kinase-1 (PLK1) also known as Serine/Threonine Protein Kinase 13 is a 66 kDa kinase. The activity of PLK-1 is crucial for mitosis and maintenance of genome stability. PLK-1 localizes to centrosomes and kinetochores where it plays a key role in late prophase and prometaphase. PLK-1 is overexpressed in many types of cancers and mediates estrogen receptor-mediated gene transcription in breast cancer cells. Overexpression of PLK-1 is associated with tumor development, with elevated levels of expression reported in non-small cell lung cancers, head and neck, gastric, breast, ovarian, colon and several other cancer types.
The parathyroid glands are small, oval, endocrine glands closely associated with the thyroid gland. The parathyroid glands regulate serum calcium and phosphate levels via parathyroid hormone (parathormone). Parathyroid hormone raises serum calcium levels directly, by increasing the rate of osteoclastic reabsorption and promoting breakdown of the bone matrix, and indirectly, by increasing the renal tubular reabsorption of calcium ions and inhibiting the reabsorption of phosphate ions from the glomerular filtrate, and finally, by promoting the absorption of calcium from the small intestine. Parathyroid hormone is the most important regulator of blood calcium levels and is essential to life, whereas calcitonin appears only to provide a complementary mechanism for fine adjustment. Chief cells are the most abundant cells in the parathyroid gland and are responsible for the secretion of parathyroid hormone.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
105G7
Concentration:
Greater than or equal to 12 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Au AYM et al. The New England Journal of Medicine, 2008 359;(11):1184-1186
References 2:
Ikeda K et al. Diagnostic Cytopathology. 2005:34(1):50-55
S-100A and S-100B proteins are two members of the S-100 family of proteins. S-100A subtypes are composed of one alpha and one beta chain, whereas S-100B is composed of two beta chains. S-100 protein is reported to be expressed in neuroectodermal tissue, including nerves and melanocytes. Langerhans cells in skin are also reported to express S-100 protein. It is noteworthy that S-100 protein is highly soluble and may be eluted from frozen tissue during immunohistochemical procedures. Clone EP32 was raised against S-100 beta protein. Immunoreactivity was observed in neuroectodermal tissue e.g. melanocytes, nerve fibres, dendritic cells, adipocytes and a percentage of macrophages, lymphocytes and plasma cells.
Antibody Isotype:
IgG
Monosan Range:
MONXtra
Clone:
EP32
Concentration:
Greater than or equal to 30 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Chen H et al. American Journal of Cancer Research 2014;4(2):89-115
References 2:
Torlakovic EE et al.Applied Immunohistochemistry & Molecular Morphology. 2015; 23(1):1-18
The CD45RO molecule, a 180 kD isoform of CD45, is reported to be expressed on 48% of peripheral blood T lymphocytes, 37% of CD4 positive lymphocytes, 80% of thymocytes and on the majority of T cell malignancies. Monocytes and granulocytes show surface expression of the antigen whereas tissue macrophages exhibit cytoplasmic expression.
Antibody Isotype:
IgG2a
Monosan Range:
MONXtra
Clone:
UCHL1
Concentration:
n/a
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Hall PA et al. Histopathology. 13: 339346 (1988
References 2:
Terry LA et al.Immunology. 64: 331336 (1988
References 3:
Norton AJ et al. Journal of Clinical Pathology. 39: 399405 (1986)
Eukaryotic cells contain a number of types of cytoplasmic filamentous proteins, microtubule, microfilaments and intermediate-sized filaments (IF). Vimentin, a 57 kD protein that is an intermediate filament is reported to be expressed in most cells of mesenchymal origin, including fibroblasts, endothelial cells, smooth muscle, melanocytes as well as T and B lymphocytes.
Antibody Isotype:
IgG1
Monosan Range:
MONXtra
Clone:
V9
Concentration:
Greater than or equal to 16 mg/L
Storage buffer:
Tissue culture supernatant with sodium azide
Storage:
2-8°C
References 1:
Colella R et al. American Journal of Surgical Pathology. 2010;34:10-17
References 2:
Gimelli S et al. Molecular Cancer. 2009;8:52
References 3:
Arnardottir S et al. Neurosurgery and Psychiatry. 2004;75(6):917-920
References 4:
Vargel I et al. American Journal of Medical Genetics. 2002; 109(1):22-35
References 5:
Osborn M et al. European Journal of Cell Biology. 1984; 34:137-143
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Mouse Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Mouse Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Mouse Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Mouse Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.25 M Sodium Chloride, pH 7.6
Storage:
2-8 °C
Country Of Origin:
Normal Mouse Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Mouse Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.5 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
2-8 °C
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Polyhisitidine tagged proteins (N- or C-terminus label)
Concentration:
1mg/ml
Conjugate:
Unconjugated
Form:
Liquid
Purification:
Affinity Purified Using solid phase 6x Histidine IgG
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Polyhisitidine tagged proteins (N- or C-terminus label)
Concentration:
none
Form:
Liquid
Purification:
Affinity Purified Using solid phase 6x Histidine IgG
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Polyhisitidine tagged proteins (N- or C-terminus label)
Concentration:
0.1mg/ml
Conjugate:
DyLight® 488 (Ex = 493 nm; Em = 518 nm)
Form:
Liquid
Purification:
Affinity Purified Using solid phase 6x Histidine IgG
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Polyhisitidine tagged proteins (N- or C-terminus label)
Concentration:
DyLight® 550
Form:
Liquid
Purification:
Affinity Purified Using solid phase 6x Histidine IgG
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Polyhisitidine tagged proteins (N- or C-terminus label)
Concentration:
0.1mg/ml
Conjugate:
DyLight® 650 (Ex = 652 nm; Em = 672 nm)
Form:
Liquid
Purification:
Affinity Purified Using solid phase 6x Histidine IgG
Buffer:
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 2 mM Sodium Azide
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Polyhisitidine tagged proteins (N- or C-terminus label)
Concentration:
0.1mg/ml
Conjugate:
Alkaline Phosphatase
Form:
Lyophilized
Purification:
Affinity Purified Using solid phase 6x Histidine IgG
Buffer:
25 mM Tris, 150 mM NaCl, 5 mM MgCl2, 0.12 mM ZnCl2, 2 mM Sodium Azide (pH7.4)
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Polyhisitidine tagged proteins (N- or C-terminus label)
Concentration:
Biotin
Form:
Lyophilized
Purification:
Affinity Purified Using solid phase 6x Histidine IgG
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Polyhisitidine tagged proteins (N- or C-terminus label)
Concentration:
1mg/ml
Conjugate:
Europium
Form:
Liquid
Purification:
Affinity Purified Using solid phase 6x Histidine IgG
Buffer:
50 mM tris (pH 7.8), 0.9% NaCl, 0.05% NaN3,
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Polyhisitidine tagged proteins (N- or C-terminus label)
Concentration:
1mg/ml
Conjugate:
Horseradish Peroxidase
Form:
Liquid
Purification:
Affinity Purified Using solid phase 6x Histidine IgG
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Polyhisitidine tagged proteins (N- or C-terminus label)
Concentration:
R-Phycoerythrin (R-PE)
Form:
Lyophilized
Purification:
Affinity Purified Using solid phase 6x Histidine IgG
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
25 mM Tris, 150 mM NaCl, 5 mM MgCl2, 0.12 mM ZnCl2, 2 mM Sodium Azide (pH7.4)
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 2 mM Sodium Azide
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
2-8 °C, DO NOT FREEZE
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 2 mM Sodium Azide
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
25 mM Tris, 150 mM NaCl, 5 mM MgCl2, 0.12 mM ZnCl2, 2 mM Sodium Azide (pH7.4)
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Mouse
Immunogen:
DYKDDDDK (FLAG)
Buffer:
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 1.5% BSA, 50mM Sucrose
Preservative:
0.01% Thimerosal
Reconstitution:
Rehydrate with 1.0 ml of deionized water and let stand 30 minutes at room temperature to dissolve. Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
2-8 °C, DO NOT FREEZE
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
DyLight® 488
Form:
Liquid
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
1mg/ml
Conjugate:
DyLight® 550 (Ex = 562 nm; Em = 576 nm)
Form:
Liquid
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
1mg/ml
Conjugate:
DyLight® 650 (Ex = 652 nm; Em = 672 nm)
Form:
Liquid
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 2 mM Sodium Azide
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
Alkaline Phosphatase
Form:
Lyophilized
Purification:
Affinity Purified Using solid phase HA
Buffer:
25 mM Tris, 150 mM NaCl, 5 mM MgCl2, 0.12 mM ZnCl2, 2 mM Sodium Azide (pH7.4)
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
1mg/ml
Conjugate:
Biotin (NHS-LC)
Form:
Lyophilized
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
Europium
Form:
Liquid
Purification:
Affinity Purified Using solid phase HA
Buffer:
50 mM tris (pH 7.8), 0.9% NaCl, 0.05% NaN3,
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
1mg/ml
Conjugate:
Horseradish Peroxidase
Form:
Lyophilized
Purification:
Affinity Purified Using solid phase HA
Immunogen:
YPYDVPDYA
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
2-8 °C
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
1mg/ml
Conjugate:
R-Phycoerythrin (R-PE)
Form:
Lyophilized
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
2-8 °C, DO NOT FREEZE
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Storage of tissue samples. The aluminium cryo vials with screw caps can be used for storage of tissue samples. The cryo tubes are suitable for storage of tissue samples in liquid nitrogen. Suitable for deepfreezing till -196°C. Autoclavable at 121°C . Available in 3ml (PA6003) and 15ml (PA6015) (sets of 100 pieces).
Storage of cryo tubes in liquid nitrogen: 1) Place the tissue in the cryo tube, 2) Close the cryotube tighly and place the cryotube in the liquid nitrogen for 1 minute, 3) The cryo vials can be stored at -80°C. Use of cryo tube in combination with isopentane: 1)Place a cup with isopentane in the liquid nitrogen; after approximately 2 minutes the isopentane clot and have a temperature of -160°C. 2)Place the tissue sample or biopsy in the isopentane for 30 seconds, 3) Place the tissue in the cryo vials and store at -80°C.
Reagent preparation:
Make sure that the cap and the vial have the same temperature because the material could slightly shrink or expand under influence of excessive temperature differences.
Expected results:
Long term storage of tissue
Precautions:
Wear a face mask at all times, Check if the screw treads and the lid are okay, Screw the lid on tightly. Attention: AVOID EXCESSIVE TEMPERATURE CHANGES, the cap could explode from the cryo tube.
Storage of tissue samples. The aluminium cryo vials with screw caps can be used for storage of tissue samples. The cryo tubes are suitable for storage of tissue samples in liquid nitrogen. Suitable for deepfreezing till -196°C. Autoclavable at 121°C . Available in 3ml (PA6003) and 15ml (PA6015) (sets of 100 pieces).
Storage of cryo tubes in liquid nitrogen: 1) Place the tissue in the cryo tube, 2) Close the cryotube tighly and place the cryotube in the liquid nitrogen for 1 minute, 3) The cryo vials can be stored at -80°C. Use of cryo tube in combination with isopentane: 1)Place a cup with isopentane in the liquid nitrogen; after approximately 2 minutes the isopentane clot and have a temperature of -160°C. 2)Place the tissue sample or biopsy in the isopentane for 30 seconds, 3) Place the tissue in the cryo vials and store at -80°C.
Reagent preparation:
Make sure that the cap and the vial have the same temperature because the material could slightly shrink or expand under influence of excessive temperature differences.
Expected results:
Long term storage of tissue
Precautions:
Wear a face mask at all times, Check if the screw treads and the lid are okay, Screw the lid on tightly. Attention: AVOID EXCESSIVE TEMPERATURE CHANGES, the cap could explode from the cryo tube.
Ribosome-inactivating Purified Protein saporin-6 (Saporin), Purified Native Purified Protein, suitable for WB.
Background Info:
Saporin is a ribosome-inactivating protein (RIP) of type I. This monomeric RNA N-glycosidase purified from seeds of the plant Saponaria officinalis also known as Soapwort, is capable of specific depurination of eukaryotic ribosomes thus arresting protein synthesis. No ligand has been identified in saporin hence its inability to transverse the cell membrane. Due to its toxicity and stability of the structure, saporin has proven extremely useful for construction of immunotoxins. Biosensis Saporin is purified in-house and available in bulk reuqest upon request as well.
Product Type:
Protein
Format:
Lyophilized
Applications:
WB
Alternative Names:
Saponaria officinalis; Common soapwort; ribosome inactivating protein saporin-6; SAP-6; SO-6; rRNA N-glycosidase
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
Keep lyophilized protein at 2-8ºC. Aliquot and keep at -20°C for long-term storage. For short term keep aliquots at 2-8ºC. Avoid repetitive freeze/thaw cycles.
Purification:
> 95% by SDS-PAGE. Purified from seeds of the plant Saponaria officinalis.
CNTF is a survival promoting factor for different types of neurons in vitro and in vivo. The essential structural features for the biological function of human CNTF were investigated by Thier, M. et al. They showed that deletion of 14 N-terminal and 18 C-terminal amino acids significantly increased bioactivity compared to wild-type CNTF. FUNCTION: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. TISSUE SPECIFICITY: Nervous system. PHARMACEUTICAL: CNTF is being tested under the name Axokine by Regeneron Pharmaceuticals for treatment of human motor neuron diseases, such as amyotrophic lateral sclerosis (ALS). As it induces substantial weight loss, preferentially of fat as opposed to lean body mass, it is being used for obesity treatment. SIMILARITY: Belongs to the CNTF family.
Product Type:
Protein
Format:
Lyophilized
Applications:
Cell Culture
Alternative Names:
Ciliary NeuroTrophic Factor
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Qiping D et al. (2018) Mechanism and consequence of abnormal calcium homeostasis in Rett syndrome astrocytes. eLife. [Accepted Manuscript]. Williams EC et al. (2014) Mutant astrocytes differentiated from Rett syndrome patients-specific iPSCs have adverse effects on wild-type neurons. Hum Mol Genet. 2014 Jun 1;23(11):2968-80.
Storage:
Aliquot and keep at -20°C for long-term storage. For short term keep at 2-8°C. Avoid repetitive freeze/thaw cycles.
Mouse NGF (2.5S) was isolated from mouse submaxillary glands by method of Mobley et al (1976) and is a form of beta-NGF that has identical biological properties. NGF is known to regulate the survival and development of certain sympathetic and sensory neurons. It is a dimer with 2 identical polypeptide chains and dimeric molecular weight of approximately 26,500 Da. Isolation and purification of NGF from mouse submaxillary glands yields preparations of NGF (2.5S) with identical biological activity but with cleavages at the amino terminus (with the loss of 8 amino acids) and/or at the carboxy-terminus (with the loss of arginine). These preparations are named 2.5 NGF (see reference below).
Background Info:
Nerve growth factor (NGF) is important for the development and maintenance of the sympathetic and sensory nervous systems. It stimulates division and differentiation of sympathetic and embryonic sensory neurons.
Product Type:
Protein
Format:
Lyophilized from PBS, pH 7.4 without preservatives.
Applications:
Cell Culture,ELISA,WB
Application Details:
Stimulates neurite outgrowth in rat PC12 cells
Alternative Names:
mouse NGF; beta NGF
Biological Activity:
Stimulates neurite outgrowth in rat PC12 cells
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt for lyophilized material. Reconstituted material, 5 days at 4C, 30 days -20°C, 60 days -70°C for highest activity Avoid repeated freezing and thawing. Use insulated storage containers for best results.
Use:
For research use only.
Product references:
Wang YN et al (2021) Slit3 secreted from M2-like macrophages increases sympathetic activity and thermogenesis in adipose tissue. Nat Metab. 3(11):1536-1551. Walters RR et al (2021) Pharmacokinetics and Immunogenicity of Frunevetmab in Osteoarthritic Cats Following Intravenous and Subcutaneous Administration. Front Vet Sci. 8:687448. Carter DR et al (2016) Glutathione biosynthesis is upregulated at the initiation of MYCN-driven neuroblastoma tumorigenesis. Mol Oncol. 2016 Jun;10(6):866-78. Goodhill GJ et al (2015) The dynamics of growth cone morphology. BMC Biol. 2015 Feb;13(10). Coulson EJ et al (2015) Neurotrophin-tyrosine kinase receptor signaling. United States Patent Application 20150344535. Gearing, DP et al (2013) A fully caninised anti-NGF monoclonal antibody for pain relief in dogs. BMC Vet Res. 9:226. Matusica D et al (2013) An intracellular domain fragment of the p75 neurotrophin receptor (p75(NTR)) enhances tropomyosin receptor kinase A (TrkA) receptor function. J Biol Chem. 2013 Apr 19;288(16):11144-54. Yuan J et al (2013) Optimality and saturation in axonal chemotaxis. Neural Comput. 2013 Apr;25(4):833-53. Sykes AM et al (2012) The effects of transmembrane sequence and dimerization on cleavage of the p75 neurotrophin receptor by gamma-secretase. J Biol Chem. 2012 Dec 21;287(52):43810-24. E.M. Forbes et al (2012) Calcium and cAMP Levels Interact to Determine Attraction versus Repulsion in Axon Guidance. Neuron. 2012 May 10;74(3):490-503.
Storage:
Store lyophilized protein at 2-8°C. After reconstitution, store at 2-8°C short term. Store long-term at -20°C to -80°C. Avoid repeated freezing and thawing. See expiration date for shelf-life estimates, actual times may vary depending upon experimental conditions and laboratory handling.
Purification:
Greater than 90% (as determined by SDS electrophoresis)
Mouse NGF (2.5S) was isolated from mouse submaxillary glands by method of Mobley et al (1976) and is a form of beta-NGF that has identical biological properties. NGF is known to regulate the survival and development of certain sympathetic and sensory neurons. It is a dimer with 2 identical polypeptide chains and dimeric molecular weight of approximately 26,500 Da. Isolation and purification of NGF from mouse submaxillary glands yields preparations of NGF (2.5S) with identical biological activity but with cleavages at the amino terminus (with the loss of 8 amino acids) and/or at the carboxy-terminus (with the loss of arginine). These preparations are named 2.5 NGF (see reference below).
Background Info:
Nerve growth factor (NGF) is important for the development and maintenance of the sympathetic and sensory nervous systems. It stimulates division and differentiation of sympathetic and embryonic sensory neurons.
Product Type:
Protein
Format:
Lyophilized from PBS, pH 7.4 without preservatives.
Applications:
Cell Culture,ELISA,WB
Application Details:
Stimulates neurite outgrowth in rat PC12 cells
Alternative Names:
mouse NGF; beta NGF
Biological Activity:
Stimulates neurite outgrowth in rat PC12 cells
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt for lyophilized material. Reconstituted material, 5 days at 4C, 30 days -20°C, 60 days -70°C for highest activity Avoid repeated freezing and thawing. Use insulated storage containers for best results.
Use:
For research use only.
Product references:
Wang YN et al (2021) Slit3 secreted from M2-like macrophages increases sympathetic activity and thermogenesis in adipose tissue. Nat Metab. 3(11):1536-1551. Walters RR et al (2021) Pharmacokinetics and Immunogenicity of Frunevetmab in Osteoarthritic Cats Following Intravenous and Subcutaneous Administration. Front Vet Sci. 8:687448. Carter DR et al (2016) Glutathione biosynthesis is upregulated at the initiation of MYCN-driven neuroblastoma tumorigenesis. Mol Oncol. 2016 Jun;10(6):866-78. Goodhill GJ et al (2015) The dynamics of growth cone morphology. BMC Biol. 2015 Feb;13(10). Coulson EJ et al (2015) Neurotrophin-tyrosine kinase receptor signaling. United States Patent Application 20150344535. Gearing, DP et al (2013) A fully caninised anti-NGF monoclonal antibody for pain relief in dogs. BMC Vet Res. 9:226. Matusica D et al (2013) An intracellular domain fragment of the p75 neurotrophin receptor (p75(NTR)) enhances tropomyosin receptor kinase A (TrkA) receptor function. J Biol Chem. 2013 Apr 19;288(16):11144-54. Yuan J et al (2013) Optimality and saturation in axonal chemotaxis. Neural Comput. 2013 Apr;25(4):833-53. Sykes AM et al (2012) The effects of transmembrane sequence and dimerization on cleavage of the p75 neurotrophin receptor by gamma-secretase. J Biol Chem. 2012 Dec 21;287(52):43810-24. E.M. Forbes et al (2012) Calcium and cAMP Levels Interact to Determine Attraction versus Repulsion in Axon Guidance. Neuron. 2012 May 10;74(3):490-503.
Storage:
Store lyophilized protein at 2-8°C. After reconstitution, store at 2-8°C short term. Store long-term at -20°C to -80°C. Avoid repeated freezing and thawing. See expiration date for shelf-life estimates, actual times may vary depending upon experimental conditions and laboratory handling.
Purification:
Greater than 90% (as determined by SDS electrophoresis)
Mouse NGF (2.5S) was isolated from mouse submaxillary glands by method of Mobley et al (1976) and is a form of beta-NGF that has identical biological properties. NGF is known to regulate the survival and development of certain sympathetic and sensory neurons. It is a dimer with 2 identical polypeptide chains and dimeric molecular weight of approximately 26,500 Da. Isolation and purification of NGF from mouse submaxillary glands yields preparations of NGF (2.5S) with identical biological activity but with cleavages at the amino terminus (with the loss of 8 amino acids) and/or at the carboxy-terminus (with the loss of arginine). These preparations are named 2.5 NGF (see reference below).
Background Info:
Nerve growth factor (NGF) is important for the development and maintenance of the sympathetic and sensory nervous systems. It stimulates division and differentiation of sympathetic and embryonic sensory neurons.
Product Type:
Protein
Format:
Lyophilized from PBS, pH 7.4 without preservatives.
Applications:
Cell Culture,ELISA,WB
Application Details:
Stimulates neurite outgrowth in rat PC12 cells
Alternative Names:
mouse NGF; beta NGF
Biological Activity:
Stimulates neurite outgrowth in rat PC12 cells
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt for lyophilized material. Reconstituted material, 5 days at 4C, 30 days -20°C, 60 days -70°C for highest activity Avoid repeated freezing and thawing. Use insulated storage containers for best results.
Use:
For research use only.
Product references:
Wang YN et al (2021) Slit3 secreted from M2-like macrophages increases sympathetic activity and thermogenesis in adipose tissue. Nat Metab. 3(11):1536-1551. Walters RR et al (2021) Pharmacokinetics and Immunogenicity of Frunevetmab in Osteoarthritic Cats Following Intravenous and Subcutaneous Administration. Front Vet Sci. 8:687448. Carter DR et al (2016) Glutathione biosynthesis is upregulated at the initiation of MYCN-driven neuroblastoma tumorigenesis. Mol Oncol. 2016 Jun;10(6):866-78. Goodhill GJ et al (2015) The dynamics of growth cone morphology. BMC Biol. 2015 Feb;13(10). Coulson EJ et al (2015) Neurotrophin-tyrosine kinase receptor signaling. United States Patent Application 20150344535. Gearing, DP et al (2013) A fully caninised anti-NGF monoclonal antibody for pain relief in dogs. BMC Vet Res. 9:226. Matusica D et al (2013) An intracellular domain fragment of the p75 neurotrophin receptor (p75(NTR)) enhances tropomyosin receptor kinase A (TrkA) receptor function. J Biol Chem. 2013 Apr 19;288(16):11144-54. Yuan J et al (2013) Optimality and saturation in axonal chemotaxis. Neural Comput. 2013 Apr;25(4):833-53. Sykes AM et al (2012) The effects of transmembrane sequence and dimerization on cleavage of the p75 neurotrophin receptor by gamma-secretase. J Biol Chem. 2012 Dec 21;287(52):43810-24. E.M. Forbes et al (2012) Calcium and cAMP Levels Interact to Determine Attraction versus Repulsion in Axon Guidance. Neuron. 2012 May 10;74(3):490-503.
Storage:
Store lyophilized protein at 2-8°C. After reconstitution, store at 2-8°C short term. Store long-term at -20°C to -80°C. Avoid repeated freezing and thawing. See expiration date for shelf-life estimates, actual times may vary depending upon experimental conditions and laboratory handling.
Purification:
Greater than 90% (as determined by SDS electrophoresis)
Tyrosine Kinase Receptor B (TrkB)-Fc Chimera, Human, Purified Recombinant Protein, suitable for IP and to Block.
Background Info:
Tyrosine Kinase Receptor B (TrkB) is a high affinity receptor for brain-derived neurotrophic factor (BDNF) and neurotrophin-4/5. It also binds neurotrophin 3 (NT-3) with lower affinity. TrkB does not bind nerve growth factor (NGF). TrkB is involved in the development and/or maintenance of the nervous system and is widely expressed, predominantly in nervous tissue. TrkB is a heavily glycosylated type I transmembrane protein. The TrkB-Fc chimera contains 13 potential N-linked glycosylation sites.
Product Type:
Protein
Format:
The chimera consists of 20-40% carbohydrate by weight.
Applications:
Block,IP
Application Details:
The TrkB-Fc chimera bound to protein A sepharose beads is able to pull down its ligand BDNF. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Beros J et al. (2021) Age Related Response of Neonatal Rat Retinal Ganglion Cells to Reduced TrkB Signaling in vitro and in vivo. Front Cell Dev Biol. 9:671087. Application: Rat, Block. Beros J (2020) Pretreatment of ovaries with collagenase before vitrification keeps the ovarian reserve by maintaining cell-cell adhesion integrity in ovarian follicles. PhD Thesis. Application: Rat, Block.
Storage:
Lyophilized products should be stored at 2 to 8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE and visualized by silver stain.
Tyrosine Kinase Receptor B (TrkB)-Fc Chimera, Human, Purified Recombinant Protein, suitable for IP and to Block.
Background Info:
Tyrosine Kinase Receptor B (TrkB) is a high affinity receptor for brain-derived neurotrophic factor (BDNF) and neurotrophin-4/5. It also binds neurotrophin 3 (NT-3) with lower affinity. TrkB does not bind nerve growth factor (NGF). TrkB is involved in the development and/or maintenance of the nervous system and is widely expressed, predominantly in nervous tissue. TrkB is a heavily glycosylated type I transmembrane protein. The TrkB-Fc chimera contains 13 potential N-linked glycosylation sites.
Product Type:
Protein
Format:
The chimera consists of 20-40% carbohydrate by weight.
Applications:
Block,IP
Application Details:
The TrkB-Fc chimera bound to protein A sepharose beads is able to pull down its ligand BDNF. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Beros J et al. (2021) Age Related Response of Neonatal Rat Retinal Ganglion Cells to Reduced TrkB Signaling in vitro and in vivo. Front Cell Dev Biol. 9:671087. Application: Rat, Block. Beros J (2020) Pretreatment of ovaries with collagenase before vitrification keeps the ovarian reserve by maintaining cell-cell adhesion integrity in ovarian follicles. PhD Thesis. Application: Rat, Block.
Storage:
Lyophilized products should be stored at 2 to 8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE and visualized by silver stain.
Tyrosine Kinase Receptor B (TrkB)-Fc Chimera, Human, Purified Recombinant Protein, suitable to Block..
Background Info:
TrkC is a member of the tropomyosin-related kinase receptor family. TrkC is a membrane-bound receptor that upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. TrkC is the receptor for neurotrophin-3 (NT-3). Signalling through TrkC leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. TrkC is a heavily glycosylated molecule with 13 potential N-linked glycosylation sites within the extracellular domain.
Product Type:
Protein
Format:
The TrkC-Fc chimera consists of 15-55% carbohydrate by weight. When reconstituted in 0.5 mL sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 2-8°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE and visualized by silver stain.
Nerve growth factor (NGF) receptor, also known as p75NTR, is a low affinity NGF receptor. It binds with equal affinity neurotrophins such as beta NGF, BDNF, NT-3 and NT-4. NGF receptors mediate signaling of neurotrophins for neuronal survival, apoptosis, neurite outgrowth and synaptic plasticity. These receptors are also thought to play a role in neurogenerative diseases such as Alzheimers disease. The NGF receptor is a type I transmembrane glycoprotein (399 aa) consisting of a signal peptide (28 aa), an extracellular domain (222 aa) which contains four cysteine rich domains responsible for ligand binding, a transmembrane domain (22 aa) and a cytoplasmic domain (155 aa).
Product Type:
Protein
Format:
The NGF Receptor-Fc chimera consists of 25-45% carbohydrate by weight.
Lyophilized products should be stored at 2-8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE and visualized by silver stain
Nerve growth factor (NGF) is important for the development and maintenance of the sympathetic and sensory nervous systems. It stimulates division and differentiation of sympathetic and embryonic sensory neurons.
Product Type:
Protein
Format:
Lyophilized, When reconstituted in 0.5 mL sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Applications:
Cell Culture
Alternative Names:
Beta-nerve growth factor; beta-NGF; NGFB;
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
Lyophilized products should be stored at 2-8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE and visualized by silver stain
Nerve growth factor (NGF) is important for the development and maintenance of the sympathetic and sensory nervous systems. It stimulates division and differentiation of sympathetic and embryonic sensory neurons.
Product Type:
Protein
Format:
When reconstituted in 0.5 mL sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Applications:
Cell Culture
Alternative Names:
Beta-nerve growth factor; beta-NGF; NGFB;
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 2-8°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE and visualized by silver stain
Epidermal Growth Factor (EGF) Receptor binds to EGF and other members of the EGF family such as TGF-alpha, amphiregulin, betacellulin, heparin-binding EGF-like growth factor, GP30 and vaccinia virus growth factor. At least 4 isoforms are produced by alternative splicing (reference SWISSPROT). The EGF receptor is a single-pass type I membrane protein containing an extracellular receptor domain, a transmembrane region and an intracellular domain with tyrosine kinase function.
Product Type:
Protein
Format:
The EGF receptor-Fc chimera consists of 5-30% carbohydrate by weight. When reconstituted in 0.5 mL sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 2-8°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue
Hepatocyte growth factor (HGF) is a member of the plasminogen related growth factor family. The HGF protein is a dimer formed from an alpha and beta subunit linked by a disulfide bond. Both subunits originate from the endoproteolytic cleavage of a common precursor which is biologically inactive. HGF is expressed in Kupffer cella and sinusoidal endothelial cells in the liver and pancreas.
Product Type:
Protein
Format:
The HGF formulation consists of 0-30% carbohydrate by weight. When reconstituted in 0.5 mL sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 2-8°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE and visualised by Coomassie Brilliant Blue
Stem Cell Factor (SCF) is a hematopoietic growth factor that stimulates the proliferation of mast cells. SCF also mediates cell-cell adhesion and acts synergistically with other cytokines. The actions of SCF are exerted by binding to the SCF Receptor (PE-1243-50) which results in receptor dimerization. SCF is a type I membrane glycoprotein with 5 potential N-linked glycosylation sites. Soluble SCF is produced by proteolytic cleavage of the extracellular domain.
Product Type:
Protein
Format:
Purified SCF consists of 0-50% carbohydrate by weight.
Lyophilized products should be stored at 2-8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE and visualized by silver stain
Stem Cell Factor (SCF) is a hematopoietic growth factor that stimulates the proliferation of mast cells. SCF also mediates cell-cell adhesion and acts synergistically with other cytokines. The actions of SCF are exerted by binding to the SCF Receptor (PE-1243-50) which results in receptor dimerization. SCF is a type I membrane glycoprotein with 5 potential N-linked glycosylation sites. Soluble SCF is produced by proteolytic cleavage of the extracellular domain.
Product Type:
Protein
Format:
Purified SCF consists of 0-50% carbohydrate by weight. When reconstituted in 0.5 mL sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Lyophilized products should be stored at 2-8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE and visualized by silver stain
Stem Cell Factor Receptor (SCFR) is a member of the receptor tyrosine kinase family. Binding of SCFR to its ligand Stem Cell Factor (PE-1242-5) induces receptor dimerization, autophosphorylation and signal transduction. SCFR is essential for the development of normal hematopoietic cells and plays an important role in the survival, proliferation and differentiation of mast cells, melanocytes and germ cells.
Product Type:
Protein
Format:
Purified SCFR consists of approximately 15-45% carbohydrate by weight.
Lyophilized products should be stored at 2 to 8°C. Following reconstitution, short-term storage at 2-8°C and longer-term storage of aliquots at -18 to -20°C is recommended. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE, visualised by Coomassie Brilliant Blue
Stem Cell Factor Receptor (SCFR) is a member of the receptor tyrosine kinase family. Binding of SCFR to its ligand Stem Cell Factor (PE-1242-5) induces receptor dimerization, autophosphorylation and signal transduction. SCFR is essential for the development of normal hematopoietic cells and plays an important role in the survival, proliferation and differentiation of mast cells, melanocytes and germ cells.
Product Type:
Protein
Format:
Purified SCFR consists of approximately 15-45% carbohydrate by weight. When reconstituted in 0.5 mL sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Lyophilized products should be stored at 2 to 8°C. Following reconstitution, short-term storage at 2-8°C and longer-term storage of aliquots at -18 to -20°C is recommended. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE, visualised by Coomassie Brilliant Blue
Stem Cell Factor Receptor (SCFR) is a member of the receptor tyrosine kinase family. Binding of SCFR to its ligand Stem Cell Factor (PE-2008-5) induces receptor dimerization, autophosphorylation and signal transduction. SCFR is essential for the development of normal hematopoietic cells and plays an important role in the survival, proliferation and differentiation of mast cells, melanocytes and germ cells.
Product Type:
Protein
Format:
The SCFR-Fc Chimera consists of 5-45% carbohydrate by weight. When reconstituted in 0.5 mL sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 2-8°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE and visualized by silver stain
Noggin, Human, Purified Recombinant Protein, suitable for Cell Culture.
Background Info:
Noggin is a glycoprotein predominantly expressed by the dorsal mesoderm during embryogenesis and is secreted as a covalently linked homodimer. Noggin is essential for cartilage morphogenesis and joint formation. It is an inhibitor of bone morphogenic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite. Defects in Noggin are a cause of symphalangism proximal syndrome (SYM1), of multiple synostoses syndrome 1 (SYNS1), of the tarsal-carpal coalition syndrome (TCC), of stapes ankylosis with broad thumb and toes, and of brachydactyly type B2 (BDB2).
Product Type:
Protein
Format:
The Noggin product consists of 5-25% carbohydrate by weight. When reconstituted in 0.5 mL sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Applications:
Cell Culture
Alternative Names:
Nog;
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
Lyophilized products should be stored at 2-8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95% as determined by SDS-PAGE and visualized by silver stain.
Noggin, Human, Purified Recombinant Protein, suitable for Cell Culture.
Background Info:
Noggin is a glycoprotein predominantly expressed by the dorsal mesoderm during embryogenesis and is secreted as a covalently linked homodimer. Noggin is essential for cartilage morphogenesis and joint formation. It is an inhibitor of bone morphogenic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite. Defects in Noggin are a cause of symphalangism proximal syndrome (SYM1), of multiple synostoses syndrome 1 (SYNS1), of the tarsal-carpal coalition syndrome (TCC), of stapes ankylosis with broad thumb and toes, and of brachydactyly type B2 (BDB2).
Product Type:
Protein
Format:
The Noggin product consists of 5-25% carbohydrate by weight.
Applications:
Cell Culture
Alternative Names:
Nog;
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
Lyophilized products should be stored at 2-8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95% as determined by SDS-PAGE and visualized by silver stain.
Noggin, Human, Purified Recombinant Protein, suitable for Cell Culture.
Background Info:
Noggin is a glycoprotein predominantly expressed by the dorsal mesoderm during embryogenesis and is secreted as a covalently linked homodimer. Noggin is essential for cartilage morphogenesis and joint formation. It is an inhibitor of bone morphogenic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite. Defects in Noggin are a cause of symphalangism proximal syndrome (SYM1), of multiple synostoses syndrome 1 (SYNS1), of the tarsal-carpal coalition syndrome (TCC), of stapes ankylosis with broad thumb and toes, and of brachydactyly type B2 (BDB2).
Product Type:
Protein
Format:
The Noggin product consists of 5-25% carbohydrate by weight.
Applications:
Cell Culture
Alternative Names:
Nog;
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
Lyophilized products should be stored at 2-8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95% as determined by SDS-PAGE and visualized by silver stain.
L-selectin-Fc Chimera, Human, Purified Recombinant Protein, suitable to Block.
Background Info:
L-selection (CD26L) is a cell surface adhesion protein constitutively expressed on all classes of human leukocytes. The L-Selectin glycoprotein is composed of a C-type lectin family domain at the amino terminus, an EGF-like domain, two short consensus repeat (SCR) sequences, a transmembrane domain and a short cytoplasmic tail. L-Selectin contains 7 potential N- linked glycosylation sites.
Product Type:
Protein
Format:
The L-Selectin-Fc chimera consists of 20-45% carbohydrate by weight.
Lyophilized products should be stored at 2 to 8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE and visualized by silver stain
L-selectin-Fc Chimera, Human, Purified Recombinant Protein, suitable to Block.
Background Info:
L-selection (CD26L) is a cell surface adhesion protein constitutively expressed on all classes of human leukocytes. The L-Selectin glycoprotein is composed of a C-type lectin family domain at the amino terminus, an EGF-like domain, two short consensus repeat (SCR) sequences, a transmembrane domain and a short cytoplasmic tail. L-Selectin contains 7 potential N- linked glycosylation sites.
Product Type:
Protein
Format:
The L-Selectin-Fc chimera consists of 20-45% carbohydrate by weight.
Lyophilized products should be stored at 2 to 8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE and visualized by silver stain
L-selectin-Fc Chimera, Human, Purified Recombinant Protein, suitable to Block.
Background Info:
L-selection (CD26L) is a cell surface adhesion protein constitutively expressed on all classes of human leukocytes. The L-Selectin glycoprotein is composed of a C-type lectin family domain at the amino terminus, an EGF-like domain, two short consensus repeat (SCR) sequences, a transmembrane domain and a short cytoplasmic tail. L-Selectin contains 7 potential N- linked glycosylation sites.
Product Type:
Protein
Format:
The L-Selectin-Fc chimera consists of 20-45% carbohydrate by weight. When reconstituted in 0.5 mL sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Lyophilized products should be stored at 2 to 8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Purification:
>95%, as determined by SDS-PAGE and visualized by silver stain
Tyrosine Kinase Receptor A (TrkA)-Fc Chimera, Purified Recombinant Protein, suitable to Block.
Background Info:
TrkA is a member of the neurotrophic tyrosine kinase receptor family. It is a membrane-bound receptor that upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. TrkA is required for high-affinity binding to nerve growth factor (NGF), neurotrophin-3 and neurotrophin-4/5 but not brain-derived neurotrophic factor (BDNF). TrkA leads to cell differentiations and may play a role in specifying sensory neuron subtypes. It has a crucial role in the development and function of the nociceptive reception system as well as establishment of thermal regulation via sweating. SUBUNIT: Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. SUBCELLULAR LOCATION: TrkA is a heavily glycosylated transmembrane protein and contains 13 potential N-linked glycosylation sites. The TrkA-Fc chimera has N-linked and may have O-linked oligosaccharides.
Lyophilized products should be stored at 2 to 8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Tyrosine Kinase Receptor A (TrkA)-Fc Chimera, Purified Recombinant Protein, suitable to Block.
Background Info:
TrkA is a member of the neurotrophic tyrosine kinase receptor family. It is a membrane-bound receptor that upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. TrkA is required for high-affinity binding to nerve growth factor (NGF), neurotrophin-3 and neurotrophin-4/5 but not brain-derived neurotrophic factor (BDNF). TrkA leads to cell differentiations and may play a role in specifying sensory neuron subtypes. It has a crucial role in the development and function of the nociceptive reception system as well as establishment of thermal regulation via sweating. SUBUNIT: Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. SUBCELLULAR LOCATION: TrkA is a heavily glycosylated transmembrane protein and contains 13 potential N-linked glycosylation sites. The TrkA-Fc chimera has N-linked and may have O-linked oligosaccharides.
Lyophilized product should be stored at 2 to 8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
This peptide may be used to block binding activity of antibody to TrkB (# R-121-100).
Product Type:
Peptide
Format:
Lyophilized
Applications:
Block
Application Details:
Control peptide. This peptide may be used to block binding activity of antibody to TrkB (# R-121-100). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
This peptide may be used to block binding activity of antibody to Parkin (# R-113-100).
Product Type:
Peptide
Format:
Lyophilized
Applications:
Block
Application Details:
Control peptide. This peptide may be used to block binding activity of antibody to Parkin (# R-113-100). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Ubiquitin E3 ligase PRKN; Parkinson juvenile disease protein 2; Parkinson disease protein 2; PARK2; PRKN
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
After reconstitution keep at -20°C. Avoid repetitive freeze/thaw cycles.
Alpha synuclein control peptide (116-131), Purified Peptide, suitable to Block.
Background Info:
<span itemprop="description">Alpha synuclein is an abundant 140 amino acid neuronal protein, expressed primarily at presynaptic terminals in the central nervous system. Alpha synuclein has been associated with several neurodegenerative diseases. A point mutation in the gene coding for the alpha-synuclein protein was the first discovery linking this protein to a rare familial form of Parkinson's disease (PD). Subsequently, other mutations in the alpha-synuclein gene have been identified in familial PD. The aggregated proteinaceous inclusions called Lewy bodies found in PD and cortical Lewy body dementia (LBD) were discovered to be predominantly alpha-synuclein. Aberrant aggregation of alpha-synuclein has been detected in an increasing number of neurodegenerative diseases, collectively known as synucleopathies. Alpha-synuclein exists physiologically in both soluble and membrane-bound states, in unstructured and alpha-helical conformations, respectively. The physiological function of alpha-synuclein appears to require its translocation between these subcellular compartments and interconversion between the 2 conformations. Abnormal processing of alpha-synuclein is predicted to lead to pathological changes in its binding properties and function.</span>
Product Type:
Peptide
Format:
Lyophilized
Applications:
Block
Application Details:
Control Peptide. This peptide may be used to block the binding activity of antibodies to alpha synuclein ( see Biosensis antibodies S-024-100 and S-075-50).
Alternative Names:
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
After reconstitution keep at -20°C. Avoid repetitive freeze/thaw cycles.
Leucine-rich repeat serine/threonine-protein kinase 2 (LRRK2-IN-1), Purified Small Molecule, suitable to Block.
Background Info:
Leucine-Rich Repeat Kinase 2 (LRRK2) is a member of the leucine-rich repeat kinase family. Mutations in the LRRK2 gene have been linked with late-onset autosomal dominant Parkinson's disease (PD). A recent screening identified the analog LRRK2-IN-1 as a potent and selective inhibitor of LRRK2. This research by Deng et al (2011, Nat Chem Biol) showed that LRRK2-IN-1 suppressed LRRK2 kinase activity in vivo leading to dephosphorylation of Ser910/Ser935, loss of 14-3-3 binding and accumulation of LRRK2 within aggregrate fibrillar structures. LRRK2-IN-1, is the first selective and potent inhibitor of LRRK2. LRRK2-IN-1 inhibits both wild-type and G2019S mutant LRRK2 kinase activity with IC50 values of 13nM and 6nM respectively (Deng et al 2011, Nat Chem Biol).
Product Type:
Small Molecule
Format:
Dry, Synthetic chemical powder
Applications:
Block
Application Details:
Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Deng X. et al (2011) Characterization of a selective inhibitor of the Parkinson's disease kinase LRRK2 Nat Chem Biol. 2011 Apr;7(4):203-5.
Storage:
Store dry, unopened vial protected from light for up to 3 months at RT or at -70ºC for up to 1 year. Reconstitute product in 100% ACS grade DMSO and store at -80ºC, in aliquots, protected from light, for up to 1 month. Prevent multiple freeze-thaw cycles. CAS Number 1234480-84-2.
Leucine-rich repeat serine/threonine-protein kinase 2 (LRRK2-IN-1), Purified Small Molecule, suitable to Block.
Background Info:
Leucine-Rich Repeat Kinase 2 (LRRK2) is a member of the leucine-rich repeat kinase family. Mutations in the LRRK2 gene have been linked with late-onset autosomal dominant Parkinson's disease (PD). A recent screening identified the analog LRRK2-IN-1 as a potent and selective inhibitor of LRRK2. This research by Deng et al (2011, Nat Chem Biol) showed that LRRK2-IN-1 suppressed LRRK2 kinase activity in vivo leading to dephosphorylation of Ser910/Ser935, loss of 14-3-3 binding and accumulation of LRRK2 within aggregrate fibrillar structures. LRRK2-IN-1, is the first selective and potent inhibitor of LRRK2. LRRK2-IN-1 inhibits both wild-type and G2019S mutant LRRK2 kinase activity with IC50 values of 13nM and 6nM respectively (Deng et al 2011, Nat Chem Biol).</div>
Product Type:
Small Molecule
Format:
Dry, Synthetic chemical powder
Applications:
Block
Application Details:
Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Deng X. et al (2011) Characterization of a selective inhibitor of the Parkinson's disease kinase LRRK2 Nat Chem Biol. 2011 Apr;7(4):203-5.
Storage:
Store dry, unopened vial protected from light for up to 3 months at RT or at -70ºC for up to 1 year. Reconstitute product in 100% ACS grade DMSO and store at -80ºC, in aliquots, protected from light, for up to 1 month. Prevent multiple freeze-thaw cycles. CAS Number 1234480-84-2.
Leucine-rich repeat serine/threonine-protein kinase 2 (LRRK2-IN-1), Purified Small Molecule, suitable to Block.
Background Info:
Leucine-Rich Repeat Kinase 2 (LRRK2) is a member of the leucine-rich repeat kinase family. Mutations in the LRRK2 gene have been linked with late-onset autosomal dominant Parkinson's disease (PD). A recent screening identified the analog LRRK2-IN-1 as a potent and selective inhibitor of LRRK2. This research by Deng et al (2011, Nat Chem Biol) showed that LRRK2-IN-1 suppressed LRRK2 kinase activity in vivo leading to dephosphorylation of Ser910/Ser935, loss of 14-3-3 binding and accumulation of LRRK2 within aggregrate fibrillar structures. LRRK2-IN-1, is the first selective and potent inhibitor of LRRK2. LRRK2-IN-1 inhibits both wild-type and G2019S mutant LRRK2 kinase activity with IC50 values of 13nM and 6nM respectively (Deng et al 2011, Nat Chem Biol).
Product Type:
Small Molecule
Format:
Dry, Synthetic chemical powder
Applications:
Block
Application Details:
Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Deng X. et al (2011) Characterization of a selective inhibitor of the Parkinson's disease kinase LRRK2 Nat Chem Biol. 2011 Apr;7(4):203-5.
Storage:
Store dry, unopened vial protected from light for up to 3 months at RT or at -70ºC for up to 1 year. Reconstitute product in 100% ACS grade DMSO and store at -80ºC, in aliquots, protected from light, for up to 1 month. Prevent multiple freeze-thaw cycles. CAS Number 1234480-84-2.
Nerve growth factor (NGF) receptor, also known as p75NTR, is a low affinity NGF receptor. It binds with equal affinity all members of the neurotrophin family including beta NGF, BDNF, NT-3 and NT-4/5. It also binds the pro-neurotrophins. NGF receptors mediate signaling of neurotrophins for neuronal survival, apoptosis, neurite outgrowth and synaptic plasticity. These receptors are also thought to play a role in neurogenerative diseases such as Alzheimers disease. The p75NTR NGF receptor is a type I transmembrane glycoprotein (396 aa) consisting of a signal peptide (21 aa), an extracellular domain (225 aa) which contains four cysteine rich domains responsible for ligand binding, a transmembrane domain (19 aa) and a cytoplasmic domain (152 aa). It is a member of the TNF-alpha receptor family (TNR16). Recently, p75NTR has been shown to act as a receptor for many pathogens such as prions, rabies virus and amyloid beta. It also acts as a co-receptor for NOGO, mediating inhibitory signals of myelin associated protein.
Lyophilized products should be stored at 2-8°C. Following reconstitution, short-term storage at 2-8°C is recommended and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Synthetic beta-amyloid A? 1-42 was monomerized by HFIP (hexafluoro-2-propanol) treatment and dried. One vial contains 50 ?g monomeric A? peptide that can be used to form solutions of unaggregated A? monomers, aggregated A? oligomers, A? fibrils and A? protein complexes according to published protocols, and used in a variety of research applications.
Product Type:
Peptide
Format:
Lyophilized.
Applications:
ELISA
Application Details:
<i>Preparation of unaggregated A-beta<sub>1-42</sub></i>:<br><br><b>Important:</b> unaggregated A-beta has to be prepared just prior to use!<br><br>1. Add 5 µL of reconstituting buffer to one vial of 50 µg of HFIP-treated A-beta peptide; spin down the liquid briefly<br>2. Vortex the vial for 5 seconds at highest speed while rotating the vial with your hands; spin down the liquid (bench-top microcentrifuge) and repeat the vortex-spin procedure for a minimum of 3 times; continue the vortex-spin procedure until all lyophilized peptide is dissolved and collected at the bottom of the tube. <b>Important</b>: refer to the attached <a class="newA" target="_blank" href="https://www.biosensis.com/documents/enhancedinfo/PE-1749-50_Peptide Reconstitution Instructions.pdf">instructions</a> for a detailed procedure to ensure that all peptide is fully reconstituted!<br>3. Add 106 µL of cold Dilution Buffer to make up to 111 µL total volume and a peptide concentration of 100 µM. Vortex-spin for 3 more times<br> 4. Final concentration of A-beta is 450 µg/mL<br>5. Use reconstituted peptide <b>immediately</b> to avoid oligomer formation<br><br><i>Preparation of oligomeric A-beta<sub>1-42</sub></i>:<br><br>1. Add 5 µL of reconstituting buffer to one vial of 50 µg of HFIP-treated A-beta peptide; spin down the liquid briefly<br>2. Vortex the vial for 5 seconds at highest speed while rotating the vial with your hands; spin down the liquid (bench-top microcentrifuge) and repeat the vortex-spin procedure for a minimum of 3 times; continue the vortex-spin procedure until all lyophilized peptide is dissolved and collected at the bottom of the tube. <b>Important</b>: refer to the attached <a class="newA" target="_blank" href="https://www.biosensis.com/documents/enhancedinfo/PE-1749-50_Peptide Reconstitution Instructions.pdf">instructions</a> for a detailed procedure to ensure that all peptide is fully reconstituted!<br>3. Add 106 µL of cold Dilution Buffer to make up to 111 µL total volume and a peptide concentration of 100 µM<br>4. Vortex-spin for 3 more times<br>5. Incubate the solution at 2-8ºC for 24 hours (protected from light)<br>6. Final concentration of A-beta is 450 µg/mL<br>7. Once reconstituted and oligomerized, o-A-beta should be used as soon as possible and within 7 days to ensure the stability of the oligomers<br><br><b>Note:</b> while the concentration of monomeric A-beta peptide used to form the oligomeric complexes is accurately determined, the precise formation, size and number of oligomers cannot be quantified by any known method.<br><br><i>Preparation of fibrillar A-beta<sub>1-42</sub></i>:<br><br>1. Add 5 µL of reconstituting buffer to one vial of 50 µg of HFIP-treated A-beta peptide; spin down the liquid briefly<br>2. Vortex the vial for 5 seconds at highest speed while rotating the vial with your hands; spin down the liquid (bench-top microcentrifuge) and repeat the vortex-spin procedure for a minimum of 3 times; continue the vortex-spin procedure until all lyophilized peptide is dissolved and collected at the bottom of the tube. <b>Important:</b> refer to the attached <a class="newA" target="_blank" href="https://www.biosensis.com/documents/enhancedinfo/PE-1749-50_Peptide Reconstitution Instructions.pdf">instructions</a> for a detailed procedure to ensure that all peptide is fully reconstituted!<br>3. Add 106 µL of 10 mM HCl to make up to 111 µL total volume and a peptide concentration of 100 µM<br>4. Vortex-spin for 3 more times<br> 5. Incubate the solution at 37ºC for 24 hours (protected from light)<br>6. Final concentration of A-beta is 450 µg/mL<br><br><i>Preparation of A-beta<sub>1-42</sub> Complexes</i>:<br><br><b>Important:</b> only unagreggated A-beta will form complexes. Use A-beta peptide immediately after reconstitution to form complexes.<br><br>1. Add 5 µL of reconstituting buffer to one vial of 50 µg of HFIP-treated A-beta peptide; spin down the liquid briefly<br>2. Vortex the vial for 5 seconds at highest speed while rotating the vial with your hands; spin down the liquid (bench-top microcentrifuge) and repeat the vortex-spin procedure for a minimum of 3 times; continue the vortex-spin procedure until all lyophilized peptide is dissolved and collected at the bottom of the tube. <b>Important:</b> refer to the attached <a class="newA" target="_blank" href="https://www.biosensis.com/documents/enhancedinfo/PE-1749-50_Peptide Reconstitution Instructions.pdf">instructions</a> for a detailed procedure to ensure that all peptide is fully reconstituted!<br>3. Add 106 µL of cold Dilution Buffer to make up to 111 µL total volume and a peptide concentration of 100 µM<br> 4. Vortex-spin for 3 more times<br> 5. Use reconstituted peptide <b>immediately</b> to avoid oligomer formation<br>6. Mix the A-beta monomer with its complex partner (eg., lipoprotein) at desired concentrations in PBS, pH 7.4, or other suitable buffers compatible with its intended application<br>7. Incubate at room temperature for 2 hours without shaking<br>8. Use complexes immediately after incubation<br><br>These protocols are based on procedures published by <a class="newA" target="_blank" href="https://www.ncbi.nlm.nih.gov/pubmed/22423893">Youmans KL <i>et al.</i>, 2012</a> and <a class="newA" target="_blank" href="https://www.ncbi.nlm.nih.gov/pubmed/23293020">Tai LM <i>et al.</i>, 2013</a>, and we refer to these publications and other relevant literature for further details.<br><br>Provided working concentrations are only meant to guide the user. Optimal concentrations depend on the experimental design and need to be determined empirically.
A proprietary preparation of human amyloid beta peptide (amino acids 1-42) that was initially monomerized by HFIP-treatment and then allowed to form oligomers by the procedure described in Youmans KL et al. , 2012 , followed by lyophilisation using Biosensis' proprietary stabilization procedures. The resulting oligomeric mixture has been specially designed to allow the formation of stable, oligomeric A? 1-42 peptide, multimeric complexes or oligomers. The material is intended to be used as a stable and consistent standard or positive control for oligomeric ELISA assays, as well as other research applications.
Product Type:
Peptide
Format:
Lyophilized, Supplied as 2 x 500 ng vials, each containing lyophilized A? oligomers</b>. Note that the amount of provided oligomeric protein is based on the amount of monomeric A? used to form these oligomers. The precise formation, size and number of oligomers cannot be quantified by any known method.
Applications:
ELISA
Application Details:
<i>Use as positive control in Oligomeric A? ELISA Kit (BEK-2215)</i>: Reconstitute one vial with 1 mL of assay buffer provided in the ELISA kit. Dilute to a concentration of 0.5-1 ng/mL. At this concentration, a positive signal will be obtained within the dynamic range of the calibration curve.<br><br><i>Use as oligomeric A-beta peptide standard in Oligomeric A? ELISA Kit (BEK-2215)</i>: Reconstitute one vial with 1 mL of assay buffer provided in the ELISA kit. Dilute to a concentration of 2 ng/mL, which represents the highest concentration of the calibration curve. Perform a 1:2 serial dilution down to 0.031 ng/mL in assay buffer. Click <a class="newA" target="_blank" href="https://www.biosensis.com/documents/enhancedinfo/PE-1750-1000_Instructions for Generating a Calibration Curve.pdf"> here </a> for detailed instructions on generating a calibration curve with PE-1750-1000.<br><br><i>Use as positive control in other applications</i>: Optimal concentrations need to be determined empirically. It is recommended to reconstitute the vial with 100 - 200 µL buffer first (eg., PBS, pH 7.4), and prepare further working dilutions thereof.
Store unopened, lyophilized oligomeric A? with desiccant, insulated, at -20°C short term, -80°C long term. Store reconstituted vial at 2-8°C for up to 2 days. The reconstituted material should not be frozen for best results.
This peptide may be used to block binding activity of antibody to ChAT (# R-043-100 and # R-1621-100).
Product Type:
Peptide
Format:
Lyophilized.
Applications:
Block
Application Details:
Control peptide. This peptide may be used to block binding activity of antibody to ChAT (# R-043-100 and # R-1621-100). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Store lyophilized peptide dry at -20°C to -80°C. Store reconstituted peptide at 2-8°C for maximum of 2 days to avoid degradation. Aliquot the reconstituted peptide and store at -20°C to -80°C; avoid repetitive freeze-thaw cycles.
PE-1831 is A1 beta casein protein that is in its native form and purified from bovine A1/A1 commercial cow's milk collected from cows that are certified BSE and disease free by the manufacture of the milk. IMPORTANT: This product may give different OD readings as compared to the protein calibrator contained in our A1 Casein ELISA Kit due to its formulation. Thus it is NOT recommended for use as a standard or QC marker in the A1 ELISA assays.
Background Info:
The protein named Casein is the largest group of proteins in mammalian milk, making up about > 80% of total protein content. Different mammals have different amounts of caseins in their milks and not all casein proteins are the same.<br><br>According to published literature, (PMID: 15453478), multiple forms of casein proteins exist in cow's milk, with beta-casein being one of the most predominant forms. Beta casein in domestic cows at lesat, has two alleles or isoforms. Beta A1 and Beta A2.<br><br>A1 beta-casein is found in milk from breeds of cows that originated in northern Europe. These breeds include Holstein, Friesian, Ayrshire, and British Shorthorn.<br><br>A2 beta-casein. is found in milk breeds that originated in the Channel Islands US and southern France. These include Guernsey, Jersey, Charolais, and Limousin cows (PMID: 15867940, PMID: 15453478).<br><br>Traditionally, store bought regular milk contains both A1 and A2 beta-casein proteins, but pure A2 milk can be obtained that originates only from A2 cows.<br><br>Some studies suggest that there could be some sort of a link between the A1 beta-casein and immunological dieseases such as type-1 diabetes and others and work is underway to understand how beta casein, both A1 and A2 may or may not contribute to human illness as well a health.
Product Type:
Protein
Format:
Liquid. Protein is provided as 50 µL aliquot at 0.4 mg/mL in TBS, pH 8.5, containing protease inhibitor. Does not contain preservatives. Use sterile methods when handling.
Applications:
WB
Application Details:
Western blotting (100 ng or less) as a standard, not recommended for ELISA. Other applications not yet tested.
Alternative Names:
Beta Casein; CSN2
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
Protein is shipped on ice packs. Upon receipt, divide into aliquots and store product long-term at -20°C. Store working aliquots short-term at 2-8°C as undiluted liquid for one week. AVOID MULTIPLE FREEZE THAWS
Purification:
The product is >95% A1 beta casein based on SDS-PAGE gel. Affinity-purified, native protein
PE-1832 is A2 beta casein protein that is purified in its native form from bovine A2/A2 milk to >95% purity. The milk is collected from commercial cows certified free of disease and BSE by the manufacture of the milk. IMPORTANT: This product may give different OD readings as compared to the protein calibrator contained in our A2 Casein ELISA Kit due to its formulation. Thus it is NOT recommended for use as a standard or QC marker in the A2 ELISA assays.
Background Info:
The protein named Casein is the largest group of proteins in mammalian milk, making up about > 80% of total protein content. Different mammals have different amounts of caseins in their milks and not all casein proteins are the same.<br><br>According to published literature, (PMID: 15453478), multiple forms of casein proteins exist in cow's milk, with beta-casein being one of the most predominant forms. Beta casein in domestic cows at lesat, has two alleles or isoforms. Beta A1 and Beta A2.<br><br>A1 beta-casein is found in milk from breeds of cows that originated in northern Europe. These breeds include Holstein, Friesian, Ayrshire, and British Shorthorn.<br><br>A2 beta-casein. is found in milk breeds that originated in the Channel Islands US and southern France. These include Guernsey, Jersey, Charolais, and Limousin cows (PMID: 15867940, PMID: 15453478).<br><br>Traditionally, store bought regular milk contains both A1 and A2 beta-casein proteins, but pure A2 milk can be obtained that originates only from A2 cows.<br><br>Some studies suggest that there could be some sort of a link between the A1 beta-casein and immunological dieseases such as type-1 diabetes and others and work is underway to understand how beta casein, both A1 and A2 may or may not contribute to human illness as well a health.
Product Type:
Protein
Format:
Liquid. Protein is provided as 50 µL aliquot at 0.4 mg/mL in TBS, pH 8.5, containing protease inhibitor. Does not contain preservatives. Use sterile methods when handling.
Applications:
WB
Application Details:
Western blotting (100 ng or less) as a standard, not recommended for ELISA. Other applications not yet tested.
Alternative Names:
Beta Casein; CSN2
Biosensis Brand:
Biosensis®
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
Protein is shipped on ice packs. Upon receipt, divide into aliquots and store product long-term at -20°C. Store working aliquots short-term at 2-8°C as undiluted liquid for one week. AVOID MULTIPLE FREEZE THAWS
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Pig Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Pig Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
The antibody reacts with rat Interferon gamma (IFN-gamma) of both natural and recombinant origin. IFN-gamma is a pluripotent cytokine with important pro-inflammatory functions. The antibody inhibits the biological activity of natural and recombinant rat IFN-gamma. The antigen specificity was further assessed by ELISA and Western blotting. No cross-reactivities with other cytokines have been detected.
The antibody reacts with human natural and recombinant TNF-alpha as assessed by ELISA. The antibody inhibits the biological activity of human natural and recombinant TNF-alpha as determined with L929 and WEHI cells in a cytotoxicity assay. The antibody cross reacts with rhesus and cynomolgus natural TNF-alpha and lacks cross reactivity with human lymphotoxin.
The antibody reacts with natural and recombinant mouse interleukin 6 (IL-6) as assessed by ELISA. The antibody inhibits the biological activity of natural and recombinant mouse IL-6 as determined with the B9 cell bio-assay. The antibody cross-reacts with natural rat IL-6. IL-6 is a pluripotent 20-22 kDa cytokine which plays a role in the pathophysiology of severe infection and regulates the immune response, acute phase reaction and hematopoiesis. IL-6 plays a critical role in B-cell differentiation to plasma cells and is a potent growth factor for plasmacytoma and myeloma. Continuous IL-6 gene expression makes an essential contribution to a multistep oncogenesis of plasma cell neoplasia. IL-6 is a very useful culture supplement for the generation of a high number of antibody-producing hybridomas.
The antibody reacts with human Interleukin-10 (IL-10) of both natural and recombinant origin. IL-10 is a pluripotent cytokine with important immunosuppressive actions: it can inhibit cytokines involved in the Th1 response such as IL-2, Interferon gamma and also inhibits the production of pro-inflammatory cytokines such as IL-1, IL-6, IL-8 and TNF-alpha. The antibody inhibits the biological activity of natural and recombinant human IL-10. The antigen specificity was further assessed by ELISA. No cross reactivities with other cytokines have been detected.
The antibody reacts with the Lectin Domain of E-selectin, CD62-e, formerly designated Endothelial Leucocyte Adhesion Molecule-1 (ELAM-1). The antibody reacts with human endothelial cells activated with TNF, IL-1 or endotoxin. The antibody was found to react also with cells transfected with the ELAM-1 gene. The antibody inhibits the adhesion of granulocytes both neutrophilic and eosinophilic.
The antibody reacts with both intact human ICAM-1, CD54 and with soluble human ICAM-1. The antibody reacts also with ICAM-1 present on chimpanzee, rhesus monkey, cynomolgus monkey and baboon tissues.
The antibody reacts with human gamma IFN (IFN-gamma) of both natural and recombinant origin. IFN-gamma is a pluripotent cytokine with important pro-inflammatory functions. The antibody inhibits the biological activity of natural and recombinant human IFN-gamma. The antigen specificity was further assessed by ELISA and Western blot. No cross reactivities with other cytokines have been detected.
The polyclonal antibody recognizes human intestinal fatty acid binding protein (I-FABP) of both natural and recombinant origin. The I-FABP protein is derived from the human FABP2 gene. FABPs are small intracellular proteins (~13-14 kDa) with a high degree of tissue specificity that bind long chain fatty acids. They are abundantly present in various cell types and play an important role in the intracellular utilization of fatty acids, transport and metabolism. There are at least nine distinct types of FABP, each showing a specific pattern of tissue expression. Due to its small size, FABP leaks rapidly out of ischemically damaged necrotic cells leading to a rise in serum levels. Ischemically damaged tissues are characterized histologically by absence (or low presence) of FABP facilitating recognition of such areas. I-FABP is localized in the small bowel epithelium, with highest expression level in the jejunum.
The antibody reacts with secretory leukocyte proteinase inhibitor (SLPI; also known as antileukoprotease (ALP)). SLPI is a 11.7 kDa cationic inhibitor of neutrophil elastase and to a lesser extent of cathepsin G. It is locally produced by epithelial cells in the lung, skin and other organs, by Polymorphonuclear leukocytes (PMN) and (in mice) by macrophages. In addition to its proteinase inhibitory properties that may serve to protect against proteolytic injury, it was recently shown that SLPI also displays several other functions such as antimicrobial and anti-inflammatory activities. These appear to be independent of its ability to inhibit PMN serine proteinases. SLPI has also been demonstrated to display antibacterial and antifungal activity at concentrations in which SLPI is present in mucosal secretions including those of the lung. Another possible role for SLPI is inhibition of protein-disulphide isomerase that is considered essential for invasion of a cell by the Human Immunodeficiency Virus (HIV).
Kinesin belongs to the group of microtubule-associated motor proteins known to convert chemical energy released from nucleoside triphosphates (preferentially from ATP) into mechanical energy. Conventional kinesin, member of the kinesin superfamily comprising more than 100 proteins, is involved in the anterograde vesicle transport in neuronal cells. Kinesin purified from mammalian brain homogenates is a heterotetramer consisting of two heavy (120 to 130 kDa) and two light chains (60 to 70 kDa), resulting in a molecular mass about 400 kDa. Each heavy chain contains an N-terminal globular motordomain with both a microtubule-binding site and an ATPase active center, stalk region responsible for heavy chain dimerization and finally C-terminal globular tail domain, which is implicated in cargo binding. Light chains may have a regulatory function.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
The ZAP70 (zeta-associated protein of 70 kDa) tyrosine kinase was identified as a tyrosine phosphoprotein that associates with TCR zeta subunit and undergoes tyrosine phosphorylation following TCR stimulation. ZAP70 is a Syk family tyrosine kinase primarily expressed in T and NK cells that plays an essential role in signaling through the TCR. TCR-mediated activation of T cells is crucial to the immune response. In humans, ZAP70 gene mutations resulting in lower ZAP70 protein expression levels or expression of catalytically inactive ZAP70 proteins, have been identified. ZAP70 deficiency results in the absence of mature CD8+ T cells and the prevention of TCR-mediated activation of CD4+ T cells, and it can lead to severe combined immunodeficiency.In patients with chronic lymphocytic leukemia (B-CLL), ZAP70 expression on B cell was shown to be correlated with disease progression and survival. ZAP70 contains two N-terminal SH2 domains (Src homology domain 2) and a C-terminal kinase domain. During T cell activation, the binding of ZAP70 SH2 domains to the phosphorylated zeta subunit on the activated TCR complex causes a colocalization with the Lck tyrosine kinase that phosphorylates ZAP70 on Tyr493 in the activation loop. ZAP70 autophosphorylates multiple tyrosines in the region between the SH2 domains and the kinase domain, including the binding sites for additional SH2-containing signaling proteins such as SLP76, LAT, Lck, PLCgamma1, Vav, Shc, Ras-GAP, and Abl. ZAP70-mediated activation of these downstream effectors leads to the release of intracellular calcium stores, and the transcription of interleukin-2 and other genes important for an immune response.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
The antibody reacts specificly with human Interleukin (IL-1)RII. The IL-1 system includes two agonists (IL-1alpha and IL-1beta), converting enzymes, antagonists, two receptors (IL-1RI and IL-1RII) and the IL-1 receptor accessory protein. The IL-1RII is part of the antagonistic IL-1 mechanism. It is also known as decoy receptor and is a non signalling molecule which functions by capturing IL-1 and preventing it from interacting with the signalling IL-1RI. The decoy IL-1RII can after binding to IL-1 also recruit the IL-1 receptor accessory protein and thus inhibit by coreceptor competition. Further a soluble form of IL-1RII exists which is shed, a process in which matrix metalloproteases have been found to play a role, by various cells including monocytes, polymorphonuclear cells, B cells and fibroblasts.
Antibody Isotype:
Ig
Monosan Range:
MONOSAN
Concentration:
100 ug/ ml
Storage buffer:
PBS with 0.1% BSA and 0.02% sodium azide
Storage:
2-8°C
References 1:
Mantovani; A et al. Ann N Y Acad Sci 1998; 840: 338
Desmin is a 53 kDa intermediate filament protein and exhibits a high degree of tissue specificity, its expression being predominantly confined to all types of muscle cells (cardiac, skeletal and smooth muscle). Regulation of desmin expression is stage and tissue-specific, since it is induced during terminal development and muscle cell differentiation. In skeletal en cardiac muscle cells desmin is localized in the Z-disk region and at the intercalated disk. The expression pattern of desmin in smooth muscle is much more heterogenous. Coexpression of desmin and vimentin has been observed in tumors derived from muscle tissue, i.e. rhabdomyosarcomas and leiomyosarcomas. Furthermore, during myocard dysfunction dramatic changes in the distribution of desmin have been observed. RCK106 reacts exclusively with Cytokeratin 18 in glandular epithelial cells of the digestive, respiRatory, and urogenital tracts, endocrine and exocrine cells and mesothelial cells, as well as adenocarcinomas originating from them.
The antibody is directed against the 56 kDa GFAP protein (Glial Fibrillary Acidic Protein, Glial Filament Protein), the main subunit of intermediate filaments of glial cells and astrocytes. The antibody can be used to discriminate glial tumors (astrocytomas, ependy-monas) from other tumors, as meningiomas, neuro-blastomas, chordomas, chondrosarcomas, lym-phomas and carcinomas. Positive control: Brain tissue.
The antiserum reacts positively with all stratified squamous epithelia and epidermal appendages such as hairfollicles, sebaceous glands. Also positive on epithelia of the urinary tract, stomach, intestine, uterine endometrium and prostate. Identifies mesotheliomas, squamous cell carcinomas, adenocarcinomas, transitional cell carcinomas and anaplastic carcinomas. Recommended for positive control: Squamous cell carcinoma, skin, cervix.
Antibody Isotype:
IgG
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Contains 0.01% sodium azide
Storage:
2-8°C
References 1:
Ramaekers F et al. A Pathol Anat Histopathol 1985;408:127-142
The polyclonal antibody reacts with human natural and recombinant Interleukin-8 (IL-8) as assessed by ELISA. The antibody inhibits the biological activity of human native and recombinant IL-8. The antibody cross reacts with rhesus and cynomolgus natural IL-8.
Laminin is a glycoprotein (Mr 850 - 1.000 kD, consisting of 3 glycosylated polypeptide chains with molecular weights of 440 and 225 (2x) kD) produced by various human epithelial and mesenchymal cells, and forms an extracellular matrix of thin filaments. In normal tissues, laminin is invariably present in all basal laminas surrounding muscle, nerve, fat and decidua cells and separates epithelial and endothelial cells from abutting connective tissues. Laminin has also been identified within the cytoplasm of breast epithelia, stromal cells of the endometrium, and within endothelial, bile duct epithelial and mesenchymal cells of the liver. Laminin has been found to be involved in cellular activities such as adhesion, spreading, differentiation, polarization, proliferation, locomotion, tissue invasion and chemotactic responses. <br />No cross reaction was obtained with human type I, III, IV and V collagen in immunoblotting, whereas the antibody reacted with a distinct band of appr. 200-220 kD from a 8M Urea extract from amnion basement membrane. Positive control: skin, kidney.
Tumor Necrosis Factor alpha (TNF-alpha) is a cytokine which has diverse immunomodulatory, anti-tumor and toxic effects. TNF-alpha has been detected in diverse inflammatory status and appears to be a critical mediator in the lethality of septic shock. Furthermore, TNF-alpha has also been found in inflammatory foci such as synovial effusions in rheumatoid arthritis, systemic circulation in septic shock, parasitemia and rejection of renal transplants. The antibody reacts with both rat and mouse natural and recombinant TNF-alpha and recognizes membrane and receptor bound TNF-alpha. The antibody shows neutralizing activity.
The antibody reacts with the extra-cellular part of the TNF-RI and with the soluble receptor. TNF-RI is present on most cell types and is considered to play a prominent role in cell stimulation by TNF-alpha. Induction of cytotoxicity and other functions are mediated largely via TNF-RI.
The polyclonal antibody recognizes the extracellular part of the mouse Tumor Necrosis Factor Receptor type 2 (TNF-RII) of the membrane-bound as well as the soluble receptor. TNF-RII (~75-80 kDa) is present on most cell types and is considered to play a prominent role in cell stimulation by TNF-alpha. TNF-alpha activates inflammatory responses, induces apoptosis, regulates cellular proliferation, and may even promote cancer progression. The effects of TNF-alpha are mediated by TNF-RI and TNF-RII, which have both distinct and overlapping downstream signaling cascades. Induction of cytotoxicity and other functions are mediated largely via TNF-RI. TNF-RI is equally well activated by both the 17 kDa soluble and 26 kDa membrane-bound form, whereas TNF-RII is efficiently activated only by the membrane bound form of TNF-alpha. Binding of the inherently trimeric TNF-alpha to TNFR1 and TNFR2 induces receptor trimerization and recruitment of several signaling proteins to the cytoplasmic domains of the receptors. Occupancy of TNFR2 results in direct recruitment of TNF Receptor Associated Factor 2 (TRAF2), which in turn recruits TRAF1.
The antibody is reactive with collagen type IV of basement membranes, and shows a homogeneous staining pattern in all tissues. As neoplastic cells of invasive carcinomas often lack a continuous basement membrane, the antiserum is useful to distinguish between non-invasive and invasive lesions. Additionally, it can be used for the differentiation of bullous lesions in dermatopathology. In immunohistochemistry no cross-reactivity with other collagens at optimal dilutions. In immunoblotting, a slight cross-reactivity with collagen type V is observed. Positive control: Skin, kidney.
Nitric oxide synthase is an enzyme catalizing the synthesis of NO from L-arginine. The antiserum was raised against a synthetic peptide of rat cerebellar NOS, that shows no homology with other related proteins. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: frozen sections of rat colon.
Gastrin-secreting cells are numerous in the antrum and a few are found in the proximal duodenum. The antibody can be used for the diagnosis of gastrin-producing tumors which are mainly found in the pancreas and occasionally in the stomach and the duodenum.<br />Positive control: Antrum (antigen localization: cytoplasmic, extracellular)
Glicentin contains the glucagon sequence and is produced in endocrine cells of the distal intestine, in pancreatic glucagon cells and in the nerves in the brain. <br />This glicentin antibody is reactive with glycentin as well as glucagon. The antibody can be used for the diagnosis of tumors from the distal intestine (rectal carcinoids) as well as pancreatic islet cell tumors.<br />Positive control: Pancreas, small intestine.
Insulin is produced by the B-cells of the pancreatic islets. The antibody can be used for the diagnosis of pancreatic B-cell tumors. <br />Antigen localization: cyto-plasm, extracellular.<br />Positive control: Pancreas.
This polyclonal antibody can be used for the study of endocrine differentiation in tumors of the respiratory tract.<br />Positive control: Gut (peripheral nerves), fetal lung
Enkephalins are small peptides derived from large precursers (pro-enkephalin A and B) containing multiple enkephalin copies. They are the most abundant opioid peptides in the body and are widely distributed in the brain and the peripheral nervous system and occur also in the adrenal medulla. Several types of neuroendocrine tumors, incl. pheochromocytomas, neuroblastomas and bronchial and gastrointestinal endocrine tumors, produce enkephalin. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while beta-endorphin does not. Cross-reacts with leu-enkephalin. Positive control:<strong> </strong>Frozen sections of cat or pig small intestine.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Kirchgessner, A. L. et al. Neurol.1989; 285, 3853
Specific for alpha-melanocyte stimulating hormone. Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining.<br>In man,<strong> </strong>alpha-MSH is found in corticotrophs of the anterior pituitary and may also occur in brain neurons.<br>Positive control: Bouin-fixed paraffin sections of pig pituitary.
Neuromedin U was found in porcine spinal cord. Neuromedin U-8 is contained within a larger polypeptide form neuromedin U-25. Neuromedin U is present in central and peripheral neurons, particularly in the enteric nervous system. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: frozen sections of chicken small intestine.
Oxytocin is synthesized in nerve cell bodies in the supraoptic nucleus and paraventricular nucleus, and carried by axonal transport to the neural stalk and pars nervosa where they are stored. Oxytocin nerve terminals can also be found throughout the CNS, even reaching the lower spinal cord. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of pig pituitary.
Specificity: absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: formalin-fixed paraffin sections of pig duodenum.
Substance P occurs in nerve fibers of the central and peripheral nervous system and in endocrine cells of the gut. It stimulates smooth muscle contraction, gives rise to vasodilation and is involved in sensory functions. Substance P-containing tumors arising in the ileum are often associated with the carcinoid syndrome, characterized by flushing of the skin, diarrhea, broncho-constriction and sudden drops in blood pressure. Substance P is commonly found in the midgut carcinoids and some of the symptoms may be related to this peptide.<br>Absorption with 10-100 ug SP 1-4 per ml diluted antiserum abolishes the staining. Positive control: frozen sections of rat colon.
The antiserum against the vesicular acetylcholine transporter is a unique immunohistochemical marker for cholinergic nerves, more specific than the commonly used acetylcholine esterase (AchE), since it does not react with postsynaptic neurons, and is more sensitive than choline acetyltransferase (ChAT). The antiserum recognizes VAChT both in the CNS and PNS of rat and mouse. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of rat small intestine.
The vesicular monoamine transporter is responsible for the vesicular uptake of monoamines, like dopamine, norepinephrine, epinephrine, serotonin and histamine. The antiserum recognizes monoaminergic neurons of the CNS, the ECL-cells of the stomach, as well as enteric nerve fibers. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of rat small intestine.
Amylin or islet amyloid polypeptide (IAPP) is produced in the pancreas beta cells and co-released with insulin. The amino acid sequence shows great homology with CGRP. Amylin has been shown to reverse insulin inhibition of hepatic gluconeogenesis and to inhibit muscle uptake of glucose. Positive control: Formalin-fixed paraffin and frozen sections of human or rat pancreas.
Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while glucagon, GIP, PP and VIP do not. Positive control: frozen sections of rat duodenum.
VIP is localized in nerve fibers of the central and peripheral nervous system, and is probably acting as a neurotransmitter. Smooth muscle relaxation, vasodilation and secretion from exocrine glands are some of the effects of VIP. The Verner-Morrison or Watery Diarrhea Hypokaliemia and Achlorhydria (WDHA) syndrome is a characteristic clinical syndrome associated with overproduction of VIP from endocrine tumors. These VIP-producing tumors are usually neuroblastomas of endocrine tumors in the pancreas. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while PHI, secretin, glucagon, GIP, and CCK do not. Positive control: formalin-fixed paraffin sections of cat ileum.
GIP occurs in endocrine cells in the small intestine. GIP is released upon feeding, particularly after carbohydrate-rich food, and is known to sensitize the insulin cells to rise in blood sugar and is thus involved in the insular axis. GIP also inhibits gastric acid secretion.<br> Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while CCK-39, VIP and secretin do not.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 50-100 ul dist. water (final solution contains 0.09% sodium azide, 1% BSA in PBS buffer, pH 7.4)
Glicentin contains the glucagon sequence and is produced in a prominent population of endocrine cells in the distal intestine as well as in pancreatic glucagon cells and in the nerves in the brain. Serum levels of glicentin are elevated after food uptake and in certain clinical conditions, e.g. after resections of the intestine. The functional role of glicentin is largely unknown. Glicentin occurs in endocrine tumors arising in the distal intestine (rectal carcinoids) and in pancreatic islet cell tumors. <br>Absorption with 10-100 ug glucagon and glicentin per ml diluted antiserum abolishes the staining, while secretin, GIP and VIP do not. Positive control: formalin-fixed paraffin sections of pig pancreas.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Sjölund, K. et al. Gastroenterology 1983;85: 112030
Bombesin is an amphibian peptide and the mammalian counterpart is referred to as Gastrin Releasing Peptide (GRP). Bombesin/GRP is widely distributed in the brain, in peripheral nerves (particularly numerous in the gut) and in endocrine cells of some sub-mammalian species, e.g. in the oxyntic mucosa of birds. The peptide stimulates secretion from endocrine and exocrine cells and intestinal smooth muscle activity. Bombesin/GRP occurs frequently in the bronchial carcinoids.<br><br> Absorption with 10-100 ug bombesin and GRP per ml diluted antiserum abolishes the staining. Positive control: formalin-fixed paraffin and frozen sections of rat or chicken stomach.
Absorption with 10-100 ug neurotensin per ml diluted antiserum abolishes the staining while glucagon, insulin, gastrin, GIP and VIP do not. Positive control: Bouin-fixed paraffin or Stefanini-fixed frozen sections of cat ileum.
The CGRP-sequence was predicted from the corresponding mRNA. CGRP is present in the C-cells of the thyroid and in nerves, in both brain and periphery, particularly within the sensory system. CGRP is a potent vasodilator, probably involved in neurogenic inflammation. Medullary carcinomas of the thyroid contain large amounts of CGRP. Absorption with 10-100 ug CGRP per ml diluted antiserum abolishes the staining while calcitonin, substance P and Neurokinin A do not. The antiserum cross-reacts with amylin. Positive control: frozen sections of rat colon.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Suzuki, N. et al. Neuroscience 1989;30: 595604
References 2:
Grunditz, T. et al. Endocrinology 1986;119:2313-2324
Specificity: absorption with 10-100 ug PYY per ml diluted antiserum abolishes the staining, while NPY and PP do not. Positive control: Bouin-fixed paraffin sections of rat colon and frozen sections of rat colon.
Neuropeptide Y is a peptide belonging to the PP-family and occurs in neurons and adrenal medullary cells. Antisera raised against NPY often cross-react with PP and PYY. This antiserum was raised using a synthetic peptide from the prepro-NPY sequence which has no homologies to PP and NPY. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: Stefanini-fixed sections of rat small intestine.
Goat anti Mouse IgG/A/M reacts with the heavy and light chains of all major classes of mouse immunoglobulin.The antibody has been adsorbed against human serum to minimise cross-reactivity with human immunoglobulins. Storage: Store at -20oC only.Storage in frost-free freezers is not recommended.This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Goat anti Mouse IgG/A/M reacts with the heavy and light chains of all major classes of mouse immunoglobulin.The antibody has been adsorbed against human serum to minimise cross-reactivity with human immunoglobulins. Storage: This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended. This product is photosensitive and should be protected from light.
Goat anti Human collagen I antibody recognizes human type 1 collagen.Goat anti Human collagen I antibody has been cross-adsorbed against collagen types II, III, IV, V and VI. Results from ELISA demonstrate <10% cross-reactivity with other collagen types. Storage: Store at -20oC only.Storage in frost-free freezers is not recommended.This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Goat anti Bovine Collagen II antibody recognizes bovine type II collagen.This antibody demonstrates less than 10% cross reactivity with bovine collagen types I, III, IV, V and VI.This antibody has not been tested for reactivity with other ECM proteins e.g. laminin and fibronectin.Goat anti Bovine Collagen II antibody may cross-react with collagen II from other species. Storage: Store at -20oC only.Storage in frost-free freezers is not recommended.This product should be stored undiluted. Should this product contain a precipitate we recommend microcentrifugation before use.
Goat anti Human Collagen III antibody recognizes human collagen III and shows <10% cross-reactivity with collagen type I, II, IV, V and VI. Reactivity with other ECM proteins such as fibronectin and laminin has not been tested. Goat anti Human Collagen III antibody may react with Collagen III from other species. Storage: Goat anti Human Collagen III antibody recognizes human collagen III and shows <10% cross-reactivity with collagen type I, II, IV, V and VI. Reactivity with other ECM proteins such as fibronectin and laminin has not been tested. Goat anti Human Collagen III antibody may react with Collagen III from other species.
Goat anti Human collagen IV antibody recognizes human collagen type IV. It has been cross adsorbed against collagen types I, II, III, V and VI, resulting in <10% cross-reactivity. It may cross-react with collagen type IV from other species. Collagen is located in the extracellular matrix of connective tissues. It is part of the interacting network of proteoglycans and proteins that provides a structural framework for both soft and calcified connective tissues. Collagen Type IV forms a two-dimensional reticulum and is a major component of the basal lamina.Goat anti human collagen IV has been successfully employed for the demonstration of vasculature in developing rat pups using immunofluorescence techniques (Kermorvant-Duchemin et al. 2013). Storage: Store at -20oC only.Storage in frost-free freezers is not recommended.This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Goat anti Human collagen V antibody recognizes human collagen V and shows <10% reactivity with collagen type I, II, III, IV, and VI. Goat anti Human collagen V antibody may react with collagen V from other species. Reactivity with other ECM proteins has not been tested. Storage: Store at -20°C only.Storage in frost-free freezers is not recommended.This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Rabbit anti Rat Collagen I antibody recognizes both native and heat denatured rat collagen type I. Collagen is located in the extracellular matrix of connective tissues. It is part of the interacting network of proteoglycans and proteins that provides a structural framework for both soft and calcified connective tissues. Type I collagen (~95 kDa) is found in bone, cornea, skin and tendon.Mutations in the encoding gene are associated with osteogenesis imperfecta (Sykes et al. 1990), Ehlers Danlos syndrome (Burrows et al. 1996), and idiopathic osteoporosis (Pernow et al. 2006). Storage: Prior to reconstitution store at +4oC.After reconstitution store at -20oC.Storage in frost-free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody.
Rabbit anti Human collagen I/II/III/IV/V antibodyrecognizes multiple collagen types and exhibits the following reactivities in ELISA with both native and denaturated human collagen types:. I & III100%IV & V90%II 80%Human fibronectin, albumin and immunoglobulins all <0.5% Storage: This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Goat anti Human Urokinase antibody detects an epitope within the C-terminal of urokinase, a potent ~50 kDa serine protease also known as urokinase plasminogen activator (uPA). uPA cleaves and activates plasminogen to form plasmin and is involved in extracellular cellular matrix degradation and cell signalling. uPA and its receptor are involved in the pathogenesis of inflammation and immunity.A specific polymorphism in the gene encoding uPA may be associated with late-onset Alzheimer's disease (Ertekin-Taner et al. 2005). The levels of uPA, uPAR and its soluble fragments have also been found to be increased in tissues, plasma and other body fluids of cancer patients and to be markers of cancer development and metastasis (Kim et al. 2016). Storage: This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Monosan Range:
MONOSAN
Concentration:
0.5mg/ml
Format:
Purified
Storage buffer:
TRIS buffered saline0.02%Sodium Azide (NaN3)0.5%Bovine Serum Albumin
E.coli-derived human Collagen IV recombinant protein (Position: G1445-T1669). Human Collagen IV shares 97% amino acid (aa) sequence identity with mouse Collagen IV.
Store at -20?C for one year from date of receipt. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for six months. Avoid repeated freeze-thaw cycles.BackgroundSubcellular LocalizationType IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Arresten, comprising the C-terminal NC1 domain, inhibits angiogenesis and tumor formation. The C-terminal half is found to possess the anti-angiogenic activity. Specifically inhibits endothelial cell proliferation, migration and tube formation. Inhibits expression of hypoxia-inducible factor 1alpha and ERK1/2 and p38 MAPK activation. Ligand for alpha1/beta1 integrin. Tissue Specificity: Basement membrane.
A synthetic peptide corresponding to a sequence at the C-terminus of human Collagen III, different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.
Store at -20?C for one year from date of receipt. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for six months. Avoid repeated freeze-thaw cycles.BackgroundSubcellular LocalizationCollagen type III occurs in most soft connective tissues along with type I collagen. Involved in regulation of cortical development. Is the major ligand of GPR56 in the developing brain and binding to GPR56 inhibits neuronal migration and activates the RhoA pathway by coupling GPR56 to GNA13 and possibly GNA12. Tissue Specificity: Secreted, extracellular space, extracellular matrix.
A synthetic peptide corresponding to a sequence at the C-terminus of human Collagen I, different from the related rat and mouse sequences by two amino acids.
At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing.BackgroundSubcellular LocalizationType I collagen is a member of group I collagen (fibrillar forming collagen). Tissue Specificity: Secreted, extracellular space, extracellular matrix.
A synthetic peptide corresponding to a sequence at the C-terminus of mouse Collagen I, identical to the related rat sequence, and different from the related human sequence by two amino acids.
Store at -20?C for one year from date of receipt. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for six months. Avoid repeated freeze-thaw cycles.BackgroundSubcellular LocalizationType I collagen is a member of group I collagen (fibrillar forming collagen). Tissue Specificity: Secreted, extracellular space, extracellular matrix.
This product is shipped at ambient temperature. Prior to reconstitution store at +4°C.After reconstitution it is recommended to aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended. This product is photosensitive and should be protected from light. Goat anti Human IgG/A/M antibody recognizes human Ig, binding to all major classes (IgG, IgA, IgM). Purified IgG conjugated to Fluorescein Isothiocyanate Isomer 1 (FITC) - lyophilized
Prior to reconstitution store at +4oC.After reconstitution store at -20oC.Storage in frost-free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody. Rabbit anti Bovine collagen I/III antibody reacts with both Collagen I and III. Less than 0.5% reactivity was observed with bovine albumin and immunoglobulins.Collagen is located in the extracellular matrix of connective tissues. It is part of the interacting network of proteoglycans and proteins that provides a structural framework for both soft and calcified connective tissues.
Prior to reconstitution store at +4oC.After reconstitution store at -20oC.Storage in frost-free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody. Rabbit anti Porcine collagen I/III antibody reacts with native and heat denatured porcine collagen type 1 and 3.Less than 0.5% reactivity is observed with porcine albumin and immunoglobulins.
Neuropeptide Y is a peptide belonging to the PP-family and occurs in neurons and adrenal medullary cells. The brain contains large quantities of NPY and it is also found in the peripheral nervous system, where it coexists with noradrenaline in sympathetic fibers. NPY inhibits gut motility and causes vasoconstriction. Pheochromocytomas contain NPY. Absorption with 10-100 ug NPY 1-20 per ml diluted antiserum abolishes the staining, while PYY and PP do not. Positive control: Stefanini-fixed sections of rat small intestine.
Neurokinin A/Substance K represents a member of the tachykinin family of peptides. Neurokinin A, which arises by cleavage of the substance P precursor, occurs in neurons in the central and peripheral nervous systems, and is particularly numerous in the gastrointestinal tract. The biological actions of neurokinin A are similar to those of substance P, and include vasodilation and stimulation of smooth muscle contraction. <br>Absorption with 10-100 ug NKA per ml diluted antiserum abolishes the staining, while substance P does not. Positive control: formalin-fixed paraffin sections of rat colon.
Serotonin is produced by endocrine cells of the stomach, duodenum and ileum. The polyclonal antibody to serotonin can be used to differentiate tumors of serotoninergic origin. The antigen localization is cytoplasmic. <br>Absorption with 10-100 ug serotonin per ml diluted antiserum abolishes the staining. Positive control: duodenum.
Pituitary adenylate cyclase activating peptide (PACAP), originally isolated from ovine hypothalamus, belongs to the VIP-family of peptides. PACAP-related peptide (PRP) is a 29-amino acid peptide, which is produced together with PACAP-27 and PACAP-38 when PreproPACAP is being processed. PRP is abundant in the brain, but can be also found in the respiratory and gastrointestinal tracts.<br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while PACAP-27, PACAP-38, VIP, PHI, CRF, oxytocin and vasopressin do not.<br>Positive control: Stefanini-fixed frozen sections of rat duodenum, fundus or antrum.
GAP-43, also called neuromodulin, B-50, pp46 and F1, is a neuron-specific, membrane-associated phosphoprotein involved in axonal growth and found in neurons undergoing regeneration.<br>The antiserum was raised against a synthetic C-terminal peptide of GAP-43.<br> Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: rat duodenum.
Regulates the level of GABA available for secretion via secretory vesicles. Marker for neurons using GABA as signaling substance. <br> Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: frozen sections of rat cerebellum.
The peptide was found in the salivary gland venom of the lizard Gila monster. It belongs to the VIP-secretin family of peptides and has many VIP-like actions. Helospectin-immunoreactivity has been demonstrated in the neurons of the gut.<br> Absorption with 10-100 ug helospectin per ml diluted antiserum abolishes the staining, while secretin, PHI and PACAP do not. <br> Cross-reacts with helodermin. Positive control: Stefanini-fixed frozen sections of rat small intestine (1% carbodiimide added to the fixative).
Insulin is produced by the B-cells of the pancreatic islets and by insulin-producing islet cell tumors. <br>Absorption with 10-100 ug proinsulin per ml diluted antiserum inactivates the antiserum, while C-peptide and insulin only partly reduce staining.<br>Positive control: formalin-fixed paraffin sections of human pancreas.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Kohnert, K. D. et al. Regul. Pept.1999; 82: 719
References 2:
Ahrén, B. et al. Pancreas 1999; 18: 7583
References 3:
Al-Amily, I. et al. Pflugers.Arch.2019; 471:633-645
Pancreastatin is a fragment of chromogranin A and is produced by proteolytic processing of chromogranin A in several peptide hormone-producing cells, such as pancreatic islet cells and gut endocrine cells, as well as tumors arising from these cells. <br> Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: Bouin-fixed paraffin sections of rat pancreas.
Histamine is a neurotransmitter in the central nervous system as well as a mast cell constituent. In addition, histamine is produced by endocrine cells (ECL-cells) in the oxynthic mucosa of the stomach. Absorption with 10-100 ug histamine per ml diluted antiserum abolishes the staining, while noradrenaline, 5-HT, VIP, glucagon and histidine do not. Positive control: cryostat sections of carbodiimide fixed human skin or freeze-dried paraffin-sections (vapor fixed in diethylpyrocarbonate; DEPC) of rat stomach.
Nitric oxide synthase is an enzyme catalizing the synthesis of NO from L-arginine. The antiserum was raised against a synthetic peptide of rat cerebellar NOS, that shows no homology with other related proteins. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: frozen sections of rat colon.
Ornithine decarboxylase is the rate-limiting enzyme in polyamine biosynthesis converting ornithine into putrescine. In normal tissue ornithine decarboxylase activity is low but increases in proliferating tissue. Positive control: Stefanini-fixed frozen sections of renal cortex from testosterone-treated mice.
The vesicular monoamine transporter is responsible for the vesicular uptake of monoamines, like dopamine, norepinephrine, epinephrine, serotonin and histamine. The antiserum recognizes monoaminergic neurons of the CNS, the ECL-cells of the stomach, as well as enteric nerve fibers. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. In Western blot experiments using a crude synaptic vesicle fraction of rat brain, the 70 kDa of anti-VMaT2 is recognized (suggested dilution 1:500). Positive control: frozen sections of rat small intestine.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Carballo-Carbajal, I. et al. Nat.Commun. 2019;10: 973
Glucagon is a common constituent of endocrine pancreatic tumors and of rectal carcinoids. The antibody is specific to pancreatic glucagon. Absorption with 10-100 ug glucagon per ml diluted antiserum abolishes the staining. Positive control: Bouin-fixed paraffin sections of cat pancreas.
VIP is localized in nerve fibers of the central and peripheral nervous system, and is probably acting as a neurotransmitter. Smooth muscle relaxation, vasodilation and secretion from exocrine glands are some of the effects of VIP. The Verner-Morrison or Watery Diarrhea Hypokaliemia and Achlorhydria (WDHA) syndrome is a characteristic clinical syndrome associated with overproduction of VIP from endocrine tumors. These VIP-producing tumors are usually neuroblastomas of endocrine tumors in the pancreas.<br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining, while PHI does not.<br>Positive control: Stefanini-fixed frozen sections of rat intestine.
Gastrin-secreting cells are numerous in the antrum and a few are found in the proximal duodenum. The antibody can be used for the diagnosis of gastrin-producing tumors which are mainly found in the pancreas and occasionally in the stomach and the duodenum. <br>Absorption with 10-100 ug gastrin 1-34 and CCK 8 per ml antiserum abolishes the staining. Positive control: formalin-fixed paraffin sections of rat antrum.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Portela-Gomes, G. M.et al. Histochem. Cell Biol. 1999;111: 4954
References 2:
Portela-Gomes, G. M.et al. J. Histochem. Cytochem.1997;45: 81522
References 3:
Mulder, H. et al. Gastroenterology 1994;107: 7129
Substance P occurs in nerve fibers of the central and peripheral nervous system and in endocrine cells of the gut. It stimulates smooth muscle contraction, gives rise to vasodilation and is involved in sensory functions. Substance P-containing tumors arising in the ileum are often associated with the carcinoid syndrome, characterized by flushing of the skin, diarrhea, broncho-constriction and sudden drops in blood pressure. Substance P is commonly found in the midgut carcinoids and some of the symptoms may be related to this peptide. Absorption with 10-100 ug SP and NKA per ml diluted antiserum abolishes the staining while GRP and NKB do not. Positive control:<strong> </strong>frozen sections of rat colon.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Kressel, M.et al. J. Comp. Neurol. 1999;412: 161172
The CGRP-sequence was predicted from the corresponding mRNA. CGRP is present in the C-cells of the thyroid and in nerves, in both brain and periphery, particularly within the sensory system. CGRP is a potent vasodilator, probably involved in neurogenic inflammation. Medullary carcinomas of the thyroid contain large amounts of CGRP. Absorption with 10-100 ug CGRP per ml diluted antiserum abolishes the staining while calcitonin, does not. Cross-reacts with amylin (IAPP).<br>Positive control: Stefanini-fixed frozen sections of rat colon.
The intestinal peptide YY is related to the PP-family of peptides and occurs in the glicentin cells in the gut. They are numerous in the rectum, colon, and ileum and few in the duodenum and jejunum. PYY has hormone-like action, inhibits gut motility and pancreatic exocrine secretion and cause vasoconstriction. <br>PYY may occur in endorine tumors of the pancreas and of the rectum. Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining.<br>Positive control: frozen sections of rat intestine.
The CGRP-sequence was predicted from the corresponding mRNA. CGRP is present in the C-cells of the thyroid and in nerves, in both brain and periphery, particularly within the sensory system. CGRP is a potent vasodilator, probably involved in neurogenic inflammation. Medullary carcinomas of the thyroid contain large amounts of CGRP. Absorption with 10-100 ug CGRP per ml diluted antiserum abolishes the staining while calcitonin does not. Does not cross-react with amylin (IAPP).<br>Positive control: frozen sections of rat colon.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Schulze, E. et al. Acta Histochem.1997; 99: 301309
References 2:
Bechakra, M. et al. Mol.Pain.2018; 14, 1744806918797040
Adrenomedullin is a potent vasorelaxing and hypotensive peptide, originally isolated from human pheochromocytoma. Adrenomedullin shares some homology with CGRP (calcitonin gene-related peptide). The antiserum was raised using synthetic peptides as immunogens. The antibody does not cross-react with CGRP. Positive control: Stefanini-fixed frozen sections of rat fundus.
Phenylethanolamine-N-methyltransferase (PNMT) is an enzyme converting noradrenaline to adrenaline. <br>The enzyme is present in adrenomedullary cells and in the brain neurons. <br> Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining.<br>Positive control: DEPC-fixed paraffin sections of rat adrenal gland.
Nitric oxide synthase is an enzyme catalizing the synthesis of NO from L-arginine. The antiserum was raised against a synthetic peptide of rat cerebellar NOS, that shows no homology with other related proteins. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes the staining. Positive control: frozen sections of rat colon.
Ornithine decarboxylase is the rate-limiting enzyme in polyamine biosynthesis converting ornithine into putrescine. In normal tissue ornithine decarboxylase activity is low but increases in proliferating tissue. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: Stefanini-fixed frozen sections of renal cortex from testosterone-treated mice.
Histidine decarboxylase (HDC) is the enzyme catalyzing the conversion of histidine into histamine. HDC can be found in the histamine secreting ECL cells of some species as well as in the mast cells. Absorption with 10-100 ug immunogen per ml diluted antiserum abolishesthe staining. <br>In Western blot the antiserum detects the 54 kDa and 73 kDa forms in addition to a 63 kDa form (rat stomach, see Dartsch et al., 1998).<br>Positive control: Stefanini-fixed frozen sections of rat fundus. <br> Dartsch, C., Chen, D. & Persson, L. Multiple forms of rat stomach histidine decarboxylase may reflect posttranslational activation of the enzyme. Regul. Pept. 77, 33-41 (1998).
The antibody reacts with a large variety of tumors with oncofetal characteristics; the antigen may also be detected in normal epithelia and tissue of non-neoplastic state. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: Bouin-fixed paraffin sections of human colon carcinoma.
The antiserum is raised against a synthetic peptide (SHMSTSAPPP) from the C-terminus of the rat CCK-A receptor. Suitable for labelling the receptors for the gastrointestinal hormone and neuropeptide CCK. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of rat pancreas.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Lyophilized; reconstitute in 100 µl dist. water
Storage:
2-8°C
References 1:
Ohlsson, B. et al. J. Gastroenterol. 2000;35: 612-8
Useful for studying sensory afferent neurons. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of rat spinal cord.
Located in the cell membrane of thyroid cells, NIS can allow sodium and iodine flow across the membrane. The antiserum is raised against the C-terminus of rat NIS. Suitable for studying the sensitivity of thyroid tumors to iodine treatment. Absorption with 50-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of rat thyroid.
The antiserum against the vesicular acetylcholine transporter is a unique immunohistochemical marker for cholinergic nerves, more specific than the commonly used acetylcholinesterase (AchE), since it does not react with postsynaptic neurons, and is more sensitive than choline acetyltransferase (ChAT). The antiserum recognizes VAChT both in the CNS and PNS. <br>Absorption with 10-100 ug immunogen per ml diluted antiserum abolishes staining. Positive control: frozen sections of human small intestine (Stefanini fixation).
LIME (Lck-interacting molecule) is a 30 kDa double-palmitoylated protein with unusually basic cytoplasmic domain, expressed by T cells. After ligation of CD4 or CD8 T cell coreceptors, LIME is phosphorylated by Src-family kinases and associates with Lck and Fyn kinases and with their negative regulator Csk. Interestingly, Csk-mediated phosphorylation of C-terminal negative-regulatory tyrosine of LIME-associated Lck can result in increase of enzymatic activity compared with the total pool of Lck, thus, LIME serves as a positive regulator of TCR-dependent T cell signaling. However, under some circumstances, LIME may mediate inhibitory signals.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
SLP76 (SH2 domain-containing leukocyte protein of 76 kDa) is a cytosolic adaptor protein which translocates to the plasma mambrane and is involved in multiple signaling pathways in T cells, mast cells, neutrophils and platelets; B cells express its analog SLP65/BLNK (B cell linker protein). SLP76 is phosphorylated by Syk-family and Tec-family tyrosine kinases and couples them to the phosphorylation and activation of PLC-gamma. Via Gads or Grb2, SLP76 also associates with LAT adaptor by involvement of SLP76 proline-rich region. The SH2 domain of SLP76 has been identified as the region involved in binding the serine/threonine kinase HPK1. HPK1 may act as both a positive and a negative regulator by promoting the Jnk-mitogen activated protein kinase (MAPK) pathway and inhibiting the pathway leading to AP-1 activation.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
PAG (phosphoprotein associated with GEMs), also known as Cbp (Csk-binding protein), is a ubiquitously expressed 46 kDa transmembrane adaptor protein present in membrane rafts (glycosphingolipid-enriched microdomains), which however migrates on SDS PAGE gels anomalously as an 80 kDa molecule. Following tyrosine phosphorylation by Src family kinases, PAG binds and thereby activates the protein tyrosine kinase Csk, the major negative regulator of the Src family kinases. Signaling via the B-cell receptor in B cells or high affinity IgE receptor (FcepsilonRI) in mast cells leads to PAG increased tyrosine phosphorylation and Csk binding, while T cell receptor signaling causes PAG dephosphorylation, loss of Csk binding and increased activation of the protein tyrosine kinase Lck.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
SLP65 / BLNK (SH2 domain-containing leukocyte-specific phosphoprotein of 65 kDa; B cell linker protein), also known as BASH, is an adaptor protein that plays key role in B cell activation initiated by cross-linking the B cell receptor (BCR). Phosphorylated by Syk tyrosine kinase, SLP65 serves as a scaffold for Btk tyrosine kinase, Vav1 guanine nucleotide exchange factor, phospholipase C gamma2, as well as Grb2 and Nck adaptor proteins; thus represents a central linker protein that bridges the BCR-associated kinases with a multitude of signaling pathways.
Monosan Range:
MONOSAN
Concentration:
1 mg/ml
Storage buffer:
Phosphate buffered saline (PBS) solution with 15 mM sodium azide
Sheep anti Human C3c antibody recognizes the C3c component of human complement, formed as a result of the inactivation of C3b. Sheep anti Human C3c antibody may be used for the detection of C3 deposits in tissues following complement activation.
Lactoferrin is an approximately 80 kDa glycoprotein which was first isolated from milk and found in epithelia and most body fluids and secretions. Lactoferrin is secreted in plasma by neutrophils. Its plasma concentration represents a positive relation to the total pool of neutrophils and the rate of neutrophil turnover. In inflammation lactoferrin is released from secondary granules of neutrophilic leukocytes into the extracellular medium. Therefore the extracellular lactoferrin concentration can be used as an index for neutrophil activation. <br /> Lactoferrin is able to strongly bind to iron and considered to have antibacterial properties. Human lactoferrin binds to bacterial products through its highly positively charged N terminus and kills various bacteria most probably by inducing intracellular changes in these bacteria without affecting the membrane permeability. Lactoferrin also plays a role in signal transduction, immunomodulation and has antiadhesive, anticancer, antiviral activity.
Human lactoferrin (LF) is an 80 kDa glycoprotein which was first isolated from human milk. It plays an important part in the immune system and helps to fight infections. Lactoferrin promotes the health of the gastro-intestinal system by improving the intestinal microbial balance. In addition, LF can be found in epithelia and most body fluids and secretions. Lactoferrin is secreted in plasma by neutrophils. Its plasma concentration also represents a positive relation to the total pool of neutrophils and the rate of neutrophil turnover. In inflammation lactoferrin is released from secondary granules of neutrophilic leukocytes into the extracellular medium. Therefore the extracellular lactoferrin concentration can be used as an index for neutrophil activation. Lactoferrin strongly binds to iron and this iron binding property is considered to be an important antimicrobial. Human lactoferrin binds to bacterial products through its highly positively charged N-terminus, it kills various bacteria, most probably by inducing intracellular changes in these bacteria without affecting the membrane permeability. Cleavage by pepsin of lactoferrin leads to the release of lactoferricin H. This 47 amino acid peptide has more antimicrobial activity than its precursor and it can inhibit the classical but not the alternative complement pathway. Lactoferrin also plays a role in signal transduction, immunomodulation and has antiadhesive, anticancer, antiviral activity.
Lysozyme is a 14 kd enzyme directed against the b 1 a 4 glycosidic bond between N-acetylglucosamine and N-acetylmuramic acid residues that make up peptidoglycan. Lysozyme is an antimicrobial protein secreted by polymorphonuclear leukocytes and is widely distributed in secretions such as airway secretions and nasal fluid whereas it is the most effective antimicrobial protein. It is also produced by monocytes, macrophages and epithelial cells. Lysozyme is able to kill bacteria by enzymatic lysis of bacterial cell walls and by a nonenzymatic mechanism. Allthough lysozyme is highly active against many gram-positive bacteria it is ineffective against gram-negative bacteria unless potentiated by certain cofactors (lactoferrin, antibody-complement or hydrogen peroxide-ascorbic acid). Next to its antimicrobial activity lysozyme has many other physiological functions including inactivation of certain viruses, important roles in surveillance of membranes of mammalian cells, immune regulatory activity, anti-inflammatory and antitumor activity
Rabbit anti Mycobacterium tuberculosis polyclonal antibody recognizes PPD from Mycobacterium tuberculosis. Rabbit anti M. tuberculosis has not been cross absorbed and may react with related micro-organisms, however the antibody is non-reactive with E.coli K12, Salmonella typhimurium, Pseudomonas aeruginosa, Streptococcus (group B), Candida albicans and Neisseria meningitidis.
Rabbit anti Human Caspase-1 antibody recognizes an epitope within the C-terminal region (CT) of human Caspase-1, otherwise known as IL-1Beta converting enzyme. Caspase-1 is an intracellular cysteine protease, identified as a mammalian homologue to C. elegans cell death gene (ced-3).Caspase-1 has been classified as an inflammatory, rather than apoptotic caspase, due to its essential role in the cleavage of the inactive precursors of the cytokines IL-1beta and IL-18, into their mature activated and secretable forms. Regulation of pro-inflammatory cytokines by Caspase-1 has made inhibitors of Caspase-1 a possible target for use as therapeutic drugs for the treatment of inflammatory diseases (Ghayur et al. 1997).Rabbit anti Human Caspase-1 antibody detects a cleaved subunit band of approximately 21 kDa in human heart cell lysates (predicted precursor MWT 45.2kDa).
Rabbit anti caspase-4 (N-terminal) antibody recognizes an epitope within the N-terminal region (NT) of Caspase-4, otherwise known as ICH-2. Caspase-4, a member of the Caspase-1 subfamily of cysteine proteases, exists as an inactive pro-enzyme which undergoes proteolytic cleavage of its p30 precursor form, into smaller p20 and p10 subunits.The cellular localization of Caspase-4 on the endoplasmic reticulum (ER) membrane, has resulted in this protein becoming a focus of studies in which dysfunction or stress to the ER membrane is implicated, such as Alzheimers disease and Ischemia and confirms the involvement of Caspase-4 as an instigator of cellular apoptosis.
Rabbit anti Human caspase-7 antibody recognizes an epitope within the C-terminal region (CT) of Caspase-7, a ~35 kDa cysteine protease, otherwise known as ICE-like Apoptotic Protease 3 (ICE-LAP3).
Caspase-7, a member of the ICE/Ced-3 subfamily, is an executioner caspase which undergoes proteolytic cleavage of its precursor to form active p12 and p20 subunits. Evidence that activation of Caspase-7 occurs during cell death induced by the cytokine death receptors Fas/APO-1 and the receptor of tumour necrosis factor (TNFR-1), coupled with the fact that granzyme-B activated Caspase-7 cleaves the nuclear enzyme poly (ADP-ribose) polymerase (PARP), suggests an important role for Caspase-7 in both cytokine-mediated and granzyme-B mediated apoptosis pathways.
The immunohistochemical staining of Alpha-1-Antitrypsin is considered to be very useful in the study of inherited AAT deficiency, benign and malignant hepatic tumors and yolk sac carcinomas. Positive staining for A-1-Antitrypsin may also be used in detection of benign and malignant lesions of an histiocytic nature. Sensitivity and specificity of the results have made this antibody a useful tool in the screening of patients with cryptogenic cirrhosis or other forms of liver disease with portal fibrosis of uncertain etiology.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Callea F, et al. J Hepatol. 1986; 2:389-401
References 2:
Palmer PE, et al.Am J Clin Pathol. 1974; 62:350-4
References 3:
Palmer PE, et al. Cancer. 1980; 45:1424-31
References 4:
Raintoft I, et al. Hum Pathol. 1979; 10:419-24
References 5:
Ramsay AD, et al. Appl Immunohistochem Mol Morphol. 2008; 16:140-7
ACTH or Adrenocorticotropic hormone is synthesized from pre-pro-opiomelanocortin (pre-POMC). ACTH is produced and secreted from corticotrophs in the anterior lobe (or adenohypophysis) of the pituitary gland. The anti-ACTH immunohistochemical reagent could be useful in the study of neoplastic and non-neoplastic pituitary diseases
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Pizarro CB, et al. Braz J Med Biol Res. 2004; 37:235-43
References 2:
Kageyama K, et al. Am J Med Sci. 2002; 324:326-30
References 3:
Fan X, et al. J Histochem Cytochem. 2002; 50:1509- 16
References 4:
Japon MA, et al. J Clin Endocrinol Metab. 2002; 87:1879-84
Complement component C3 plays a central role in the activation of complement system. Its activation is required for both classical and alternative complement activation pathways. C3d deposition in the renal transplant PTCs (peritubular capillaries) is indicative of AR (acute rejection) with subsequent high probability of graft loss. Anti-C3d, combined with anti-C4d, can be utilized as a tool for diagnosis of AR and warrant prompt and aggressive anti-rejection treatment. In another study, Pfaltz et al. have shown that anti-C3d labeled the epidermal basement membrane in 97% (31/32) cases of bullous pemphigoid (BP), with none of the normal controls demonstrating such findings. In the same study 27% (3/11) cases of pemphigus vulgaris (PV) demonstrated intercellular C3d deposition. Therefore, C3d immunohistochemistry is a helpful adjunct in the diagnosis of BP (and perhaps PV), especially in the cases in which only formalin-fixed, paraffin embedded tissue is available for analysis.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Bickerstaff A, et al. Am J Pathol. 2008; 173:347-57
References 2:
Kuypers DR, et al. Transplantation. 2003; 76:102-8
Immunohistochemical staining with anti-calcitonin antibody has proven to be an effective way of demonstrating calcitonin-producing cells in the thyroid. C-cell hyperplasia and medullary thyroid carcinomas stain positive for calcitonin. Studies of calcitonin have resulted in the identification of a wide spectrum of C-cell proliferative abnormalities.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Matias-Guiu X, et al. Endocr Pathol. 2014; 25:21-9
References 2:
Fisher S, et al. Arch Pathol Lab Med. 2008;132:359-72
Anti-CD3 antibody has been considered the best all around T-cell marker. This antibody reacts with an antigen present in early thymocytes. The positive staining of this marker may represent a sign of early commitment to the T-cell lineage.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Beverley PC, et al. Eur J Immunol. 1981; 11:329-34
References 2:
Clevers H, et al. Eur J Immunol. 1988; 18:705-10
References 3:
Hedvat CV, et al. Hum Pathol. 2002; 33:968-74
References 4:
Karube K, et al. Am J Surg Pathol. 2003; 27:1366-74
Anti-CEA specifies a group of proteins in the Carcinoembryonic Antigen (CEA) family of proteins which are present in the epithelia of various types and tumors (both benign and malignant) derived from such epithelia. Such tissues are represented by the epithelia of colon, bronchus, alveoli, breast, pancreas, biliary tract, superficial layer and parietal layers of the stomach. Predominately biliary canaliculi are labelled in the liver and this factor is useful in the diagnosis of hepatocelluar carcinoma. Anti-CEA has been quite useful in differentiating adenocarcinoma of the lung vs. mesothelioma. Associated products: CK 5/6, Calretinin, WT-1, E-Cadherin, TTF-1, TAG-72, EMA, CK 20
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Shield PW, et al. Am J Clin Pathol. 1996; 105:157-62
References 2:
Sheahan K, et al. Am J Clin Pathol. 1990; 94:157-64
The claudins are a family of over twenty proteins which are components of tight junction. Tight junctions are specialized regions of cell to cell contact; made up of network of strands to act as a molecular gasket for preventing the leakage of ions, water etc. between cells. They are abundant in luminal epithelial sheets where they maintain epithelial cell polarity. The claudins constitute a variable component, with specific claudins being associated with specific tissues. The immunoreactivity for anti-claudin 1 is membranous and is found in nearly all carcinomas. The staining is much stronger in the carcinoma cells than in normal tissues. Anti-claudin 1 in a panel of immunostains with EMA (positive), S-100 (negative), and GLUT1 can be utilized as a robust marker in diagnosis of perineurioma and neurofibroma. Recently studies showed anti-claudin seems to be a specific marker for meningiomas. Therefore, anti-claudin with anti-EMA, anti-S-100 protein, anti-CD34, and anti-glial fibrillary acidic protein may be helpful in the diagnosis of meningiomas from histologic mimics
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Folpe AL, et al. Am J Surg Pathol. 2002; 26:1620-6
Anti-Factor VIII-Related Antigen antibody reacts with endothelial cells and neoplastic blood cells. This antibody has helped to establish the endothelial nature of some lesions of disputed histogenesis, e.g. Kaposis sarcoma and cardiac myxoma. Not all endothelial cells synthesize (or store) this molecule; therefore, it should not be surprising that not all tumors of endothelial differentiation (benign or malignant) react with this antigen.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Nichols GE, et al. Am J Clin Pathol. 1992; 97:770-5
References 2:
Falk S, et al. Am J Surg Pathol. 1993; 17:959-70
References 3:
Meis-Kindblom JM, et al. Am J Surg Pathol. 1998; 22:683-97
References 4:
Allison KH, et al. Am J Surg Pathol. 2004; 28:298-307
References 5:
Peyvandi F, et al. Blood Transfus. 2011; 9 Suppl 2:s3-8
Anti-FSH is a useful marker in classification of pituitary tumors and the study of pituitary disease. It reacts with FSH-producing cells (gonadotrophs).
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Baenziger JU, et al. Biochim Biophys Acta. 1988; 947:287-306
References 2:
Nussey SS, et al. BIOS Scientific Publishers Ltd; 2001 p. 217-79
References 3:
Uccella S, et al. Pituitary. 2000; 3:131-9
References 4:
Schmid M, et al. Pathol Res Pract. 2001; 197:663-9
Anti-Gastrin antibody gives positive staining of G-cells of human antral/pyloric mucosa and cells producing gastrin or a structural gastrin analogue as is seen in stomach; no staining of other cells or tissue types has been observed. This antibody may react with sulfated and non-sulfated forms of gastrin. The antibody cross-reacts with more than 50% of the present choleocystokinin octapeptide.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Kasacka W, et al. Folia Morphol. 2012; 71:39-44.
References 2:
Hur K, et al. J Cancer Res Clin Oncol. 2006; 132:85-91
References 3:
Waldum et al. Frontiers in Endocrinology. 2017; 8:1-7
Anti-GH is a useful marker in classification of pituitary tumors and the study of pituitary disease (acromegaly). It reacts with GH-producing cells. Growth hormone receptors have been found in various non-pituitary cells, including that from hepatocellular carcinoma and various benign and malignant cutaneous lesions.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Rezaei M, et al. J Res Med Sci. 2012; 17:681-5
References 2:
Al-Brahim NY, et al. J Clin Pathol. 2006; 59:1245-53
References 3:
Fukaya T, et al. Cancer. 1980; 45:1598-1603
References 4:
Kovacs K, et al. Virch Arch Pathol Anat. 1982; 395:59-68
Anti-Glucagon antibody detects glucagon-secreting cells and tumors such as glucagonomas. Studies show that approximately 80% of glucagonomas are malignant and these patients have a syndrome often initially recognized by dermatologists. Symptoms include necrolytic migratory erythema as well as diabetes, anemia, stomatitis, weight loss, frequent venous thromboses, and in some instances, diarrhea and psychiatric disturbances. The diagnosis may be readily confirmed by the demonstration of elevated plasma glucagon concentration.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Quesada I, et al. J Endocrinol. 2008; 199:5-19
References 2:
Gurlo T, et al. J Histotechnol. 2016; 39:8-16
References 3:
Wewer Albrechtsen NJ, et al. Biomark Med. 2016; 10:1141-51
Glucose transporter type I (GLUT1), a prototype member of GLUT super family, reacts with a 55 kD protein, is a membrane-associated erythrocyte glucose transport protein. It is a major glucose transporter in the mammalian blood-brain barrier, and also mediates glucose transport in endothelial cells of the vasculature, adipose tissue and cardiac muscle. GLUT1 is detectable in many human tissues including those of colon, lung, stomach, esophagus, and breast. GLUT1 is overexpressed in malignant cells and in a variety of tumors that include the breast, pancreas, cervix, endometrium, lung, mesothelium, colon, bladder, thyroid, bone, soft tissues, and oral cavity. Immuohistochemical detection of GLUT1 can discriminate between reactive mesothelium and malignant mesothelioma. Anti-GLUT1 with anti-Claudin1, and anti-EMA are perineurial markers in diagnosis of perineuriomas. Anti-GLUT1 is also useful in distinguishing benign endometrial hyperplasia from atypical endometrial hyperplasia and adenocarcinoma. GLUT1 expression has been associated with increased malignant potential, invasiveness, and a poor prognosis in general. Expression of GLUT1 is a late event in colorectal cancer and expression in a high proportion of cancer cells is associated with a high incidence of lymph node metastases.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Kato Y, et al. Mod Pathol. 2006; 20:215-20
References 2:
Afify A, et al. Acta Cytol. 2005; 49:621-6
References 3:
Parente P, et al. J Exp Clin Cancer Res. 2008; 27:34
Granzymes are serine proteases which are stored in specialized lytic granules of cytotoxic T lymphocytes and in natural killer cells. Anti-Granzyme B has been useful in diagnosing Natural killer/T cell lymphoma, as well as anaplastic large cell lymphoma. High percentages of cytotoxic T cells have been shown to be an unfavorable prognostic indicator in Hodgkins disease.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Kummer JA, et al. Clin Exp Immunol. 1995; 100:164-72
hCG is a protein secreted in large quantities by normal trophoblasts; the antibody detects cells and tumors of trophoblastic origin such as Choriocarcinoma. Large Cell Carcinoma and Adenocarcinoma of Lung demonstrate hCG positivity in 90% and 60% of cases respectively. 20% of Squamous Cell Lung Carcinomas are positive for hCG. hCG expression by nontrophoblastic tumors may indicate aggressive behavior since it has been observed that hCG may play a role in the host response to a given tumor.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Helicobacter pylori is strongly associated with inflammation of the stomach and is also implicated in the development of gastric malignancy, peptic ulcers, and gastric lymphomas in humans. Helicobacter pylori can exist in a number of locations: in the mucus, attached to epithelial cells, or inside of vacuoles in epithelial cells, where it produces adhesions that bind to membrane-associated lipids and carbohydrates in or on epithelial cells. The most reliable method for detecting H. pylori infection is a biopsy during endoscopy histologic examination and detection by immunohistochemistry. Immunohistochemical staining of H. pylori on the surface of gastric mucosa is a valuable tool for identification of H. pylori infections.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Herpes simplex virus is quite ubiquitous and is quite variable in its presentation in human disease. Type I usually infects the non-genital mucosal surfaces. It may affect the skin or internal organs (typically brain, lung, liver, adrenal gland, or GI tract) of immunocompromised individuals. This polyclonal antibody reacts with Type I Herpes viruses. There may be cross-reactivity with varicella zoster virus at higher concentrations. Cross-reactivity with CMV or Epstein-Barr virus is not seen with this antibody.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Human placental lactogen (hPL), also previously known as human chorionic somatomammotropin, is a 22 kD protein with partial homology to growth hormone. hPL is first detectable in the maternal serum in the fifth week of gestation and reaches a plateau by the thirty-fourth week. hPL has been demonstrated by immunochemistry in the syncytiotrophoblastic cells of choriocarcinoma. A rare variant of trophoblastic tumor has been reported in the testis with resemblance to uterine placental site trophoblastic tumor. It consisted purely of intermediate trophoblasts, which was diffusely positive for hPL and focally for ?-hCG.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Shih IM, et al. Am J Surg Pathol. 2004; 28:1177-83
References 2:
Ulbright TM, et al. Am J Surg Pathol. 1997; 21:282-8
Immunoglobulin A (IgA) plays a critical role in mucosal immunity. It is present in the mucosal secretions such as tears, saliva, colostrum, intestinal juice, vaginal fluid, and secretions from the prostate and respiratory epithelium, and represents a key first line of defense against invasion by inhaled and ingested pathogens at the vulnerable mucosal surfaces. It is also found in small amounts in blood. Because it is resistant to degradation by enzymes, secretory IgA can survive in harsh environments such as the digestive and respiratory tracts, to provide protection against microbes that multiply in body secretions. It is useful when identifying multiple myeloma.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Ansari NA, et al. Asian Pac J Cancer Prev. 2007; 8:593-6
Anti-IgM reacts with immunoglobulin mu (IgM) chains. IgM is one of the predominant surface immunoglobulins on B-lymphocytes. This antibody is useful when differentiating and sub-classifying hematolymphoid neoplasms.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Arnold A, et al. New Eng J Med. 1983; 309:1593-1599
References 2:
Leong AS, et al. Geenwich Medical Media Ltd. 1999; 217-219
References 3:
Taylor CR. Arch Path Lab Med. 1978; 102:113-121
References 4:
Kojima M, et al. APMIS. 2002; 110:875-80
References 5:
Pambuccian SE, et al. Am J Surg Pathol. 1997; 21:179-86
Luteinizing hormone (LH) is a heterodimeric glycoprotein produced by gonadotropic cells of the pituitary gland. Anti-LH is a useful marker to aid in the classification of pituitary tumors and the study of pituitary disease.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Sano T, et al. Virchows Arch A Pathol Anat Histopathol. 1990; 417:361-7
References 2:
Felix I, et al. Hum Pathol. 1991; 22:719-21
References 3:
Saccomanno K, et al. J Clin Endocrinol Metab. 1994; 78:1103-7
Anti-Lysozyme stains myeloid cells, histiocytes, granulocytes, macrophages, and monocytes in human tonsil, colon and skin. It is an important marker that may demonstrate the myeloid or monocytic nature of acute leukemia. The restrictive nature of anti-lysozyme antibody staining suggests that lysozyme may be synthesized predominantly in reactive histiocytes rather than in resting, unstimulated phagocytes. Anti-lysozyme may aid in the identification of histiocytic neoplasias, large lymphocytes and classifying lymphoproliferative disorders.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Rehg J, et al. Toxicol Pathol. 2012; 40: 345-74
References 2:
Seifert RP, et al. Annals Diag Pathol. 2014; 18:253-60.
Anti-Myeloperoxidase detects granulocytes and monocytes in blood and precursors of granulocytes in the bone marrow. This antibody can detect myeloid cell populations of the bone marrow as well as in other sites.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Pinkus GS, et al. Mod Pathol. 1991; 4:733-41
References 2:
Markoc F, et al. Tumori. 2010; 96:149-53
References 3:
Alexiev BA, et al. Diagn Pathol. 2007; 31;2:42
References 4:
Saravanan L, et al. Int J Lab Hematol. 2010; 32:132-6
References 5:
Manaloor EJ, et al. Am J Clin Pathol. 2000; 113:814-22
Immunostaining with anti-myoglobin provides a specific, sensitive, and practical procedure for the identification of tumors of muscle origin. Since myoglobin is found exclusively in skeletal and cardiac muscle and is not present in any other cells of the human body, it may be used to distinguish rhabdomyosarcoma from other soft tissue tumors.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Mukai K, et al. Am J Surg Pathol. 1979; 3:373-6
References 2:
Corson JM, et al.Am J Pathol. 1981; 103:384-9
References 3:
Brooks JJ. Cancer. 1982; 50:1757-63
References 4:
Furlong MA, et al. Ann Diagn Pathol. 2001; 5:199-206
Napsin is a pepsin-like aspartic proteinase in the A1 clan of the AA clade of proteinases. There are two closely related napsins, napsin A (NAPSA) and napsin B (NAPSB). Napsin A is involved in processing propeptide pulmonary surfactant protein B (proSP-B) in the lung.4 In normal tissue, Napsin A is expressed in type II pneumocytes of the lung and proximal tubules of the kidney. Napsin A is a useful marker for lung adenocarcinoma
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Brasch F, et al. J Biol Chem. 2003; 278: 49006-14
References 2:
Jagirdar J et al. Arch Pathol Lab Med. 2008; 132:384-96
References 3:
Bishop JA, et al. Hum Pathol. 2010; 41:20-5
References 4:
Ye J, et al. Appl Immunohistochem Mol Morphol. 2011; 19:313-17
References 5:
Mukhopadhyay S, et al. Am J Surg Pathol. 2011; 35:15-25
Protein gene product 9.5 (PGP 9.5), also known as ubiquitin carboxyl-terminal hydrolase-1 (UCH-L1), is a 27-kDa protein originally isolated from whole brain extracts (1). Although PGP9.5 expression in normal tissues was originally felt to be strictly confined to neurons and neuroendocrine cells (2), it has been subsequently documented in distal renal tubular epithelium, spermatogonia, Leydig cells, oocytes, melanocytes, prostatic secretory epithelium, ejaculatory duct cells, epididymis, mammary epithelial cells, Merkel cells, and dermal fibroblasts. LK Campbell et al demonstrated immunostaining of a plethora of different mesenchymal neoplasms with this antibody.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Campbell LK, et al. Mod Pathol. 2003; 16:963-9
References 2:
Bassotti G, et al. J Clin Pathol. 2005; 58:973-7
References 3:
Mahalingam M, et al. J Cutan Pathol. 2001; 28:282-6.
References 4:
Mahalingam M, et al. J Cutan Pathol. 2006; 33:51-6.
Prolactin (PRL) is a single-chain polypeptide of 226 amino acids and plays a role in multiple processes including cell growth, reproduction, and immune function. Anti-Prolactin reacts with prolactin-producing cells and is a useful marker in classification of pituitary tumors and the study of pituitary disease.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Asa SL, et al. Arch Pathol Lab Med. 1982; 106:360-3
References 2:
Duello TM, et al. Am J Anat. 1980; 158:463-9
References 3:
Minniti G, et al. Surg Neurol. 2002; 57:99-103
References 4:
Popadic A, et al. Surg Neurol. 1999; 51:47-54
References 5:
Nevalainen MT, et al. J Clin Invest. 1997; 99:618-27
Anti-Synaptophysin reacts with neuroendocrine cells of human adrenal medulla, carotid body, skin, pituitary, thyroid, lung, pancreas and gastrointestinal mucosa. Positive staining is seen in neurons of the brain, spinal cord, retina, and Paneths cells in the gastrointestinal tract and gastric parietal cells. This antibody identifies normal neuroendocrine cells and neuroendocrine neoplasms. Diffuse, finely granular cytoplasmic staining is observed, which probably correlates with the distribution of the antigen within neurosecretory vesicles. The expression of synaptophysin is independent of the presence of NSE or other neuroendocrine markers. Anti-Synaptophysin is an independent broadrange marker of neural and neuroendocrine differentiation.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Navone F, et al. J Cell Biol. 1986; 103:2511-27
References 2:
Wiedenmann B, et al. Cell. 1985; 41:1017-28
References 3:
Kayser K, et al. Pathol Res Pract. 1988; 183:412-7
Anti-TdT antibody labels normal cortical thymocytes and primitive lymphocytes. Anti-TdT antibody detects an enzyme found in the nucleus of normal hematopoietic cells, normal cortical thymocytes and in the cytoplasm of megakaryocytes of the bone marrow. TdT expression is seen in over 90% of acute lymphoblastic lymphoma/ leukemia cases with the exception of pre-B-Cell ALL. TdT expression is not seen in normal mature T-or B-lymphocytes. Anti-TdT is positive for approximately one third of all cases of chronic myeloid leukemia, making it a good indicator of better response to chemotherapy.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Motea EA, et al. Biochimica et Biophysica Acta. 2010; 1804:1151-66
References 2:
Stauchen JA, et al. Int J Surg Pathol. 2003; 11:21-4
References 3:
Suzumiya J, et al. J Pathol. 1997; 182:86-91
References 4:
Arber DA, et al. Am J Clin Pathol. 1996; 106:462-8
Toxoplasma gondii is a spindle-to-oval-shaped protozoan which presents as an infection in humans of various sorts. The cyst (30 um) and trophozoite (7 um) stages can be identified in humans is such cases. This intracellular parasite is transmitted via raw/undercooked meat, contaminated soil, or by direct contact with an infected host. Infection in humans is usually associated with a variable degree of immunosuppression such as in pregnancy or immunosuppression due to various drugs.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Thyroid-stimulating hormone (also known as TSH or thyrotropin) is a peptide hormone synthesized and secreted by thyrotrops in the anterior pituitary gland which regulate the endocrine function of the thyroid gland. TSH is a glycoprotein and consists of two subunits which are non-covalently bound to one another. Anti-TSH reacts with TSH-producing cells (thyrotrophs), and is a useful marker in classification of pituitary tumors.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Batanero E, et al. Brain Behav Immun. 1992; 6:249-64
References 2:
Sanno N, et al. J Clin Endocrinol Metab. 1995; 80:2518-22
References 3:
La Rosa S, et al. Virchows Arch. 2000; 437:264-9
References 4:
Kuzuya N, et al. J Clin Endocrinol Metab. 1990; 71:1103-11
Alpha-fetoprotein (AFP) is a fetal tumor-associated polypeptide of the albuminoid gene family that binds and transports molecules in addition to many other proposed functions. This secretory protein is synthesized primarily in the fetal liver whereas expression is repressed in adult liver.Anti-AFP has been immunohistochemically demonstrated in hepatocellular carcinoma (HCC) and shows no immunoreactivity in normal liver.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Mizejewski GJ et al. Exp Biol Med. 2001; 226:377-408
References 2:
Lazarevich NL et al.Biochemistry (Mosc). 2000; 65:117-33
References 3:
Yusof YA, et al. Anal Quant Cytol Histol. 2003; 25:332-8
Phosphohistone H3 (PHH3) is a core histone protein, which together with other histones, forms the major protein constituents of the chromatin in eukaryotic cells. In mammalian cells, phosphohistone H3 is negligible during interphase but reaches a maximum for chromatin condensation during mitosis. Immunohistochemical studies showed anti-PHH3 specifically detected the core protein histone H3 only when phosphorylated at serine 10 or serine 28. Studies have also revealed no phosphorylation on the histone H3 during apoptosis. PHH3 can serve as a mitotic marker to separate mitotic figures from apoptotic bodies and karyorrhectic debris, which may be a very useful tool in diagnosis of tumor grades, especially in CNS, skin, gyn., soft tissue, and GIST.
Monosan Range:
MONOSAN
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Gurley LR, et al. Eur J Biochem 1978; 84:1-15
References 2:
Hendzel MJ, et al. J Biol Chem 1998; 273:24470-8
References 3:
Colman H, et al. Am J Surg Pathol. 2006; 30:657-64
References 4:
Nasr MR, et al. Am J Dermatopathol. 2008; 30:117-22
PAX2 is a member of the paired box family of transcription factors, which is required for development and proliferation of the kidney, brain, and mllerian organs. PAX2 genes contain a highly conserved DNA sequence within the paired box region, which encodes a DNA-binding domain, enabling PAX proteins to bind the promoters of specific genes to transcriptionally regulate their expression. PAX2 is specifically expressed in the developing central nervous system, eye, ear, and urogenital tract, and is essential for the development of these organs. In normal adult tissues PAX2 was mainly detected in the urogenital system, including kidney, ureteric epithelium, fallopian tube epithelium, ovary and uterus. In tumors, PAX2 has been detected in renal cell carcinomas, Wilms' tumors, nephrogenic adenomas and papillary serous carcinoma of the ovary. PAX2 has been used as a marker for the identification of renal cell carcinoma and ovarian carcinoma by immunohistochemistry.
Monosan Range:
MONOSAN
Clone:
EP235
Concentration:
n/a
Storage buffer:
Tris Buffer, pH 7.3-7.7, containing 1% BSA and <0.1% Sodium Azide
Storage:
2-8°C
References 1:
Gnarra JR, et al. Cancer Res. 1995; 55:4092-8
References 2:
Mazal PR, et al. Mod Pathol. 2005; 4:535-40
References 3:
Chivukula M, et al. Int J Gynecol Pathol. 2009; 28:570-8
The reactivity of the antiserum is restricted to the Fc part of the IgM molecule. In immunoelectrophoresis and radial immunodiffusion, using various antiserum concentrations against normal human serum a single precipitin line is obtained which shows a reaction of identity with the precipitin line obtained with purified IgM. No precipitation reaction is obtained with purified IgG, IgA, and IgG/Fab fragments. In precipitating techniques as immunoelectrophoresis and radial immunodiffusion to identify the presence of IgM in human serum and other body fluids or to determine its concentration. To prepare an immunoadsorbent for the purification of human IgM from serum or plasma.The antiSerum does not cross-react with any other component of the Human Ig system. Interspecies cross-reactivity is a normal feature of antibodies to immunoglobulins, since Ig of different species frequently share antigenic determinants. In immunoelectrophoresis crossreactivity of this antiSerum has not been observed with Serum of Rhesus Monkey, Cynomolgus and Baboon.
BDNF belongs to the neurotrophin family and regulates the survival and differentiation of neurons during development. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. FUNCTION: Promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. Post Translation Modification (PTM): The propeptide is N-glycosylated and glycosulfated. PTM: Converted into mature BDNF by plasmin (PLG) (By similarity). DISEASE: Defects in BDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. CCHS is frequently complicated with neurocristopathies such as Hirschsprung disease that occurs in about 16% of CCHS cases. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Immunogen:
Recombinant human BDNF
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA (1 site), Western Blot, immunoblot, inhibition of biological activity in vitro/in vivo. Recommended to be used at an amount of 1-10 µg/mL for immunohistochemistry, Western blot or immunoblot, 0.1 µg/mL for ELISA and for inhibition of biological activity in vitro 1-10 µg/mL. Use neat for in vivo studies at 2-10 µg/mL (ED50). This antiserum stains cell bodies and some nerve terminals in the dorsal horn of the rat spinal cord, however, does not stain finest nerve terminals. Western blot: 1-10 µg/mL. Tissue homogenate is a recommended sample application for Western Blotting. The antibody detects 14 kDa (mature BDNF), 32 kDa (proBDNF) and a 18 kDa BDNF isoform, however numerous other non-characterized bands may also be present. In cell lysates, only 18 kDa and 32 kDa BDNF are detected. Alternative antibodies for Western Blotting are: R-1707-100 (cell lysates and tissue homogenates), R-083-100/R-066-500 (cell lysates, tissue homogenates and human serum); M-1744-50/100 (human serum and tissue homogenates).<br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Serra, M.P. et al. (2022) Anti-Inflammatory Effect of Beta-Caryophyllene Mediated by the Involvement of TRPV1, BDNF and trkB in the Rat Cerebral Cortex after Hypoperfusion/Reperfusion Int. J. Mol. Sci. Mar; 23(7),3633 Lin J.C-Y. and Rosenthal A. (2011) Methods for treating obesity by administering a trkB antagonist US Patent US 7935342 B2 Counts S.E. and Mufson E.J. (2010) Noradrenaline activation of neurotrophic pathways protects against neuronal amyloid toxicity J Neurochem. 2010 May;113(3):649-60. Unsain N. et al (2009) Brain-derived neurotrophic factor facilitates TrkB down-regulation and neuronal injury after status epilepticus in the rat hippocampus J Neurochem. 2009 Oct;111(2):428-40 Salehi Z., Mashayekhi F. (2009) Brain-derived neurotrophic factor concentrations in the cerebrospinal fluid of patients with Parkinson's disease J Clin Neurosci. Jan;16(1):90-3.
Specificity:
Less than 0.1% cross-reactivity against NGF, recombinant NT3 and NT4 by dot blot. This antiserum is known to react with BDNF from rat, mouse and human. Expected to react with BDNF of other species due to amino acid sequence homology.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Saporin Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, ELISA.
Background Info:
Saporin is a ribosome-inactivating protein (RIP) of type I. This monomeric RNA N-glycosidase purified from seeds of the plant Saponaria officinalis also known as Soapwort, is capable of specific depurination of eukaryotic ribosomes thus arresting protein synthesis. No ligand has been identified in saporin hence its inability to transverse the cell membrane. Due to its toxicity and stability of the structure, saporin has proven extremely useful for construction of immunotoxins. The expected molecular weight of the purified saporin is 29.5 kDa.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Plant
Immunogen:
Saporin, whole molecule
Applications:
ELISA,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, Immunofluorescence, ELISA, Western Blot. A dilution of 1:200 to 1: 2000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Saponaria officinalis; Common soapwort
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed to react with purified saporin. No cross-reactivity with other molecules has been reported.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
This gene encodes an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This gene product is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer's disease. Polymorphisms in this gene have been associated with Alzheimer's disease and mild cognitive impairment. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform. [provided by RefSeq, May 2010]
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Guinea Pig,Mouse,Pig,Rabbit,Rat
Immunogen:
A synthetic peptide (GLFSSYRLPGHTQDTLVAQKSS) as a part of porcine ChAT protein (aa: 167-188) conjugated to KLH
Applications:
ELISA,ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
Mixed
Application Details:
Immunohistochemistry/cytochemistry on 4% PFA or formalin fixed frozen sections; paraffin sections can be more difficult and require more extensive antigen recovery methods. 1:400-1:2000 depending up detection and incubation times<br>ELISA: direct antigen ELISA<br>This antiserum will superbly stain both cell bodies and nerve terminal, and works particularly well in enteric and peripheral neurons. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Beig MI, Dampney BW and Carrive P (2014) Both ox1r and ox2r orexin receptors contribute to the cardiovascular and locomotor components of the novelty stress response in the rat. Neuropharmacology September 16 [Epub ahead of print] Application: IH ; Species: Rat Ellis KM, O'Carroll DC, Lewis MD, Rychkov GY, Koblar SA (2014) Neurogenic potential of dental pulp stem cells isolated from murine incisors. Stem Cell Res Ther. 2014 Feb 27;5(1):30. Application: IF ; Species: Mouse Leong WK, Klaric TS, Lin Y, Lewis MD, Koblar SA (2013) Upregulation of the neuronal Per-Arnt-Sim domain protein 4 (Npas4) in the rat corticolimbic system following focal cerebral ischemia. Eur J Neurosci. 2013 Jun;37(11):1875-84 Application: IH ; Species: Rat Li S et al (2011) The expression and localization of Prune2 mRNA in the central nervous system. Neurosci Lett. Oct 10;503(3):208-14.
Specificity:
This antiserum stains cholinergic neurons in guinea-pig and rabbit. This antiserum is known to react with ChAT of origin guinea-pig, mouse, rat and rabbit.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Capsaicin receptor (TrpV1) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
TISSUE SPECIFICITY: Predominantly expressed in trigeminal and dorsal root sensory ganglia. Isoform 1 and isoform 3 are also expressed in brain and peripheral blood mononuclear cells.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse (Predicted),Rat
Immunogen:
A synthetic peptide (YFSHLKEYVAS) of human capsaicin receptor protein (aa: 531-541) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. Use at 1:1000 to 1:2000 dilution. This antibody has not been tested in other applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rehman R et al (2013) TRPV1 inhibition attenuates IL-13 mediated asthma features in mice by reducing airway epithelial injury. Int Immunopharmacol. 2013 Mar;15(3):597-605.
Specificity:
Immunohistochemical analysis of rat DRG indicates a superb degree of specificity for this serum. This antibody is known to react with rat Capsaicin and due to sequence homology is expected to react with mouse Capsaicin . Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent.
Rabbit anti-Beta-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Beta-synuclein is a non-amyloid component of senile plaques found in Alzheimer disease. It could act as a regulator of SNCA aggregation. It protects nerurons from staurosporine and 6 hydroxy dopamine -stimulated capspase activation in a p53-dependent manner. It localises to the cytoplasm and it is predominantly expressed in the brain where it is most concentrated in presynaptic nerve terminals. This protein is phosphorylated. This protein is also associated with the disease Brain iron accumulation type 1 (NBIA1).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (IEPLMEPEGSYEDPPQE) of human beta synuclein protein (aa: 108-125) conjugated to diptheria toxid has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB , immunoblot. A dilution of 1:500 to 1:2000 is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
SNCB
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Israeli E. and Sharon R. (2009) Beta-synuclein occurs in vivo in lipid-associated oligomers and forms hetero-oligomers with alpha-synuclein J Neurochem. 2009 Jan;108(2):465-74
Specificity:
Less than 0.1% cross reactivity to human alpha synuclein This antiserum is known to react with human and rat beta synuclein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Gamma-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway. SUBUNIT: May be a centrosome-associated protein. SUBCELLULAR LOCATION: Cytoplasm; perinuclear region. Centrosome. Spindle. Associated with centrosomes in several interphase cells. In mitotic cells, localized to the poles of the spindle. TISSUE SPECIFICITY: Highly expressed in brain, particularly in the substantia nigra. Also expressed in the corpus callosum, heart, skeletal muscle, ovary, testis, colon and spleen. Weak expression in pancreas, kidney and lung. PTM: Phosphorylated. Phosphorylation by GRK5 appears to occur on residues distinct from the residue phosphorylated by other kinases. DISEASE: Brain iron accumulation type 1 (NBIA1, also called Hallervorden-Spatz syndrome), a rare neuroaxonal dystrophy, is histologically characterized by axonal spheroids, iron deposition, Lewy body (LB)-like intraneuronal inclusions, glial inclusions and neurofibrillary tangles. SNCG is found in spheroids but not in inclusions. SIMILARITY: Belongs to the synuclein family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (EKEEVAEEAQSGGD) as part of human gamma synuclein protein (aa: 114-127) conjugated to diptheria toxid has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1:500 to 1:1000 is recommended for both applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Immunohistochemical/western blot analysis indicate a high level of specificity for this antiserum for gamma synuclein. This antiserum is known to react with human and rat gamma synuclein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Pan-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Detects human alpha-, beta-, and gamma synuclein proteins. A family of homologous proteins known as alpha-, beta-, and gamma-synuclein are abundantly expressed in brain, especially in the presynaptic terminal of neurons. Although the precise function of these proteins remains unknown, alpha-synuclein has been implicated in synaptic plasticity associated with avian song learning as well as in the pathogenesis of Parkinson's disease (PD), dementia with LBs (DLB), some forms of Alzheimer's disease (AD), and multiple system atrophy (MSA).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (AKEGVVAAAEKTKQGV) as a consensus part of human alpha-, beta-, and gamma synuclein proteins conjugated to diphteria toxoid has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB and immunoblot. A dilution of 1:1000 is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Ulusoy A. et al (2010) Eur J Neurosci. 2010 Aug;32(3):409-22 Naesstrom T. et al (2010) The lipid peroxidation products 4-oxo-2-nonenal and 4-hydroxy-2-nonenal promote the formation of _-synuclein oligomers with distinct biochemical, morphological, and functional properties. Free Radic Biol Med. 2010 Dec 1. Eslamboli A. et al (2007) Long-term consequences of human alpha-synuclein overexpression in the primate ventral midbrain. Brain. 2007 Mar;130(Pt 3):799-815. Mukaetova-Ladinska E.B. et al (2008) Alpha- and gamma-synuclein proteins are present in cerebrospinal fluid and are increased in aged subjects with neurodegenerative and vascular changes. Dement Geriatr Cogn Disord. 2008;26(1):32-42.
Specificity:
Overlap specific immunohistochemical staining of alpha-, beta- and gamma synucleins This antiserum recognises human and rat alpha-, beta- and gamma synucleins.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
BDNF belongs to the neurotrophin family and regulates the survival and differentiation of neurons during development. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer, and Parkinson disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain.<br />FUNCTION: Promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. POst translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Immunogen:
A synthetic peptide (HSDPARRGEL) as a part of human BDNF protein (aa: 129-138) conjugated to KLH has been used as the immunogen. The BDNF protein sequence is highly conserved amongst mammalian species.
Applications:
ELISA,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
<b>Western Blotting:</b> A concentration of 1-10 µg/mL is recommended for this application. In Western Blotting, this antibody detects multiple BDNF isoforms (14 kDa mature BDNF, 18 kDa isoform, 28 kDa BDNF dimer/truncated BDNF, 32 kDa proBDNF monomer) depending on sample application (human serum, cell lysate, tissue homogenate).<br><br><b>IHC:</b> Antibody works well in immunohistochemistry with the proper fixation, pretreatments and dilution. Formal fixed, paraffin embedded tissue is not recommend. Recommended fixation is Zamboni fixative or light 4% PFA fixation on fixed, frozen tissue. Recommended dilution is 1-10 µg/mL for immunohistochemistry at 4 degrees centigrade for 2-48 hours. <b>ELISA:</b> 1-10 µg/mL capture/detection.<br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Feron F et al (2008) Neurotrophin expression in the adult olfactory epithelium. Brain Res. 1196:13-21 Application: IHC ; Species: Rat
Specificity:
Less than 0.1% cross reactivity with mouse NGF, recombinant human NT3 and NT4/5 has been recorded by dot blot analysis. This antiserum is known to recognise rat, human and human BDNF, and is expected to react with BDNF from other species due to amino acid sequence homology.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Receptor for neurturin. Mediates the NRTN-induced autophosphorylation and activation of the RET receptor. Also able to mediate GDNF signaling through the RET tyrosine kinase receptor. SUBCELLULAR LOCATION: Cell membrane; lipid-anchor; GPI-anchor (By similarity). ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (PRVEKTPSLPDDLSD) as a part of human GFR alpha-2 protein (aa: 376-390) conjugated to KLH.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1:500 to 1:1000 is recommended for both applications. This antibody stains beautifully the large neurons in the rat DRG. This antibody also is ideal for WB analysis of rat DRG and brain homogenate. The optimal dilution should be determined by the end user, but a dilution of 1 in 500 is recommended for initial testing. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Western blot analysis indicates a high level of specificity to GFR alpha-2 for this antiserum. This antibody is known to react with rat GFR alpha-2 and from IHC analysis, there appears to be no cross-reactivity with other members of the GFR family.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Receptor for the glial cell line-derived neurotrophic factor, artemin. Mediates the artemin-induced autophosphorylation and activation of the RET receptor tyrosine kinase (By similarity). SUBCELLULAR LOCATION: Cell membrane; lipid-anchor; GPI-anchor (By similarity). SIMILARITY: Belongs to the GDNFR family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
A synthetic peptide (MGLSWSPRPPL) as part of mouse GFR alpha-3 protein (aa: 1-11) conjugated to KLH
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1:500 to 1:1000 is recommended for both applications. This antibody stains nicely large neurons in the rat DRG. Specifically, if you would like to perform WB using rat brain homogenate detecting GFR alpha-3, this is the antibody to be used. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
GDNF family receptor alpha-3; GFR-alpha-3
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Western blot analysis indicates a high level of specificity to GFR alpha-3 for this antiserum. This antibody is known to react with rat GFR alpha-2.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Amyloid-beta precursor protein (APP) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
FUNCTION: Functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. Involved in cell mobility and transcription regulation through protein-protein interactions. Can promote transcription activation through binding to APBB1/Tip60 and inhibit Notch signaling through interaction with Numb. Couples to apoptosis-inducing pathways such as those mediated by G(O) and JIP. Inhibits G(o) alpha ATPase activity. Acts as a kinesin I membrane receptor, mediating the axonal transport of beta-secretase and presenilin 1. May be involved in copper homeostasis/oxidative stress through copper ion reduction. Can regulate neurite outgrowth through binding to components of the extracellular matrix such as heparin and collagen I and IV. FUNCTION: Beta-amyloid peptides are lipophilic metal chelators with metal-reducing activity. Bind transient metals such as copper, zinc and iron. Rat and mouse beta-amyloid peptides bind only weakly transient metals and have little reducing activity due to substitutions of transient metal chelating residues. Beta-APP42 may activate mononuclear phagocytes in the brain and elicit inflammatory responses. Promotes both tau aggregation and TPK II-mediated phosphorylation (By similarity). FUNCTION: The gamma-CTF peptides as well as the caspase-cleaved peptides, including C31, are potent enhancers of neuronal apoptosis. SUBUNIT: Binds, via its C-terminus, to the PID domain of several cytoplasmic proteins, including APBB family members, the APBA family, MAPK8IP1, SHC1, Numb and Dab1. Binding to Dab1 inhibits its serine phosphorylation. Also interacts with GPCR-like protein BPP, FPRL1, APPBP1, IB1, KNS2 (via its TPR domains), APPBP2 (via BaSS) and DDB1. In vitro, it binds MAPT via the MT-binding domains. Associates with microtubules in the presence of ATP and in a kinesin-dependent manner. Interacts, through a C-terminal domain, with GNAO1. Amyloid beta-42 binds CHRNA7 in hippocampal neurons. Beta-amyloid associates with HADH2. TISSUE SPECIFICITY: different isoforms in different tissues: kidney. brain. liver. hippocampus, substania nigra pars compacta and cerebellum. In the cerebellum, all the isoforms are abundantly expressed in Purkinje cells.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
Synthetic peptides (C-ETHLHW HTVAKET, aa: 145-157; C-HAH FQKAKERLEA KHRER, aa: 388-405; C-KKKQYTS IHHGVVE, aa: 724-737) as parts of human APP isoform A conjugated to KLH
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. Recommended to be used at a dilution of 1:500 to 1:3000 for immunohistochemistry. This antiserum has not yet been tested for western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity for APP was confirmed by IHC. This antiserum is known to react with rat APP. Reactivity with other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Amyloid-beta precursor protein (APP) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
FUNCTION: Functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. Involved in cell mobility and transcription regulation through protein-protein interactions. Can promote transcription activation through binding to APBB1/Tip60 and inhibit Notch signaling through interaction with Numb. Couples to apoptosis-inducing pathways such as those mediated by G(O) and JIP. Inhibits G(o) alpha ATPase activity. Acts as a kinesin I membrane receptor, mediating the axonal transport of beta-secretase and presenilin 1. May be involved in copper homeostasis/oxidative stress through copper ion reduction. Can regulate neurite outgrowth through binding to components of the extracellular matrix such as heparin and collagen I and IV. FUNCTION: Beta-amyloid peptides are lipophilic metal chelators with metal-reducing activity. Bind transient metals such as copper, zinc and iron. Rat and mouse beta-amyloid peptides bind only weakly transient metals and have little reducing activity due to substitutions of transient metal chelating residues. Beta-APP42 may activate mononuclear phagocytes in the brain and elicit inflammatory responses. Promotes both tau aggregation and TPK II-mediated phosphorylation (By similarity). FUNCTION: The gamma-CTF peptides as well as the caspase-cleaved peptides, including C31, are potent enhancers of neuronal apoptosis. SUBUNIT: Binds, via its C-terminus, to the PID domain of several cytoplasmic proteins, including APBB family members, the APBA family, MAPK8IP1, SHC1, Numb and Dab1. Binding to Dab1 inhibits its serine phosphorylation. Also interacts with GPCR-like protein BPP, FPRL1, APPBP1, IB1, KNS2 (via its TPR domains), APPBP2 (via BaSS) and DDB1. In vitro, it binds MAPT via the MT-binding domains. Associates with microtubules in the presence of ATP and in a kinesin-dependent manner. Interacts, through a C-terminal domain, with GNAO1. Amyloid beta-42 binds CHRNA7 in hippocampal neurons. Beta-amyloid associates with HADH2. TISSUE SPECIFICITY: different isoforms in different tissues: kidney. brain. liver. hippocampus, substania nigra pars compacta and cerebellum. In the cerebellum, all the isoforms are abundantly expressed in Purkinje cells.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
A synthetic peptide (HMNVQNGKWESDPSGTKTC, aa: 44-62) as part of mouse APP isoform A conjugated to the immunogenic protein Blue Carrier Protein
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. Recommended to be used at a dilution of 1:500 to 1:3000 for immunohistochemistry. This antiserum has not yet been tested for western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Amyloid beta A4 protein; ABPP; Alzheimer disease amyloid protein homolog; Amyloidogenic glycoprotein; AG
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity for APP was confirmed by IHC. This antiserum is known to react with rat APP. Reactivity with other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Adenosine triphosphate (ATP)- ase (ATPase) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
CATALYTIC ACTIVITY: ATP + H2O = ADP + phosphate. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein (By similarity). ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. SIMILARITY: Belongs to the cation transport ATPase (P-type) family. Type V subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (C-DDVHRSRHGLSLQDQ) as part of human ATP13A2 protein (aa: 195-209) conjugated to KLH
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:500 to 1:2000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Immunohistochemistry shows specific staining for ATPase. This antiserum is known to react with rat ATPase. Other species have not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Adenosine triphosphate (ATP)- ase (ATPase) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
CATALYTIC ACTIVITY: ATP + H2O = ADP + phosphate. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein (By similarity). SIMILARITY: Belongs to the cation transport ATPase (P-type) family. Type V subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
A synthetic peptide (C-ELHRQEEAKQVLRYY) as part of mouse ATP13A2 protein (aa: 147-161) conjugated to KLH
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:500 to 1:2000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Immunohistochemistry shows specific staining for ATPase. This antiserum is known to react with rat ATPase. Other species have not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Alpha-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Alpha synuclein is an abundant 140 amino acid neuronal protein, expressed primarily at presynaptic terminals in the central nervous system. FUNCTION: May be involved in the regulation of dopamine release and transport. Soluble protein, normally localized primarily at the presynaptic region of axons, which can form filamentous aggregates that are the major non amyloid component of intracellular inclusions in several neurodegenerative diseases (synucleinopathies). Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase 3 activation. TISSUE SPECIFICITY: Expressed principally in brain but is also expressed in low concentrations in all tissues examined except in liver. Concentrated in presynaptic nerve terminals.SUBUNIT: Soluble monomer which can form filamentous aggregates. Interacts with UCHL1. Interacts with phospholipase D and histones. SUBCELLULAR LOCATION: Cytoplasm. Membrane. Nucleus. Note=Membrane-bound in dopaminergic neurons. Also found in the nucleus. ALTERNATIVE PRODUCTS: 3 named isoforms produced by alternative splicing. Additional isoforms seem to exist.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (SEEGYQDYEPEA) corresponding to the C-terminal of human alpha synuclein protein (aa 129-140) conjugated to Blue Carrier Protein has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from alpha synuclein protein in monkey and pig.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1:500 to 1:3000 is recommended for both applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP; SNCA; PARK1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Tinsley R.B. et al (2010) Sensitive and specific detection of alpha-synuclein in human plasma J Neurosci Res. 2010 Sep;88(12):2693-700.
Specificity:
Immunohistochemical and western blot analysis of human brain indicates a high level of specificity for this antiserum. This antibody is known to react with human, mouse and rat alpha synuclein. Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Capsaicin receptor (TrpV1) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Responses evoked by low pH and heat, and capsaicin can be antagonized by capsazepine. SIMILARITY: Belongs to the transient receptor family. TrpV subfamily. SIMILARITY: Contains 3 ANK repeats.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (PSESTSHRWRGPA) of human capsaicin receptor protein (aa: 608-621) conjugated to KLH has been used as the antigen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. Use at 1:1000 to 1:2000 dilution. This antibody has not been tested in other applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Jabin Fagelskiold A et al (2012) Insulin-secreting INS-1E cells express functional TRPV1 channels. Islets. 2012 Jan 1;4(1).
Specificity:
Specificity was confirmed by IHC using frozen sections of rat dorsal root ganglia (DRG) and spinal cord. Due to sequence homology, similar staining is predicted in human DRG and spinal cord. Human, rat. Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Vanilloid receptor-like protein 1 (VRL-1) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
TISSUE SPECIFICITY: Ubiquitously expressed. Expressed in dorsal root ganglia, trigeminal ganglia, spinal chord (Lissauer's tract, dorsal horn and dorsal columns) (at protein level). PTM: N-glycosylated. PTM: Phosphorylated by PKA. SIMILARITY: Belongs to the transient receptor family. TrpV subfamily. SIMILARITY: Contains 3 ANK repeats.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4, containing 0.02% sodium azide as preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (C-KNSASEEDHLPLQVLQSP) as part of rat VRL-1 protein (aa: 744-761) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, Immunofluorescence, Western blot and Immunoblot. Recommended to be used at a concentration of 0.5-1 µg for these applications. This antiserum works superbly for immunohistochemistry on free-floating or paraffin embedded sections. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
osm-9-like TRP channel 2; OTRPC2
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Immunohistochemical analysis in rat dorsal root ganglia and spinal cord indicates a high level of specificity for this antiserum. Specificity was also shown by Western blot. This antibody is known to react with rat and human VRL-1.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent.
Rabbit anti-Vanilloid receptor-like protein 1 (VRL-1) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
TISSUE SPECIFICITY: Ubiquitously expressed. Expressed in dorsal root ganglia, trigeminal ganglia, spinal chord (Lissauer's tract, dorsal horn and dorsal columns) (at protein level). PTM: N-glycosylated. PTM: Phosphorylated by PKA. SIMILARITY: Belongs to the transient receptor family. TrpV subfamily. SIMILARITY: Contains 3 ANK repeats.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (C-KNSASEEDHLPLQVLQSP) of rat VRL-1 protein (aa: 744-761) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, Immunofluorescence, Western blot. Recommended to be used at a dilution of 1: 1000 to 1: 2000 for immunohistochemistry and Western blot, for Immunofluorescence at a dilution of 1:50 to 1: 200 in free-floating sections or paraffin embedded sections. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
osm-9-like TRP channel 2; OTRPC2
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Immunohistochemical analysis in rat dorsal root ganglia and spinal cord indicates a high level of specificity for this antiserum. Specificity was also shown by Western blot. This antibody is known to react with rat and human VRL-1.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent.
GDNF is a glycosylated, disulfide-bonded homodimer molecule. It was first discovered as a potent survival factor for midbrain dopaminergic neurons and was then shown to rescue these neurons in animal models of Parkinson's disease. GDNF is about 100 times more efficient survival factor for spinal motor neurons than the neurotrophins. <br />FUNCTION: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. <br />DISEASE: Defects in GDNF may be a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, defects in GDNF may be involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. DISEASE: Defects in GDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human GDNF
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB and dot blot. Recommended to be used at a dilution of 1:1000 to 1:3000 for Western blot. The predicted molecular weight of the GDNF monomer is 11.6 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
No cross reactivity with NTN has been observed in Western Blot analysis. This antibody is known to react with human, mouse and rat GDNF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
BDNF belongs to the neurotrophin family and regulates the survival and differentiation of neurons during development. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. FUNCTION: Promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. POst translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Immunogen:
A synthetic peptide (HSDPARRGEL) as a part of human BDNF protein (aa: 129-138) conjugated to KLH has been used as the immunogen. The BDNF protein sequence is highly conserved amongst primates.
Applications:
ELISA,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
<b>Western Blotting:</b> This antibody detects multiple BDNF isoforms (14 kDa mature BDNF, 18 kDa isoform, 28 kDa BDNF dimer/truncated BDNF, 32 kDa proBDNF monomer) depending on sample application (human serum, cell lysate, tissue homogenate). Antibody also detects BDNF under non-reducing conditions (McLean NA, 2014).<br><br><b>ELISA:</b> Detection only, 1:1000-1:5000 recommended.<br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
McLean NA, Popescu BF, Gordon T, Zochodne DW, Verge VM. (2014) "Delayed nerve stimulation promotes axon-protective neurofilament phosphorylation, accelerates immune cell clearance and enhances remyelination in vivo in focally demyelinated nerves." PLoS One. 2014 Oct 13;9(10):e110174 Application: WB , non-reducing, Species: Rat Cysneiros R.M. et al (2010) Qualitative analysis of hippocampal plastic changes in rats with epilepsy supplemented with oral omega-3 fatty acids Epilepsy Behav. 2010 Jan;17(1):33-8. Ooe N. et al (2009) Dynamic regulation of bHLH-PAS-type transcription factor NXF gene expression and neurotrophin dependent induction of the transcriptional control activity Biochem Biophys Res Commun. 2009 Jan 23;378(4):761-5.
Specificity:
Less than 0.1% cross reactivity with mouse NGF, recombinant human NT3 and NT4/5 has been recorded by dot blot analysis. This antiserum is known to recognise rat, mouse and human BDNF, and is expected to react with BDNF from other species due to amino acid sequence homology.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. It stimulates division and differentiation of sympathetic and embryonic sensory neurons. SUBUNIT: Homodimer, associated by noncovalent forces. SUBCELLULAR LOCATION: Secreted protein. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Avian,Human,Mouse,Rat
Immunogen:
Native mouse beta NGF purified from submaxillary salivary gland (95% purity by PAGE)
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, 1-site ELISA, WB, immunoblot, inhibition of biological activity. A dilution of 1:1000-1:5000 is recommended for IHC, western blot and immunoblot; 1:15000 for ELISA; for inhibition of biological activity: 1:10-50 for in vitro, 5-10 µL/g body weight for in vivo. This antiserum completely inhibits neuronal survival and the outgrowth actions of murine NGF in chicken DRG in vitro. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Beta-nerve growth factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Mulhall J.P. et al (2008) J Sex Med. May;5(5):1126-36.
Specificity:
A cross reactivity of less than 1% to recombinant human BDNF, NT3, NT4/5 by ELISA has been shown. This antiserum is known to cross react with mouse, rat, human and avian NGF bot not bovine NGF.
Storage:
Store lyophilized antibody at 2-8ºC. After reconstitution keep aliquots at -20°C to -80ºC for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
BDNF belongs to the neurotrophin family and regulates the survival and differentiation of neurons during development. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. FUNCTION: Promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. Post Translation Modification (PTM): The propeptide is N-glycosylated and glycosulfated. PTM: Converted into mature BDNF by plasmin (PLG) (By similarity). DISEASE: Defects in BDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. CCHS is frequently complicated with neurocristopathies such as Hirschsprung disease that occurs in about 16% of CCHS cases. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Immunogen:
A synthetic peptide (C-ELLDEDQKVRPNEE) as a part of human BDNF precursor protein (aa: 69-82) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1:1000 to 1:5000 is recommended for both applications. ICC: 1:500 to 1:2000, antibody works on 4% formaldehyde fixed cells. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Used in western blot, this antiserum detects a 35 kDa band corresponding to the molecular weight of proBDNF. No cross reactivity with other proneurotrophins was detected. This antiserum is known to react with human, mouse and rat proBDNF and also expected to recognise other mammalian proBDNF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
BDNF belongs to the neurotrophin family and regulates the survival and differentiation of neurons during development. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. FUNCTION: Promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. Post Translation Modification (PTM): The propeptide is N-glycosylated and glycosulfated. PTM: Converted into mature BDNF by plasmin (PLG) (By similarity). DISEASE: Defects in BDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. CCHS is frequently complicated with neurocristopathies such as Hirschsprung disease that occurs in about 16% of CCHS cases. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Immunogen:
Recombinant human BDNF
Applications:
IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA (1 site), Western Blot, inhibition of biological activity in vitro/in vivo. Recommended to be used at a dilution of 1:1000 for immunohistochemistry, ELISA and Western blot. 1:10 to 1:50 for inhibition of biological activity in vitro. Use neat for in vivo studies at 5-10 uL/g body weight. This antiserum stains cell bodies and some nerve terminals in the dorsal horn of the rat spinal cord, however, does not stain finest nerve terminals. <br><br>Western Blotting: Antibody does detect BDNF forms in tissue lysates but there are multiple bands present, many of which are uncharacterized. The antibody detects 14 kDa (mature BDNF), 32 kDa (proBDNF) and a 18 kDa BDNF isoform (see blot examples). In cell lysates, only 18 kDa and 32 kDa BDNF are detected. The reason for these differences has not been characterized. Alternative antibodies for Western Blotting are: R-017-500 (IgG-purified form of R-088-100 for tissue homogenate analysis); R-1707-100 (cell lysates and tissue homogenates), R-083-100/R-066-500 (cell lysates, tissue homogenates and human serum); M-1744-50/100 (human serum and tissue homogenates).<br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
L.Y. Chen et al (2010) Learning induces neurotrophin signaling at hippocampal synapses Proc Natl Acad Sci USA. Apr 13;107(15):7030-5 Soderquist R.G. et al (2009) PEGylation of brain-derived neurotrophic factor for preserved biological activity and enhanced spinal cord distribution J Biomed Mater Res A. 2009 Dec;91(3):719-29. Tang S. et al (2010) Immunolocalization of pro- and mature-brain derived neurotrophic factor (BDNF) and receptor TrkB in the human brainstem and hippocampus. Brain Res. Oct 1;1354:1-14. Sadri-Vakili G. et al (2010) Cocaine-induced chromatin remodeling increases brain-derived neurotrophic factor transcription in the rat medial prefrontal cortex, which alters the reinforcing efficacy of cocaine. J Neurosci. 2010 Sep 1;30(35):11735-44. Maldonado M.A. et al (2008) Motor skill training, but not voluntary exercise, improves skilled reaching after unilateral ischemic lesions of the sensorimotor cortex in rats. Neurorehabil Neural Repair. 2008 May-Jun;22(3):250-61. Nakajima H. et al (2007) Rescue of rat anterior horn neurons after spinal cord injury by retrograde transfection of adenovirus vector carrying brain-derived neurotrophic factor gene. J Neurotrauma. 2007 Apr;24(4):703-12. Zhang H.T. et al (2007) Immunohistochemical distribution of NGF, BDNF, NT-3, and NT-4 in adult rhesus monkey brains. J Histochem Cytochem. 2007 Jan;55(1):1-19. Carrasco M.A. et al (2007) Regulation of glycinergic and GABAergic synaptogenesis by brain-derived neurotrophic factor in developing spinal neurons. Neuroscience. 2007 Mar 16;145(2):484-94. Zhang H.T. et al (2008) Temporal changes in the level of neurotrophins in the spinal cord and associated precentral gyrus following spinal hemisection in adult Rhesus monkeys J Chem Neuroanat. 2008 Dec;36(3-4):138-43.
Specificity:
Less than 0.1% cross-reactivity against NGF, NT3 and NT4/5 by dot blot. Known to react with BDNF from rat, mouse and human. Expected to react with BDNF from other species due to amino acid sequence homology.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Low affinity receptor which can bind to NGF, BDNF, NT-3, and NT-4. Can mediate cell survival as well as cell death of neural cells. SUBUNIT: Homodimer; disulfide-linked. Interacts with p75NTR-associated cell death executor. Interacts with TRAF2, TRAF4, TRAF6, PTPN13 and RANBP9. Interacts through TRAF6 with SQSTM1 which bridges NGFR to NTRK1. Interacts with BEX1 and NGFRAP1/BEX3. SUBCELLULAR LOCATION: Membrane; single-pass type I membrane protein. DOMAIN: Death domain is responsible for interaction with RANBP9. PTM: N- and O-glycosylated. PTM: O-linked glycans consist of Gal(1-3)GalNAc core elongated by 1 or 2 NeuNAc. PTM: Phosphorylated on serine residues. SIMILARITY: Contains 1 death domain. SIMILARITY: Contains 4 TNFR-Cys repeats.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
Extra cellular domain of human p75NTR
Applications:
ICC,IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence. Recommended to be used at a dilution of 1:500 to 1:2000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
IHC shows specific staining for p75NTR. This antibody is known to react to rat p75NTR.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Huntingtin-associated protein 1 (HAP-1) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
FUNCTION: Associates specifically with huntingtin. This binding is enhanced by an expanded polyglutamine repeat. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: In the brain, especially in the olfactory bulb and in the brain stem. No detectable expression in peripheral tissues such as lung, testis, spleen, and small intestine. SIMILARITY: Contains 1 HAP1 N-terminal domain.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Rat
Immunogen:
Recombinant rat HAP-1
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:500 to 1:3000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Huntingtin-associated protein 1; HAP1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity for HAP-1 was confirmed by IHC. This antiserum is known to react with rat HAP-1. Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Tumor necrosis factor receptor superfamily member 19 (TROY) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
FUNCTION: Can mediate activation of c-Jun and NF-kappa-B. May promote caspase-independent cell death. Isoform 2 and isoform 3 may act as decoy receptors. SUBUNIT: Associates with TRAF1, TRAF2, TRAF3 and TRAF5. SUBCELLULAR LOCATION: Isoform 1, isoform 3, isoform 4: Cell membrane; single-pass type I membrane protein (Probable). Isoform 2: Secreted protein (Probable). ALTERNATIVE PRODUCTS: 4 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Highly expressed in adult brain, and in embryos from day 11-17, but not earlier. Detected in embryonic brain and epithelium, and at lower levels in adult heart, lung and liver. In neonatal mice, mainly in hair follicles and neuron-like cells in the cerebellum, but not in the skin epidermis. Isoform 3 was found in embryonic day 17.5 skin but not in brain and liver. SIMILARITY: Contains 3 TNFR-Cys repeats.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
A synthetic peptide (CRPHRF KEDWGFQK) as part of mouse TROY protein (aa: 75-88) conjugated to the immunogenic protein Blue Carrier Protein
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. Recommended to be used at a dilution of 1:500 to 1:2000 for immunohistochemistry. This antiserum has not yet been tested for western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Tumor necrosis factor receptor superfamily member 19; TNFRSF19; Toxicity and JNK inducer; TRADE
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity for TROY was confirmed by IHC. This antiserum is known to react with rat TROY. Reactivity with other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Whole serum
Target:
Tumor necrosis factor receptor superfamily member 19 (TROY)
FUNCTION: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. It stimulates division and differentiation of sympathetic and embryonic sensory neurons. SUBUNIT: Homodimer, associated by noncovalent forces. SUBCELLULAR LOCATION: Secreted protein. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.2-7.6 without preservatives
Host Animal:
Rabbit
Species Reactivity:
Avian,Human,Mouse,Rat
Immunogen:
Native mouse beta NGF purified from submaxillary salivary gland (95% purity by PAGE)
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, 1-site ELISA, WB, immunoblot, inhibition of biological activity. A concentration of 1-3 µg/mL is recommended for IHC, western blot and immunoblot, ELISA, inhibition of biological activity in vitro. Use neat for in vivo studies at 2-10 µg/mL (ED50). This antibody was tested on cultured sensory neurons supported by 100 ng/mL of purified mouse beta NGF. Be advised that 2 µg/mL will neutralize 100 ng/mL of mouse NGF. The higher 10 µg/mL is only recommended if the concentration of NGF being used is higher than 100 ng/mL such as the 200 or 500ng/mL that is occasionally used in some culture systems. This antiserum completely inhibits neuronal survival and the outgrowth actions of murine NGF in chicken DRG in vitro. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Beta-nerve growth factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Laurina Z. et al (2009) Growth factors/cytokines/defensins and apoptosis in periodontal pathologies. Stomatologija. 2009;11(2):48-54. Lee H.W. et al (2007) Expression of nerve growth factor is upregulated in the rat thymic epithelial cells during thymus regeneration following acute thymic involution. Regul Pept. 2007 Jun 7;141(1-3):86-95
Specificity:
A cross reactivity of less than 1% to recombinant human BDNF, NT3, NT4/5 by ELISA has been shown. This antiserum is known to cross react with mouse, rat, human and avian NGF but not bovine NGF.
Storage:
Store lyophilized antibody at 2-8ºC. After reconstitution keep aliquots at -20°C to -80ºC for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Seems to promotes the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human (aa: 139-149), mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Feron F et al (2008) Neurotrophin expression in the adult olfactory epithelium. Brain Res. 1196:13-21 Application: IHC ; Species: Rat
Specificity:
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Seems to promote the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human (aa: 139-149), mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A dilution of 1:500 to 1:2000 is recommended for IHC, western blot. For inhibition of biological activity: 1:10-50 for in vitro, 5-10 µL/g body weight for in vivo. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Seems to promotes the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Chicken,Human,Rat
Immunogen:
Recombinant human NT3
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A dilution of 1:500 to 1:1000 is recommended for IHC, ELISA and western blot. For inhibition of biological activity: 1:10-50 for in vitro, 2-10 µL/g body weight for in vivo. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% to mouse NGF, recombinant human BDNF and 5% to NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Seems to promotes the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS with no preservatives.
Host Animal:
Rabbit
Species Reactivity:
Chicken,Human,Rat
Immunogen:
Recombinant human NT3
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% to mouse NGF, recombinant human BDNF and 5% to NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
CNTF is a survival promoting factor for different types of neurons in vitro and in vivo. The essential structural features for the biological function of human CNTF were investigated by Thier, M. et al. They showed that deletion of 14 N-terminal and 18 C-terminal amino acids significantly increased bioactivity compared to wild-type CNTF. FUNCTION: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. TISSUE SPECIFICITY: Nervous system. PHARMACEUTICAL: CNTF is being tested under the name Axokine by Regeneron Pharmaceuticals for treatment of human motor neuron diseases, such as amyotrophic lateral sclerosis (ALS). As it induces substantial weight loss, preferentially of fat as opposed to lean body mass, it is being used for obesity treatment. SIMILARITY: Belongs to the CNTF family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human CNTF
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:500 to 1: 4000 is recommended for western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Ciliary neurotrophic factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody specifically detects CNTF shown by western blot. This antiserum to known to react with rat, mouse and human CNTF protein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Primate,Rat
Immunogen:
Recombinant human NT4
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA (1 site), Western Blot, inhibition of biological activity in vitro/in vivo. Recommended to be used at a dilution of 1:500 to 1:2000 for immunohistochemistry, ELISA and Western blot. 1:10 to 1:50 for inhibition of biological activity in vitro. Use neat for in vivo studies at 5-10 µL/g body weight. Note that the concentration of NT4 is generally low in most tissues nevertheless, neonatal testes of rat can be used as a good positive control. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Less than 1% cross-reactivity against NGF, recombinant human BDNF and 5% to NT3 has been shown by 1-site ELISA. Known to react with NT4 from rat and human, mouse and monkey.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Primate,Rat
Immunogen:
Recombinant human NT4
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA (1 site), Western Blot, ICC, inhibition of biological activity in vitro/in vivo. Recommended to be used at a concentration of 1-10 µg/mL for immunohistochemistry, ELISA, ICC and Western blot and inhibition of biological activity in vitro. Use neat for in vivo studies at 2-10 µg/mL (ED50). Note that the concentration of NT4 is generally low in most tissues nevertheless, neonatal testes of rat can be used as a good positive control. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Less than 1% cross-reactivity against NGF, recombinant human BDNF and 5% to NT3 has been shown by dot blot. Known to react with NT4 from rat and human, mouse and monkey.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Rabbit anti-Neurokinin-3 Receptor (NK-3R) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
FUNCTION: This is a receptor for the tachykinin neuropeptide neuromedin K (neurokinin B). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein. PTM: The anchoring of this receptor to the plasma membrane is probably mediated by the palmitoylation of a cysteine residue. MISCELLANEOUS: The rank order of affinity of this receptor to tachykinins is: neuromedin K > substance K > substance P. SIMILARITY: Belongs to the G-protein coupled receptor 1 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Rat
Immunogen:
A synthetic peptide (ASTTSSF ISSPYTSVDE YS) corresponding to the absolute C-terminal of rat NK-3 receptor protein (aa: 434-452) conjugated to KLH
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:500 to 1:2000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neuromedin K receptor; NKR; Neurokinin B receptor; NK-3 receptor; NK-3R; Tachykinin receptor 3; Tacr3; Tac3r
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity has been shown by western blot using rat brain homogenate. A band of 66 kDa, the theoretical MW of NK-3R, could be easily detected. This antiserum is know to cross react with rat NK-3 R.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Orexin-A Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
FUNCTION: Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested. Orexin-A binds to both OX1R and OX2R with a high affinity, whereas orexin-B binds only to OX2R with a similar high affinity. SUBCELLULAR LOCATION: Endoplasmic reticulum; rough endoplasmic reticulum. Associated with perikaryal rough endoplasmic reticulum as well as cytoplasmic large granular vesicles at synapses. SIMILARITY: Belongs to the orexin family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Bovine,Rat
Immunogen:
A synthetic peptide (CRLYELLHGAGNHAAGILTL) as part of Bovine Orexin A (aa: 14-33) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. This is a superb antiserum for immunohistochemistry on Orexin A containing neurons exhibiting intense labelling of neurons with very low back ground. A dilution of 1:1000 to 1:2000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Orexin-A; Hypocretin-1; Hcrt1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Kruger J.L. et al (2010) Cellular location and major terminal networks of the orexinergic system in the brains of five microchiropteran species. J Chem Neuroanat. 2010 Nov;40(3):256-62. Gaykema R.P. et al (2009) Lipopolysaccharide challenge-induced suppression of Fos in hypothalamic orexin neurons: their potential role in sickness behavior. Brain Behav Immun. 2009 Oct;23(7):926-30. Lee H.S. et al (2005) Retrograde study of hypocretin-1 (orexin-A) projections to subdivisions of the dorsal raphe nucleus in the rat. Brain Res. 2005 Oct 12;1059(1):35-45. Yao S.T. et al (2005) Water deprivation increases the expression of neuronal nitric oxide synthase (nNOS) but not orexin-A in the lateral hypothalamic area of the rat. J Comp Neurol. 2005 Sep 19;490(2):180-93.
Specificity:
The specificity for this antiserum has been confirmed by immunohistochemistry on rat brain and the results reflect the current literature. This antibody is known to react with rat Orexin A.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Nociceptin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, ELISA.
Background Info:
FUNCTION: Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Expressed predominantly in the spinal cord and brain, being more abundant in the hypothalamus and striatum. Also found in small amounts in ovary. PTM: Specific enzymatic cleavages at paired basic residues probably yield other active peptides besides nociceptin. PTM: The N-terminal domain contains 6 conserved cysteines thought to be involved in disulfide bonding and/or processing. SIMILARITY: Belongs to the opioid neuropeptide precursor family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Guinea Pig,Rat
Immunogen:
A synthetic peptide (C-TG ARKSARKLAN Q) as part of rat Nociceptin peptide (aa: 139-151) conjugated to diphtheria toxoid
Applications:
ELISA,IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC, 1-site ELISA. A dilution of 1: 1000 to 1: 3000 is recommended for both applications. This antibody may also be used for staining of nerve fibres in guinea pig myenteric plexus. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
There are no synonyms for this peptide; however the precursor protein contains: Neuropeptide 1; Nociceptin (Orphanin FQ; PPNOC; ORL1 receptor agonist); Neuropeptide 2
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity has been tested by the use of different peptides including enkephalin, dynorphin and endorphin for absorption in immunihistochemistry. This antibody is known to cross react with guinea pig and rat.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Contactin-6 Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
The neural adhesion molecule Contactin-6, also known as NB-3, is a contactin/F3 subgroup member of immunoglobulin superfamily. It is expressed exclusively in the nervous system and mainly upregulated at the early postnatal stage during mouse brain development. Employing Northern blot analysis Kamei et al found that amongst different regions of the adult human nervous system cerebellum expressed highest level of NB-3 mRNA. The expression of NB-3 in the cerebellum increases until adulthood. In contrast, the expression in the cerebrum declines to a low level after postnatal day 7. NB-3 like other neural recognition molecules plays a vitally important role in axonal guidance during development, plasticity, and maintenance of synaptic connections in the adult brain. Cui et al recently showed that NB-3 acts as a novel Notch ligand to participate in oligodendrocyte generation. Furthermore, NB-3 triggers nuclear translocation of the Notch intracellular domain and promotes oligodendrogliogenesis from progenitor cells and differentiation of oligodendrocyte precursor cells via Deltex1. In primary oligodendrocytes, NB-3 increases myelin-associated glycoprotein transcripts. Hence, the NB-3/Notch signaling pathway may be worthwhile a closer examination for its potential for the treatment of demyelinating diseases. Human NB-3 shares with rat NB-3 86% identity in nucleotide sequences and 90% identity in amino acid sequences. FUNCTION: Contactins mediate cell surface interactions during nervous system development. Participates in oligodendrocytes generation by acting as a ligand of NOTCH1. Its association with NOTCH1 promotes NOTCH1 activation through the released notch intracellular domain (NICD) and subsequent translocation to the nucleus. Involved in motor coordination. SUBCELLULAR LOCATION: Cell membrane; lipid-anchor; GPI-anchor. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Expressed in brain. In brain, it is preferentially expressed in the accessory olfactory bulb, layers II/III and V of the cerebral cortex, piriform cortex, anterior thalamic nuclei, locus coeruleus of the pons and mesencephalic trigeminal nucleus and in Purkinje cells of the cerebellum.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (GYPSPHYRWKQ) as part of mouse contactin-6 conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:1000 to 1: 4000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neural recognition molecule NB-3; mNB-3
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum stains beautifully the NB3 in DRG, where it nicely stains a subpopulation of neurons and in the trigeminal nerve root, where staining is restricted to the oligodendrocytes. Confirmed to react with rat Contactin-6 and expected to recognise human and mouse Contactin-6 as well.
Storage:
After reconstitution keep aliquots at -20°C for increased stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Rabbit anti-Myelin basic protein (MBP) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Myelin is a membrane characteristic of the nervous tissue and functions as an insulator to increase the velocity of the stimuli being transmitted between a nerve cell body and its target. Myelin isolated from human and bovine nervous tissue is composed of approximately 80% lipid and 20% protein, and 30% of the protein fraction constitutes myelin basic protein (MBP). MBP is an 'intrinsically unstructured' protein with a high proportion (approximately 75%) of random coil, but postulated to have core elements of beta-sheet and alpha-helix. MBP is a major protein in CNS myelin and is expressed specifically in the nervous system. A detailed immunochemical examination of monoclonal and polyclonal antibody responses to MBP and its peptides has revealed the existence of as many as 27 antigenic determinants, many of them conformational. Topological mapping of the potential antigenic determinants onto a model of MBP secondary structure places these determinants within 11 separate regions of the molecule, including those portions that have been found to be encephalitogenic. The message for myelin basic protein is selectively translocated to the ends of the cell processes. Immunization with myelin-associated antigens including MBP significantly promotes recovery after spinal cord contusion injury in the rat model. FUNCTION: Is, with PLP, the most abundant protein component of the myelin membrane in the CNS. Has a role in both the formation and stabilization of this compact multilayer arrangement of bilayers. Each splice variant and charge isomer may have a specialized function in the assembly of an optimized, biochemically functional myelin membrane (By similarity). SUBUNIT: Homodimer (By similarity). SUBCELLULAR LOCATION: Myelin membrane; peripheral membrane protein; cytoplasmic side. Cytoplasmic side of myelin. TISSUE SPECIFICITY: Found in both the central and the peripheral nervous system.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Guinea Pig,Human,Rat
Immunogen:
A synthetic peptide (YG SLPQKSQRSQ DENPVV, aa: 68-86) as part of guinea pig MBP protein conjugated to KLH
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:1000 to 1:4000 is recommended. Immunostaining for MBP of abnormal appearing oligodendrocytic process and cell bodies in demyelinating areas. This antibody recognises only areas of myelin degeneration when tested in injured spinal cord and lesioned sciatic nerves. It also stains discrete white matter in the brain of multiple system atrophy. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Myelin Basic Protein
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum recognizes MBP in demyelinated nerve tissues. Immunohistochemical analysis of lesioned rat spinal cord indictaes a high level of specificity for this antiserum. This antiserum reacts with human and rat MBP.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
DBH is an oxireductase belonging to the copper type II ascorbate-dependent monooxygenase family. DBH exists as a homotetramer composed of two non-covalently bound disulfide-linked dimers. It is present in the synaptic vesicles of postganglionic sympathetic neurons and converts dopamine to norepinephrine. It binds 2 copper ions and 1 PQQ per subunit . Depending on the presence of a signal peptide, DBH can exist in both soluble and membrane-bound forms.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Bovine,Guinea Pig,Human,Rat
Immunogen:
Native enzyme prepared from Bovine adrenal glands. Purity was greater than 95% by PAGE.
Applications:
IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC (frozen), Western Blot, radioimmunoassay and inhibition of enzymatic activity. Recommended to be used at a dilution of 1:500 to 1: 2000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Bowolaksono A. (2012) Molecular Regulation of Noradrenaline in Bovine Corpus Luteum. HAYATI Journal of Biosciences June 2012 Vol. 19 No. 2, p 81-87 Blanco-Centurion C. et al (2004) Effects of hypocretin2-saporin and antidopamine-beta-hydroxylase-saporin neurotoxic lesions of the dorsolateral pons on sleep and muscle tone. Eur J Neurosci. 2004 May;19(10):2741-52. Ohshita N. et al (2004) Characteristics of the trigeminal depressor response in cats. J Neurosci Res. 2004 Jun 15;76(6):891-901.
Specificity:
This antiserum has been extensively characterised in several laboratories. It reacts with a single band on western blot of bovine adrenal homogenates and stains only cells known to contain DBH, such as sympathetic neurons, adrenal medullary cells and central adrenergic neurons. Staining is abolished by preincubation with the enzyme. This antibody is known to react with bovine, human, guinea pig and rat DBH.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Rabbit anti-Autophagy protein 5 (ATG5) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Required for autophagy. Conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and autophagosome. The conjugate detaches from the membrane immediately before or after autophagosome formation is completed. FUNCTION: May play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity. SUBCELLULAR LOCATION: Cytoplasm. Colocalizes with nonmuscle actin. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Ubiquitous. The mRNA is present at similar levels in viable and apoptotic cells, whereas the protein is dramatically highly expressed in apoptotic cells. INDUCTION: By apoptotic stimuli. PTM: Conjugated to ATG12; which is essential for autophagy, but is not required for association with isolation membrane. SIMILARITY: Belongs to the ATG5 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide corresponding to the C-terminal of human ATG-5L. No immunogenic carrier protein was conjugated to the immunogen. Instead, Adjukine B has been used to orchestrate/boost the immune response.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence, WB. A dilution of 1:200 to 1:1000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Autophagy protein 5; APG5-like; APG 5; Apoptosis-specific protein; APG5; ATG5; APG5L; ASP
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
E.N. Wilson et al (2011) A Switch Between Cytoprotective and Cytotoxic Autophagy in the Radiosensitization of Breast Tumor Cells by Chloroquine and Vitamin D. Horm Cancer. 2011 Sep 2. Bristol ML et al (2012) Dual functions of autophagy in the response of breast tumor cells to radiation: cytoprotective autophagy with radiation alone and cytotoxic autophagy in radiosensitization by vitamin D 3. Autophagy. 2012 May 1;8(5):739-53. Guido C et al (2012) Metabolic reprogramming of cancer-associated fibroblasts by TGF-? drives tumor growth: connecting TGF-_ signaling with "Warburg-like" cancer metabolism and L-lactate production. Cell Cycle. 2012 Aug 15;11(16):3019-35.
Specificity:
IHC and WB confirmed the specificity for ATG5. Human, not yet tested in other species.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Autophagy-related protein 12 (ATG12) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Required for autophagy. SUBUNIT: Conjugated to ATG5. SUBCELLULAR LOCATION: Cytoplasm. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Ubiquitous. SIMILARITY: Belongs to the ATG12 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide corresponding to the N-terminal of human ATG12 protein has been used as the immunogen. No immunogenic carrier protein was conjugated to the immunogen. Instead, Adjukine B (see the Adjuvants in biosensis' product list) has been used to orchestrate/boost the immune response.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence, WB. A dilution of 1:200 to 1:1000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Autophagy-related protein 12; APG12-like; APG 12; ATG12; APG12; APG12L
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
IHC and WB confirmed the specificity for ATG12. Human, rat
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Parkinson disease protein 2 (Parkin) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, ELISA.
Background Info:
FUNCTION: Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. These substrates include SYT11, CCNE1, GPR37, STUB1, a 22 kDa O-linked glycosylated isoform of SNCAIP and SEPT5. May play a more general role in the ubiquitin proteasomal pathway by participating in the removal and/or detoxification of abnormally folded or damaged protein. Loss of this ubiquitin ligase activity appears to be the mechanism underlying pathogenesis of PARK2. May protect neurons against alpha synuclein toxicity, proteasomal dysfunction, GPR37 accumulation, and kainate-induced excitotoxicity. May play a role in controlling neurotransmitter trafficking at the presynaptic terminal and in calcium-dependent exocytosis. Regulates cyclin E during neuronal apoptosis. May represent a tumor suppressor gene. SUBCELLULAR LOCATION: Cytoplasm. Co-localizes with STY11 in neutrites. Co-localizes with SNCAIP in brainstem Lewy bodies. TISSUE SPECIFICITY: Highly expressed in the brain including the substantia nigra. Expressed in heart, testis and skeletal muscle. Expression is down-regulated or absent in tumor biopsies, and absent in the brain of PARK2 patients. Overexpression protects dopamine neurons from kainate-mediated apoptosis.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Guinea Pig,Human,Rat
Immunogen:
A synthetic peptide (RILGEEQYNRYQQYGAEEC) as part of human Parkin conjugated to diphtheria toxoid has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, immunoblot, 1-site ELISA. A dilution of 1:500 to 1:2000 is recommended for these applications. This antiserum stains trigeminal motor neurons in rat brain stem. A 50 kDa band was identified in rat brain extract using western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Ubiquitin E3 ligase PRKN; Parkinson juvenile disease protein 2; Parkinson disease protein 2; PARK2; PRKN
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Francelin C et al (2021) BACE1 Inhibition Increases Susceptibility to Oxidative Stress by Promoting Mitochondrial Damage. Antioxidants (Basel). 10(10):1539. E. Rubio de la Torre et al (2009) Combined kinase inhibition modulates parkin inactivation. Hum Mol Genet. 2009 Mar 1;18(5):809-23. D'Agata V. et al (2009) Parkin expression profile in dopamine d3 receptor knock-out mice brains. Neurochem Res. 2009 Feb;34(2):327-32. Tamo W. et al (2007) Parkin is expressed in vascular endothelial cells. Neurosci Lett. 2007 Jun 4;419(3):199-201. Trimmer P.A. et al (2004) Parkinson's disease transgenic mitochondrial cybrids generate Lewy inclusion bodies. J Neurochem. 2004 Feb;88(4):800-12. Denison S.R. et al (2004) Alterations in the common fragile site gene Parkin in ovarian and other cancers. Oncogene. 2003 Nov 13;22(51):8370-8. Pawlyk A.C. et al (2003) Novel monoclonal antibodies demonstrate biochemical variation of brain parkin with age. J Biol Chem. 2003 Nov 28;278(48):48120-8. Horowitz J.M. et al (2001) Spatial distribution, cellular integration and stage development of Parkin protein in Xenopus brain. Brain Res Dev Brain Res. 2001 Jan 31;126(1):31-41.
Specificity:
This antiserum is known to specifically recognise Parkin shown by IHC and WB. This antibody is known to react with Parkin of guinea pig and rat.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Parkinson disease protein 2 (Parkin) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. These substrates include SYT11, CCNE1, GPR37, STUB1, a 22 kDa O-linked glycosylated isoform of SNCAIP and SEPT5. May play a more general role in the ubiquitin proteasomal pathway by participating in the removal and/or detoxification of abnormally folded or damaged protein. Loss of this ubiquitin ligase activity appears to be the mechanism underlying pathogenesis of PARK2. May protect neurons against alpha synuclein toxicity, proteasomal dysfunction, GPR37 accumulation, and kainate-induced excitotoxicity. May play a role in controlling neurotransmitter trafficking at the presynaptic terminal and in calcium-dependent exocytosis. Regulates cyclin E during neuronal apoptosis. May represent a tumor suppressor gene. SUBCELLULAR LOCATION: Cytoplasm. Co-localizes with STY11 in neutrites. Co-localizes with SNCAIP in brainstem Lewy bodies. TISSUE SPECIFICITY: Highly expressed in the brain including the substantia nigra. Expressed in heart, testis and skeletal muscle. Expression is down-regulated or absent in tumor biopsies, and absent in the brain of PARK2 patients. Overexpression protects dopamine neurons from kainate-mediated apoptosis.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (NSLIKELHHFRILGEEQ) as part of human Parkin conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1:1000 is recommended for immunohistochemistry and 1:2000 for western blot. Nice staining is achieved in neuronal and cytoplasmic granules sections treated with citrate buffer for antigen retrieval. Few inclusions are stained but these were not positively identified as Lewy bodies. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Ubiquitin E3 ligase PRKN; Parkinson juvenile disease protein 2; Parkinson disease protein 2; PARK2; PRKN
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Song Y. J. C. et al (2009). Degeneration in different parkinsonian syndromes relates to astrocyte type and astrocyte protein expression. J. Neuropathol. Exp. Neurol. Oct 2009;68(10):1073-1083 Huang Y. et al (2008). LRRK2 and parkin immunoreactivity in multiple system atrophy inclusions. Acta Neuropathol. 2008 Dec;116(6):639-46.
Specificity:
This antiserum is known to be highly specific for Parkin shown by IHC and WB. This antibody is known to react with rat and human Parkin.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Ubiquitin-like protein which binds to a wide range of target proteins. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Involved in targeting RANGAP1 to the nuclear pore complex protein RANBP2. SUBUNIT: Covalently attached to a number of proteins such as PmL, RANGAP1, HIPK2, SP100, p53, p73alpha, MDM2, JUN and DNMT3B. Also interacts with HIF1A, HIPK2, HIPK3, CHD3, PIAS1, EXOSC9, TDG, RAD51 and RAD52. SUBCELLULAR LOCATION: Nucleus; nuclear membrane. Nucleus; nucleoplasm; nuclear speckle. Cytoplasm. SIMILARITY: Belongs to the ubiquitin family. SMT3 subfamily. SIMILARITY: Contains 1 ubiquitin-like domain.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (AKPSTEDLGDKKEGEY) as part of human SUMO-1 peptide (aa: 6-21) conjugated to diphtheria toxoid has been used as the immunogen. This antigen is homologous with SUMO-1 of rat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1:1000 to 1:2000 is recommended for immunohistochemistry and 1:2000 to 1:4000 for western blot. Cell lysate from Hela and NIH-3T3 cell lysates may be used as a positive control, and for IHC, lung carcinoma may be used. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Small ubiquitin-related modifier 1; Ubiquitin-like protein SMT3C; SMT3 homolog 3; Ubiquitin-homology domain protein PIC1; Ubiquitin-like protein UBL1; GAP-modifying protein 1; GMP1; Sentrin; SUMO1; SMT3C; SMT3H3; UBL1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum recognises human SUMO-1 and not ubiquitin. This antiserum is known to cross react with rat and human SUMO-1.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Synphilin-1 (Sph1) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Synuclein alpha interacting protein (Synphilin-1) contains several protein-protein interaction domains and interacts with alpha synuclein in neurons. Mutations of SNCAIP have been linked to Parkinson disease. The amino acid sequence of synphilin-1 shares a high level of identity with its human counterpart, particularly in regions containing ankyrin-like motifs and the coiled-coil domain. Expression pattern of synphilin-1 in tissues is similar in both mouse and human. Synphilin-1 has an important role in the formation of aggregates and cytotoxicity in Parkinson disease and also Dorfin may be involved in the pathogenic process by ubiquitylation of synphilin-1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (SLELNGEKDKDKGRTLQRT) as part of human synphilin-1a conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1: 1000 to 1:2000 is recommended for this application. This antiserum will stain Lewy bodies in Dorsal raphe nucleus of Parkinson's diseased human brain. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A high level of specificity has been shown for this antiserum by IHC on human brain. This antiserum is known to react with rat and human synphilin-1a.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Synphilin-1 (Sph1) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Synuclein alpha interacting protein (Synphilin-1) contains several protein-protein interaction domains and interacts with alpha synuclein in neurons. Mutations of SNCAIP have been linked to Parkinson disease. The amino acid sequence of synphilin-1 shares a high level of identity with its human counterpart, particularly in regions containing ankyrin-like motifs and the coiled-coil domain. Expression pattern of synphilin-1 in tissues is similar in both mouse and human. Synphilin-1 has an important role in the formation of aggregates and cytotoxicity in Parkinson disease and also Dorfin may be involved in the pathogenic process by ubiquitylation of synphilin-1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (CASKGKNKAA) as part of human synphilin-1a conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1: 1000 to 1:2000 is recommended for immunohistochemistry and 1:500-1:1000 for western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A high level of specificity has been shown for this antiserum by IHC on human brain. This antiserum is known to react with rat and human synphilin-1a.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Tyrosine Hydroxylase (TH) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Tyrosine hydroxylase (TH) is the rate-limiting enzyme in the synthesis of the catecholamines dopamine, epinephrine and norepinephrine. Therefore the regulation of the TH enzyme represents the central means for controlling the synthesis of these important catecholamines. FUNCTION: Plays an important role in the physiology of adrenergic neurons. CATALYTIC ACTIVITY: L-tyrosine + tetrahydrobiopterin + O2 = 3,4-dihydroxy-L-phenylalanine + 4a-hydroxytetrahydrobiopterin. COFACTOR: Fe(2+) ion. ENZYME REGULATION: Phosphorylation leads to an increase in the catalytic activity. PATHWAY: Catecholamine biosynthesis; first step. SUBUNIT: Homotetramer. PTM: In vitro, phosphorylation of Ser-19 increases the rate of Ser-40 phosphorylation, which results in enzyme opening and activation. SIMILARITY: Belongs to the biopterin-dependent aromatic amino acid hydroxylase family. The presence of different DNA sequences at the TH locus confers susceptibility to various disorders of the brain including manic-depression and schizophrenia. Parkinson's disease is also considered a TH deficiency as low dopamine levels are a consistent neurochemical abnormality.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Guinea Pig,Mouse,Rat
Immunogen:
A synthetic peptide (PRFIGRRQSLIEDARK) as part of human Tyrosine Hydroxylase (63-78) conjugated to KLH has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from TH protein in rat (31-47).
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
<b>Immunohistochemistry (IHC):</b> 1:2,000 to 1:5,000, dilutions of up to 1:100,000 have been reported. This is a superb antibody for detection of tyrosine hydroxylase (TH) containing neurons exhibiting an intense labelling with a negligible background. This antiserum has proven extremely useful for staining of catecholaminergic neurons. It stains nicely and intensely dendritic processes and fine nerve terminals. We recommend mouse or rat brain containing catecholaminergic neurons as a positive control for this antibody, for example brain stem or striatum. <br><b>Western blotting (WB)</b>: 1:100 to 1:500. Antibody has been tested on RIPA-extracted PC12 cell lysate and shown to be specific for TH (~60 kDa). Tissue homogenates show a higher level of non-specific binding and presence of uncharacterized bands. Affinity-purified anti-TH antibody (R-148-50) is recommended for tissue homogenates. <br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Pierre S.R., Lemmens M.A., Figueiredo-Pereira M.E. (2009) Subchronic infusion of the product of inflammation prostaglandin J2 models sporadic Parkinson's disease in mice J Neuroinflammation. Jul 25;6:18 Takeoka A. et al (2010) Noradrenergic innervation of the rat spinal cord caudal to a complete spinal cord transection: effects of olfactory ensheathing glia J Exp Neurol. 2010 Mar;222(1):59-69. Brown R.E. et al (2008) Characterization of GABAergic neurons in rapid-eye-movement sleep controlling regions of the brainstem reticular formation in GAD67-green fluorescent protein knock-in mice. Eur J Neurosci. 2008 Jan;27(2):352-63. Bisem NJ et al (2012) Mapping of FGF1 in the Medulla Oblongata of Macaca fascicularis. Acta Histochem Cytochem. 2012 Dec 26;45(6):325-34.
Specificity:
IHC on brain shows a pattern of staining specific for TH containing neurons. This antibody is known to react with rat, mouse and guinea pig. Cross reactivity with other species has not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by g proteins which activate adenylyl cyclase. PTHR2 may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTHR2 presence in neurons indicates that it may function as a neurotransmitter receptor. SUBUNIT: Binds to TIPF39/TIP39. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein. TISSUE SPECIFICITY: Abundantly expressed in brain, arterial and cardiac endothelium. Found as well in sperm, in the head of the epididymis. Lower expression is found in vascular smooth muscle, exocrine pancreas, testis and placenta. SIMILARITY: Belongs to the G-protein coupled receptor 2 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Rat
Immunogen:
A synthetic peptide (RQIDSHVTLPGYVWSSSEQDC) of rat Parathyroid hormone receptor protein (aa: 481-501) conjugated to KLH has been used as the immunogen.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:500 to 1:1000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity has been shown by western blot. A band of 63 kDa corresponding to the theoretical molecular weight of Parathyroid hormone receptor is easily detectable by WB. Absorption of the antiserum with the immunising peptide abolished the binding of the antibody to the target hence detectability of the band. This antibody is known to react with rat Parathyroid hormone receptor.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Tyrosine Kinase Receptor B (TrkB) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
FUNCTION: Receptor for brain-derived neurotrophic factor (BDNF), neurotrophin-3 and neurotrophin-4/5 but not nerve growth factor (NGF). Involved in the development and/or maintenance of the nervous system. This is a tyrosine-protein kinase receptor. Known substrates for the TRK receptors are SHC1, PI-3 kinase, and PLC-gamma-1. CATALYTIC ACTIVITY: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. SUBUNIT: Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures (By similarity). Binds APS. Interacts with SQSTM1. SUBCELLULAR LOCATION: Membrane; single-pass type I membrane protein. ALTERNATIVE PRODUCTS: 3 named isoforms produced by alternative splicing. Additional isoforms seem to exist. TISSUE SPECIFICITY: The different forms are differentially expressed in various cell types. Isoform T2 is primarily expressed in neurons. PTM: Ligand-mediated auto-phosphorylation. SIMILARITY: Belongs to the Tyr protein kinase family. Insulin receptor subfamily. SIMILARITY: Contains 2 Ig-like C2-type (immunoglobulin-like) domains. SIMILARITY: Contains 2 LRR (leucine-rich) repeats. SIMILARITY: Contains 1 protein kinase domain.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (AFPRLEPNSIDPEN(C)) as part of rat TrkB protein (aa: 54-67) conjugated to KLH
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:1000 to 1:3000 is recommended for this application. For WB, a 1:500 to 1:1000 dilution is recommended. The sequence of the immunogen and the conjugate are identical to the one used by Yan et al (see the Refs) and the antiserum appears to have similar characteristics. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Warren PM et al. (2018) "Rapid and robust restoration of breathing long after spinal cord injury." Nat Commun. 2018 Nov. PMID: 30482901 9(1):4843. Application: IHC/IF. Species: Rat, spinal cord sections. Wang T et al. (2016) "Flux of signalling endosomes undergoing axonal retrograde transport is encoded by presynaptic activity and TrkB." Nat Commun. 2016 Sep. PMID: 27687129 30(7):12976. Application: IF & structured illumination microscopy (SIM). Species: Rat, Mouse; fixed 4% PFA with 4% sucrose Matusica D et al. (2016) Inhibition of motor neuron death in vitro and in vivo by a p75 neurotrophin receptor intracellular domain fragment. J Cell Sci. 2016 Feb 1;129(3):517-30. Application: WB. Brock JH et al. (2010) Local and remote growth factor effects after primate spinal cord injury. J Neurosci. 2010 Jul 21;30(29):9728-37. Gruber H. et al. (2008) Brain-derived neurotrophic factor and its receptor in the human and the sand rat intervertebral disc. Arthritis Res Ther. 2008; 10(4): R82.
Specificity:
Sequence was chosen to avoid cross reactivity with TrkA and TrkC. This antiserum recognises human, rat and mouse TrkB. Cross reactivity with other species has not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Noxa Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
The Bcl-2 family of proteins which regulate apoptosis share identical sequences called Bcl-2 Homology domains (BH1-4). The BH3 proteins, including BID, NOXA, PUMA, BIK, BIM and BAD are all pro-apoptotic and share sequence identity within the amphipathic alpha-helical BH3 region, which is essential for their apoptotic function. NOXA is highly expressed in adult T-cell leukemia cell line.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Mouse
Immunogen:
A synthetic peptide (MPGRKARRNA PVNPTR) as part of mouse Noxa (aa: 1-16) conjugated to diphtheria toxoid
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:1000 to 1:2000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
PMAIP1; phorbol-12-myristate-13-acetate-induced protein 1; adult T cell leukemia-derived PMA-responsive; Immediate-early-response protein APR; PMA-induced protein 1; Pmaip1; Noxa
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Western blot analysis of cells infected with Noxa adenoviruses and BAF indicates a high level of specificity for this antiserum. This antiserum cross-reacts with mouse. Not yet tested in other species.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Noxa Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
The Bcl-2 family of proteins which regulate apoptosis share identical sequences called Bcl-2 Homology domains (BH1-4). The BH3 proteins, including BID, NOXA, PUMA, BIK, BIM and BAD are all pro-apoptotic and share sequence identity within the amphipathic alpha-helical BH3 region, which is essential for their apoptotic function. NOXA is highly expressed in adult T-cell leukemia cell line.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Mouse
Immunogen:
A synthetic peptide (CAQLRR IGDKVNLRQK) as part of mouse Noxa (aa: 75-90) conjugated to diphtheria toxoid
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:1000 to 1:2000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
PMAIP1; phorbol-12-myristate-13-acetate-induced protein 1; adult T cell leukemia-derived PMA-responsive; Immediate-early-response protein APR; PMA-induced protein 1; Pmaip1; Noxa
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Western blot analysis of cells infected with Noxa adenoviruses and BAF indicates a high level of specificity for this antiserum. This antiserum cross-reacts with mouse. Not yet tested in other species.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Destroys radicals which are normally produced within the cells and which are toxic to biological systems. CATALYTIC ACTIVITY: 2 superoxide + 2 H+ = O2 + H2O2. COFACTOR: Binds 1 copper ion per subunit. COFACTOR: Binds 1 zinc ion per subunit. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. DISEASE: Defects in SOD1 are the cause of familial amyotrophic lateral sclerosis (FALS); also called amyotrophic lateral sclerosis 1 (ALS1 or ALS). ALS is a degenerative disorder of motorneurons in the cortex, brainstem and spinal cord. ALS is characterized by muscular weakness and atrophy beginning in the hands and spreading to the forearms and legs. Muscle fasciculations are commonly visible. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. ALS is sometimes referred to as Lou Gehrig disease after the famous American baseball player who was diagnosed with the disorder. FALS, the familial form of ALS, accounts for about 10% of the cases and is transmitted in an autosomal dominant manner. The mean age at onset of FALS is 45 years. MISCELLANEOUS: Zinc binding promotes dimerization. SIMILARITY: Belongs to the Cu-Zn superoxide dismutase family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (ESNGPVK VWGSIK) as part of human superoxide dismutase (SOD1) protein (aa: 24-36) conjugated to diphtheria toxoid
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:500 to 1:1000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Superoxide dismutase [Cu-Zn]; SOD1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity was confirmed by western blot detecting human superoxide dismutase (SOD1). This antiserum is known to react with human superoxide dismutase (SOD1).
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Destroys radicals which are normally produced within the cells and which are toxic to biological systems. CATALYTIC ACTIVITY: 2 superoxide + 2 H+ = O2 + H2O2. COFACTOR: Binds 1 copper ion per subunit. COFACTOR: Binds 1 zinc ion per subunit. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. DISEASE: Defects in SOD1 are the cause of familial amyotrophic lateral sclerosis (FALS); also called amyotrophic lateral sclerosis 1 (ALS1 or ALS). ALS is a degenerative disorder of motorneurons in the cortex, brainstem and spinal cord. ALS is characterized by muscular weakness and atrophy beginning in the hands and spreading to the forearms and legs. Muscle fasciculations are commonly visible. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. ALS is sometimes referred to as Lou Gehrig disease after the famous American baseball player who was diagnosed with the disorder. FALS, the familial form of ALS, accounts for about 10% of the cases and is transmitted in an autosomal dominant manner. The mean age at onset of FALS is 45 years. MISCELLANEOUS: Zinc binding promotes dimerization. SIMILARITY: Belongs to the Cu-Zn superoxide dismutase family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
A synthetic peptide (ASGEPVV LSGQIT) as part of mouse superoxide dismutase (SOD1) protein (aa: 24-36) conjugated to diphtheria toxoid
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:500 to 1:1000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Superoxide dismutase [Cu-Zn]; SOD1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Park KH et al. (2013) Postnatal muscle modification by myogenic factors modulates neuropathology and survival in an ALS mouse model. Nat Commun. 2013;4:2906.
Specificity:
Specificity was confirmed by western blot detecting mouse superoxide dismutase (SOD1). This antiserum is known to react with mouse and rat superoxide dismutase (SOD1) protein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Contactin-6 Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
The neural adhesion molecule Contactin-6, also known as NB-3, is a contactin/F3 subgroup member of immunoglobulin superfamily. It is expressed exclusively in the nervous system and mainly upregulated at the early postnatal stage during mouse brain development. Employing Northern blot analysis Kamei et al found that amongst different regions of the adult human nervous system cerebellum expressed highest level of NB-3 mRNA. The expression of NB-3 in the cerebellum increases until adulthood. In contrast, the expression in the cerebrum declines to a low level after postnatal day 7. NB-3 like other neural recognition molecules plays a vitally important role in axonal guidance during development, plasticity, and maintenance of synaptic connections in the adult brain. Cui et al recently showed that NB-3 acts as a novel Notch ligand to participate in oligodendrocyte generation. Furthermore, NB-3 triggers nuclear translocation of the Notch intracellular domain and promotes oligodendrogliogenesis from progenitor cells and differentiation of oligodendrocyte precursor cells via Deltex1. In primary oligodendrocytes, NB-3 increases myelin-associated glycoprotein transcripts. Hence, the NB-3/Notch signaling pathway may be worthwhile a closer examination for its potential for the treatment of demyelinating diseases. Human NB-3 shares with rat NB-3 86% identity in nucleotide sequences and 90% identity in amino acid sequences. FUNCTION: Contactins mediate cell surface interactions during nervous system development. Participates in oligodendrocytes generation by acting as a ligand of NOTCH1. Its association with NOTCH1 promotes NOTCH1 activation through the released notch intracellular domain (NICD) and subsequent translocation to the nucleus. Involved in motor coordination. SUBCELLULAR LOCATION: Cell membrane; lipid-anchor; GPI-anchor. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Expressed in brain. In brain, it is preferentially expressed in the accessory olfactory bulb, layers II/III and V of the cerebral cortex, piriform cortex, anterior thalamic nuclei, locus coeruleus of the pons and mesencephalic trigeminal nucleus and in Purkinje cells of the cerebellum. DEVELOPMENTAL STAGE: Highly expressed after birth, reaching a maximum at the postnatal day 7, and declines thereafter in the cerebrum, whereas it increases in the cerebellum to adulthood.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Rat
Immunogen:
A synthetic peptide (KLHKMSSLSSVGVQILKPSTQF) as part of rat contactin-6 conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:1000 to 1: 5000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neural recognition molecule NB-3; mNB-3
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum stains beautifully the NB3 in DRG, where it nicely stains a subpopulation of neurons and in the trigeminal nerve root, where staining is restricted to the oligodendrocytes. Confirmed to react with rat Contactin-6
Storage:
After reconstitution keep aliquots at minus 20ºC for increased stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Influenza hemagglutin (HA) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
The Human influenza hemagglutin (HA) tag corresponds to a region (98-106 amino acids) from the HA molecule.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Host Animal:
Rabbit
Species Reactivity:
Species Independent
Immunogen:
The antiserum was produced by immunizing rabbit with synthesized peptide containing the influenza hemagglutinin epitope (YPYDVPDYA).
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting at a suggested dilution 1:500~1:1000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Antibody detects HA-tagged proteins (on amino- and carboxy termini) in transfected mammalian cells.
Storage:
Stable for 1 year at -20°C from the date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to opening the cap. Aliquot to avoid repeated freezing and thawing.
Purification:
The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific peptide.
The 6X His tag is a short peptide sequence of 6 histidine residues. Epitopes such as the 6X His tag are often included with the target DNA at the time of cloning to produce fusion proteins containing the tag sequence. This allows anti-epitope tag antibodies such as this one to serve as a universal detection reagent for any recombinant protein containing this tag. Anti-epitope antibodies are a useful alternative to generating antibodies to identify a specific recombinant protein. The 6X His motif is often used as a tag on recombinant proteins to facilitate purification with immobilized metal-affinity chromatography.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS, pH 7.4 with 0.02% sodium azide.
Host Animal:
Rabbit
Species Reactivity:
Species Independent
Immunogen:
The antiserum was produced by immunizing rabbit with synthesized peptide containing 6 Histidine residues.
Applications:
ELISA,ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
ELISA, WB, IP, IF, IHC. Western Blotting at a suggested concentration of 1:500~1:1000. ELISA at a suggested concentration of 1: 2500. IP 5 µg/sample. IF 5 µg/mL. IHC 5 µg/mL. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
His-tagged fusion proteins
Storage:
Stable for 1 year at -20°C from the date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to opening the cap. Aliquot to avoid repeated freezing and thawing.
Rabbit anti-Maltose-Binding Protein Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Maltose binding protein (MBP) is encoded by the malE gene of E.coli. MBP is often used in protein expression studies because it creates a stable fusion product that does not appear to interfere with the bioactivity of the protein of interest. It also allows for its easy purification from bacterial extracts under mild conditions.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS, pH 7.4 with 0.05% sodium azide
Host Animal:
Rabbit
Species Reactivity:
Species Independent
Immunogen:
MBP epitope tag recombinant protein.
Applications:
ELISA,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and ELISA. Suggested starting dilutions for WB of 1:1,000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody recognizes the MBP epitope tag fused to the amino- or carboxy- termini of targeted proteins.
Storage:
Stable for 1 year at -20°C from the date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to opening the cap. Aliquot to avoid repeated freezing and thawing.
Rabbit anti-Myc Tag Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
The Myc tag contains the amino acids Glu-Gln-Lys-Leu-Ile-Ser-Glu-Glu-Asp-Leu (E-Q-K-L-I-S-E-E-D-L) corresponding to amino acids 410-419 of human Myc. This tag is widely used for monitoring expression of recombinant proteins in bacteria, insect and mammalian cells.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS, pH 7.4 with 0.05% sodium azide. For maximum recovery of product, centrifuge the original vial after thawing and prior to opening the cap.
Host Animal:
Rabbit
Species Reactivity:
Species Independent
Immunogen:
Myc epitope tag peptide
Applications:
ELISA,WB
Antibody Isotype:
IgG
Application Details:
ELISA and Western Blotting (WB). Suggested dilutions for ELISA at 1:1,000 and WB 1:500 - 1:1,000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Martel, D. et al. (2017) Characterisation of Casein Kinase 1.1 in Leishmania donovani Using the CRISPR Cas9 Toolkit. BioMed Res. Int. 2017 Article ID 4635605. Application: WB
Specificity:
This polyclonal anti-Myc-tag antibody detects overexpressed proteins containing the Myc epitope tag. The antibody recognizes the Myc-tag fused to either the amino- or carboxy- termini of targeted proteins in transfected or transformed cells.
Storage:
Maintain at -20°C prior to opening for up to 1 year. The product is also stable at 2-8°C undiluted for several weeks. After opening store at -20°C in undiluted aliquots for up to six months. For maximum recovery of product, centrifuge the original vial after thawing and prior to opening the cap. Avoid repeated freezing and thawing.
Adiponectin Receptors 1 and 2 are membrane receptors for adiponectin, a hormone secreted by adipocytes which regulates energy homeostatis and insulin sensitivity.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. 15% glycerol
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
The intracellular portion of mouse Adiponectin Receptor 1 protein (amino acids: 4-142) conjugated to GST.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting. A dilution of 1:2000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Adipor1; AdipoR1; Progestin and adipoQ receptor family member I; ADIPOR1; PAQR1;TESBP1A; CGI-45;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum is known to recognise both mouse and human Adiponectin Receptor 1.
Storage:
Aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Adiponectin Receptors 1 and 2 are membrane receptors for adiponectin, a hormone secreted by adipocytes which regulates energy homeostatis and insulin sensitivity.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. 15% glycerol
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
Human Adiponectin Receptor 2 protein (amino acids: 78-219) conjugated to GST.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting. A dilution of 1:2000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Progestin and adipoQ receptor family member II; ADIPOR2; PAQR2;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum is known to recognise both mouse and human Adiponectin Receptor 2.
Storage:
Aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1 (APPL1) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
APPL1 (adaptor protein containing PH domain, PTB domain and leucine zipper motif 1) mediates adiponectin signaling in various types of cells. APPL1 is also thought to have a role in insulin signaling.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
The C-terminus of Human APPL1 protein (amino acids: 455-709) conjugated to GST.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunoprecipitation (IP). A dilution of 1:1,000 is recommended for WB. A concentration of 3 µL/reaction is recommended for IP. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
DCC-interacting protein 13-alpha; Dip13-alpha; Adapter protein containing PH domain; PTB domain and leucine zipper motif 1; APPL1; APPL; DIP13A; KIAA1428;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum is known to recognise both mouse and human APPL1.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
Adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1 (APPL1)
Rabbit anti-Adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 2 (APPL2) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
APPL2 is an isoform of APPL1 with 54% identity in their protein sequences. APPL2 has a role in cell proliferation and embryonic development. Recently, it was shown that APPL2 regulates FSH signaling and acts as a negative regulator in adiponectin signaling.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. 15% glycerol
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
Mouse APPL2 protein (amino acids: 619-662) conjugated to GST.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunoprecipitation (IP). A dilution between 1:2500 and 1:5000 is recommended for WB. A concentration of 3 µL/reaction is recommended for IP. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
DCC-interacting protein 13-beta; Dip13-beta; Adapter protein containing PH domain; PTB domain and leucine zipper motif 2; APPL2; DIP13B;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum is known to recognise both mouse and human APPL2.
Storage:
Aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
Adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 2 (APPL2)
Rabbit anti-PRKR-like endoplasmic reticulum kinase (phosphorylated and non phosphorylated) (PERK) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
PERK (PKR-like ER kinase) is a single-pass type I ER membrane protein with a stress-sensing luminal domain connected by a transmembrane segment to a cytoplasmic-kinase domain.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. 50% glycerol
Host Animal:
Rabbit
Species Reactivity:
Mouse
Immunogen:
A recombinant peptide from mouse PERK.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunoprecipitation (IP). A dilution of 1:500 is recommended for WB. A dilution of 30 µL of antibody in a total reaction mixture of 500 µL is recommended for IP. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Feliziani C. et al (2022) Ca2+ signalling system initiated by Endoplasmic reticulum stress stimulates PERK activation Cell Calcium. 2022 [Epub ahead of print] Bollo M. et al (2010) Calcineurin interacts with PERK and dephosphorylates calnexin to relieve ER stress in mammals and frogs PLoS One. 2010 Aug 5;5(8)
Specificity:
This antiserum is known to recognise both phosphorylated and non phosphorylated mouse PERK.
Storage:
Aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
PRKR-like endoplasmic reticulum kinase (phosphorylated and non phosphorylated) (PERK)
Rabbit anti-Coronin- 1A Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Coronins belong to the WD40 or WD family of proteins. Coronins appear to be particularly involved in binding to actin, actin associated proteins, tubulin and phospholipase C and have been implicated in the mechanisms of chemotaxis and phagocytosis. In mammals there are at least five major coronin proteins, named coronins 1 to 5 in one nomenclature. Another nomenclature divides these five proteins in coronins 1a and 1b, 2a, 2b and 2c (see the Human Genone Organization Gene Nomenclature Committee link for this family). The mammalian coronin family members are abundant components of eukaryotic cells and each type has a restricted cell type specific expression pattern. Coronin 1A is found exclusively in hematopoetic lineage cells such as lymphocytes, macrophages and neutrophils. This antibody is therefore an excellent marker of cells of this lineage and can also be used to study the leading edges particularly of neutrophils. Since the only hematopoetic cells found within the central nervous system are microglia, this antibody is also an excellent marker of this important cell type. Microglia are numerically fairly minor components of the nervous system, but microglial activation is seen in response to a wide variety of damage and disease states, including ALS, Alzheimer's disease and responses to brain tumors. Since coronin 1a is a constitutive component of microglia, the coronin 1a antibody can be used to study both quiescent and activated microglia.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Pig,Rat
Immunogen:
C-terminal peptide of human coronin 1a coupled to KLH
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:2,500-5,000 is recommended for WB. Human Coronin 1A has a predicted length of 461 residues and a MW of 51 kDa. A concentration of 1:500-1:1,000 is recommended for ICC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Coronin-1A; Coronin-like protein A; Clipin-A; Coronin-like protein p57; Tryptophan aspartate-containing coat protein; TACO; CORO1A; CORO1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Stephens A.N. et al (2010) Post-translational modifications and protein-specific isoforms in endometriosis revealed by 2D DIGE. J Proteome Res. 2010 May 7;9(5):2438-49. Ahmed Z. et al (2007) Actin-binding proteins coronin-1a and IBA-1 are effective microglial markers for immunohistochemistry. J Histochem Cytochem. 2007 Jul;55(7):687-700.
Specificity:
The specificity of this antibody has been confirmed by WB and ICC against the antigen. Human, Rat, Mouse and Feline. Predicted to react with other mammalian tissue.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Glial Fibrillary Acidic Protein (GFAP) Polyclonal Antibody (Unconjugated), suitable for WB, ICC, IHC-Frozen.
Background Info:
GFAP is a 50 kDa intra-cytoplasmic filamentous protein of the cytoskeleton in astrocytes. During the development of the central nervous system, it is a cell-specific marker that distinguishes astrocytes from other glial cells. GFAP immunoreactivity has been shown in immature oligodendrocytes, epiglottic cartilage, pituicytes, papillary meningiomas, myoepithelial cells of the breast and in non-CNS: Schwann cells, salivary gland neoplasms, enteric glia cells, and metastasizing renal carcinomas.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Horse,Human,Mouse,Pig,Rat
Immunogen:
Recombinant full length human GFAP isotype 1 expressed in and purified from E. coli.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:5,000 is recommended for WB, and 1:1,000 - 1:5,000 for ICC and IHC. A dilution of 1:1,000 using fluorescent secondary antibodies or 1:5,000 using peroxidase or other enzyme-linked methods is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Astrocyte; Glial fibrillary acidic protein; GFAP;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Autophagy-related protein 12 (ATG12) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Required for autophagy. SUBUNIT: Conjugated to ATG5. SUBCELLULAR LOCATION: Cytoplasm. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Ubiquitous. SIMILARITY: Belongs to the ATG12 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide corresponding to the N-terminal of human ATG12 protein has been used as the immunogen. No immunogenic carrier protein was conjugated to the immunogen. Instead, Adjukine B (see the Adjuvants in biosensis' product list) has been used to orchestrate/boost the immune response.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, immunofluorescence, WB (1-5 µg/mL working concentration), Flow Cytometry (2?g/10^6 cells). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Autophagy-related protein 12; APG12-like; ATG12; APG12; APG12L
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
IHC and WB confirmed the specificity for ATG12. Human, rat
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Neurofilaments can be defined as the intermediate or 10nm diameter filaments found in neuronal cells. They are composed a mixture of subunits which often includes the neurofilament triplet proteins, NF-L, NF-M and NF-H. Neurofilaments may also include peripherin, alpha-internexin, nestin and in some cases vimentin. Alpha-internexin is a ~66 kDa Class IV intermediate filament subunit expressed in large amounts early in neuronal development, but is downregulated in many neurons as development procedes. Many classes of mature neurons contain alpha-internexin in addition to NF-L, NF-M and NF-H. In some mature neurons alpha-internexin is the only neurofilament subunit expressed. Antibodies to alpha-internexin are therefore unique probes to study and classify neuronal types and follow their processes in sections and in tissue culture. In addition the very early developmental expression of alpha-internexin means its presence is an early and convenient diagnostic feature of neuronal progenitors cells and other cell committed to the neuronal lineage.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Cat,Human,Mouse,Other Mammals,Rat
Immunogen:
Recombinant alpha-internexin expressed and purified from E. coli
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:10,000 - 1:20,000 is recommended for WB. A dilution of 1:500-1,000 is recommended for ICC and IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB. This antibody is specific for the 64-66 kDa alpha-internexin protein. Molecular weight will depend on species. Hu, Rat, Ms, Fel, and other mammals
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Myristoylated alanine rich C kinase substrate (MARCKS) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Myristoylated alanine-rich C-kinase substrate (MARCKS) is the most prominent cellular substrate for protein kinase C. This protein binds calmodulin, actin, and synapsin. MARCKS is a filamentous (F) actin cross-linking protein. Ref: SWISSPROT.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant full length MARCKS expressed and purified from E. coli
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (IC). A dilution of 1:10,000 - 20,000 is recommended for WB. A dilution of 1:500-1,000 is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Myristoylated alanine-rich C-kinase substrate; MARCKS; Protein kinase C substrate 80 kDa protein;Marcks; Macs;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB. Does not react with rodent protein.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
Myristoylated alanine rich C kinase substrate (MARCKS)
Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues in association with MMP14. PEX, the C-terminal non-catalytic fragment of MMP2, posseses anti-angiogenic and anti-tumor properties and inhibits cell migration and cell adhesion to FGF2 and vitronectin. Ligand for integrinv/beta3 on the surface of blood vessels. MMP2 isoform 2 mediates the proteolysis of CHUK/IKKA and initiates a primary innate immune response by inducing mitochondrial-nuclear stress signaling with activation of the pro-inflammatory NF-kappaB, NFAT and IRF transcriptional pathways. Catalytic activity of MMP2 causes cleavage of gelatin type I and collagen types IV, V, VII, X. Cleaves the collagen-like sequence Pro-Gln-Gly-|-Ile-Ala-Gly-Gln. (Ref: uniprot.org).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Western Blotting (WB): 1:5,000 - 1:10,000. MMP2 appears as two bands at apparent molecular weights of 66 and 72 kDa. Immunohistochemistry (IHC): 1:500-1:1,000.<br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
72 kDa gelatinase; Gelatinase A; MMP-2; TBE-1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human. Expected to react with horse, cow, pig, chicken, rat and mouse MMP2.
Storage:
Store lyophilized, unopened vial at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C to -80°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Autophagy protein 5 (ATG5) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Required for autophagy. Conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and autophagosome. The conjugate detaches from the membrane immediately before or after autophagosome formation is completed. FUNCTION: May play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity. SUBCELLULAR LOCATION: Cytoplasm. Colocalizes with nonmuscle actin. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Ubiquitous. The mRNA is present at similar levels in viable and apoptotic cells, whereas the protein is dramatically highly expressed in apoptotic cells. INDUCTION: By apoptotic stimuli. PTM: Conjugated to ATG12; which is essential for autophagy, but is not required for association with isolation membrane. SIMILARITY: Belongs to the ATG5 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide corresponding to the C-terminal of human ATG-5L. No immunogenic carrier protein was conjugated to the immunogen. Instead, Adjukine B (see the Adjuvants in biosensis' product list) has been used to orchestrate/boost the immune response.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Flow Cytometry (2 ?g/10^6 cells), IHC, immunofluorescence, WB. Use a dilution of 1:200 to 1:1000 for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Autophagy protein 5; APG5-like; APG 5; APG5; Apoptosis-specific protein; ATG5; APG5L; ASP
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Villanueva-Paz M. et al. (2016) Amitriptyline induces mitophagy that precedes apoptosis in human HepG2 cells. Genes Cancer. 2016;7(7-8):260-277 Garrido-Maraver J. et al (2012) Screening of effective pharmacological treatments for MELAS syndrome using yeasts, fibroblasts and cybrids models of the disease Br J Pharmacol. 2012 Jul 2. De la Mata M. et al (2012) Recovery of MERRF fibroblasts and cybrids pathophysiology by Coenzyme Q10 Neurotherapeutics. 2012 Apr;9(2):446-63. Cotan D. et al. (2011) Secondary coenzyme Q10 deficiency triggers mitochondria degradation by mitophagy in MELAS fibroblasts FASEB J. 2011
Specificity:
IHC and wb confirmed the specificity for ATG5. Human, not yet tested in other species.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Neurofilaments contain three intermediate filament proteins: light (68 kDa), medium (160 kDa) and heavy (200 kDa). Neurofilament heavy (NF200 or NF-H) is phosphorylated and it is thought that this results in the formation of interfilament cross bridges that are important in the maintenance of axonal caliber.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Horse,Human,Mouse,Pig,Rat
Immunogen:
Native NF-H purified from bovine spinal cord
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunocytochemistry (IHC). Suggested dilution for WB of 1:5,000-10,000. Suggested dilution for ICC/IHC is 1:1,000-1:5,000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
NF-200; NF200; NF-H; NEFH; N52; Neurofilament heavy polypeptide; Neurofilament triplet H protein; 200 kDa neurofilament protein; KIAA0845; NFH;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Hashiguchi S et al. (2019) "Ataxic phenotype with altered CaV3.1 channel property in a mouse model for spinocerebellar ataxia 42." Neurobiol Dis. Jun 20:104516 [Epub ahead of print]. Application: IHC. Species: Human.
Specificity:
The specificity of this antibody has been confirmed by WB. This antibody reacts with phosphorylated NF-H and is seen as a band of approx 200 kDa. Rat. Predicted to react with other mammals due to sequence homology.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Neurofilament Heavy, phosphorylated and non-phosphorylated (pNF-H) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Neurofilaments contain three intermediate filament proteins: light (68 kDa), medium (160 kDa) and heavy (200 kDa). Neurofilament heavy (NF200 or NF-H) is phosphorylated and it is thought that this results in the formation of interfilament cross bridges that are important in the maintenance of axonal caliber.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Other Mammals (Predicted),Rat
Immunogen:
Purified rat NF-H construct containing most of the tandem KSP repeats expressed and purified from E.coli.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (IC). Suggested dilution for WB of 1:5,000-10,000. Suggested dilution for IC is 1:500-1,000. This antibody stains dendritic and perikaryal neurofilaments particularly well. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
NF-200; NF200; NF-H; NEFH; N52; Neurofilament heavy polypeptide; Neurofilament triplet H protein; 200 kDa neurofilament protein; KIAA0845; NFH;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been confirmed by WB. This antibody reacts with noth phosphorylated NF-H at approx 200 kDa and non-phosphorylated NF-H at 160 kDa. Rat. Predicted to react with other mammals due to sequence homology.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
Neurofilament Heavy, phosphorylated and non-phosphorylated (pNF-H)
Neurofilaments are composed of three intermediate filament proteins: light (~68 kDa), medium (~160 kDa) and heavy (~200 kDa), which are involved in the maintenance of the neuronal caliber. Neurofilament light (NF68 or NF-L) is the most abundant of the three proteins.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Pig,Rat
Immunogen:
Recombinant full length human NF-L protein
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:10,000 - 1:20,000 is recommended for WB. A dilution of 1:2,000 - 1:5,000 is recommended for ICC/IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rabbit anti-Neurofilament Medium (NF-M) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, ICC.
Background Info:
Neurofilaments are composed of three intermediate filament proteins: light (~68 kDa), medium (~160 kDa) and heavy (~200 kDa), which are involved in the maintenance of the neuronal caliber. Neurofilament medium runs on SDS-PAGE gels in the range 145-170 kDa, with some variation in different species.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Chicken,Horse,Human,Mouse,Pig,Rat
Immunogen:
A recombinant fusion protein containing the extreme C-terminus of rat NF-M expressed in and purified from E. coli.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:1,000 - 1:5,000 is recommended for WB, ICC and IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neurofilament medium polypeptide; NF-M; 160 kDa neurofilament protein; Neurofilament 3; Neurofilament triplet M protein; Nefm; Nef3; Nfm;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specifically recognizes the medium neurofilament subunit NF-L in WB. Band appears at ~145 kDa in WB from rodent and ~160 kDa for human and bovine WB. Hu, Rat, Ms, Fel, Chk
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Neuron specific enolase (NSE) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Enolase is a metalloenzyme that catayzes the reaction between 2-phospho-D-glycerate and phosphoenolpyruvate during glycolysis. Mammalian enolase is composed of 3 subunits; alpha, beta and gamma (Neuron-specific enolase). These subunits can form homodimers or heterodimers. The alpha/gamma heterodimer and the gamma/gamma homodimer are found primarily in neurons.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human Neuron Specific Enolase (NSE) expressed in and purified from E.coli
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:1,000 - 1:2,000 is recommended for WB. A dilution of 1:500 is recommended for ICC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rabbit anti-Microtubule-associated protein 1 light chain 3 gamma (MAP1LC3C) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, ICC.
Background Info:
FUNCTION: Probably involved in formation of autophagosomal vacuoles (autophagosomes). SUBUNIT: 3 different light chains, LC1, LC2 and LC3, can associate with MAP1A and MAP1B proteins. SUBCELLULAR LOCATION: LC3-I: Cytoplasm. LC3-II: Intracytoplasmic membrane; lipid-anchor. LC3-II binds to the autophagic membranes. TISSUE SPECIFICITY: Most abundant in placenta, lung and ovary. PTM: The precursor molecule is cleaved by APG4B/ATG4B to form the cytosolic form, LC3-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, LC3-II. SIMILARITY: Belongs to the MAP1 LC3 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (CQEEVAGIRAKF) corresponding to the N-terminal of human MAP1LC3 C conjugated to Blue Carrier Protein has been used as the immunogen. The peptide is homologous with the corresponding sequence deriven from MAP1LC3 C protein in Macaca mulatta (monkey) and Canis familiaris (dog).
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence, WB. A dilution of 1:100 to 1:1000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
IHC and WB confirmed the specificity for MAP1LC3 C . This antibody should recognise MAP1LC3 C only and not the other forms MAP1LC3A and MAP1LC3B. Human, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Whole serum
Target:
Microtubule-associated protein 1 light chain 3 gamma (MAP1LC3C)
Rabbit anti-Peripherin Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Peripherin is a class-III neuronal intermediate filament protein found in certain classes of neuron, most of which are located in the peripheral nervous system.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Pig,Rat
Immunogen:
Recombinant full length Peripherin protein expressed in and purified from E.coli.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (IC). A dilution of 1:2,000 - 1:10,000 is recommended for WB. A dilution of 1:1,00-1:2,000 is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Peripherin; Prph; Prph1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Ise H. et al (2017) Elucidation of GlcNAc-binding properties of type III intermediate filament proteins, using GlcNAc-bearing polymers. Genes Cell. 2017 Sep; [Epub ahead of print] Sekerkova G. et al (2008) Espin actin-cytoskeletal proteins are in rat type I spiral ganglion neurons and include splice-isoforms with a functional nuclear localization signal. J Comp Neurol. 2008 Aug 20;509(6):661-76.
Specificity:
The specificity of this antibody has been confirmed by WB. This antibody detects ~57 kDa Peripherin protein and a smaller molecule derived from Peripherin at ~48 kDa. Hu, Rat, Ms, Fel, Rb. Predicted to react with other mammalian tissue.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Ubiquitin Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Ubiquitin is a highly conserved 76 amino acid protein with an estimated molecular weight of 8.56 kDa which has a central role in regulated protein degradation. It is a protein modifier which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Several types of polymeric chains can be formed depending on the lysine used for the assembly. Attachment to proteins as a polymer leads to their degradation by the 26S proteosome; a complex, multicatalytic cytosolic and nuclear protease. Attachment to proteins as a monomer or as an alternatively linked polymer does not lead to proteasomal degradation and may be required for numerous functions, including maintenance of chromatic structure, regulation of gene expression, stress response, ribosome biogenesis and DNA repair. Ubiquitin is synthesized as a polyubiquitin precursor with exact head to tail repeats, the number of repeats of which differ between species and strains. In some species there is a final amino-acid after the last repeat, here in bovine a Cys. Some ubiquitin genes contain a single copy of ubiquitin fused to a ribosomal protein (either L40 or S27a).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Glutaraldehyde cross-linked ubiquitin.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:500-1,000 is recommended for ICC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB. This antibody detects ~8.5 kDa Ubiquitin. Human. Predicted to react with other mammalian tissues.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Ubiquitin C Terminal Hydrolase 1 (UCHL1) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. The enzyme also binds to free monoubiquitin and may prevent its degradation in lysosomes (ref: SWISSPROT).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Chicken,Horse,Human,Mouse,Pig,Rat
Immunogen:
Recombinant full length human Ubiquitin C Terminal Hydrolase 1 (UCHL1) purified from E. coli.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunocytochemistry (IC). A dilution of 1:1,000 - 1:2,000 is recommended for WB. A dilution of 1:500-1:1,000 is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB. This antibody detects ~24 kDa UCHL1 enzyme. Suitable control tissue is rat spinal cord or peripheral nerve homogenate. Hu, Rat, Ms, Bov, Por
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Beclin-1 Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Beclin-1 plays a central role in autophagy. It may also play a role in antiviral host defense. It is ubiquitously expressed and it localises to the cytoplasm, golgi apparatus membrane, and in dendrites and cell bodies of cerbellar Purkinje cells. The unprocessed precursor has a length of 450 amino acids and an estimated molecular weight of 51.89 kDa.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
C-terminal of human Beclin-1 conjugated to Blue Carrier Protein.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:100 to 1:2000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Coiled-coil myosin-like BCL2-interacting protein; Protein GT197; APG 6; BECN1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specific for Beclin-1. Human, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
FUNCTION: Involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1. SUBUNIT: Monomer. Interacts with GABRG2, NSF, GOSR1 and beta-tubulin. Interacts with ULK1. SUBCELLULAR LOCATION: Golgi apparatus. TISSUE SPECIFICITY: Ubiquitous. Expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. Expressed at very low levels in lung, thymus and small intestine. SIMILARITY: Belongs to the MAP1 LC3 family. ESTIMATED MOLECULAR WEIGHT: 13.667 kDa.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (CVESAKIRAKYP) corresponding to the N-terminal of human GABARAP L2 (GABARAPL2) protein has been used as the immunogen. The sequence is homologous with mouse and rat form of GABARAP L2 (GABARAPL2).
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence, WB. A dilution of 1:200 to 1:1000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Gamma-aminobutyric acid receptor-associated protein-like 2; GABA(A) receptor-associated protein-like 2; Ganglioside expression factor 2; GEF-2; General protein transport factor p16; MAP1 light chain 3-related protein; GABARAPL2; FLC3A; GEF2;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
IHC, WB and ELISA confirmed the specificity for GABARAP L2 (GABARAPL2). A 14 kDa band, that corresponds to the molecular weight of GABARAPL2, is detected via western blot analysis. Human, rat. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Gamma-aminobutyric acid receptor-associated protein (GABARAP) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
GABARAP is highly positively charged in its N-terminus and shares sequence homology with MAP1LC3 1A and 1B. This protein clusters neurotransmitter receptors (GABA(A) receptors) by mediating interaction with the cytoskeleton. SUBUNIT: Interacts with GABRG2, TUBA1, ULK1 and NSF. Interacts with beta-tubulin and GPHN. SUBCELLULAR LOCATION: Intracytoplasmic membrane. Cytoskeleton. Largely associated with intracellular membrane structures including the Golgi apparatus and post-synaptic cisternae. Colocalizes with microtubules. TISSUE SPECIFICITY: Heart, brain, placenta, skeletal muscle, kidney and pancreas.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (FEKRRSEGEKIC) corresponding to the N-terminal of human GABARAP protein has been used as the immunogen. The sequence is homologous with mouse and rat form of GABARAP.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence, WB. A dilution of 1:200 to 1:1000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
IHC, WB and ELISA confirmed the specificity for GABARAP. Human, rat. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Whole serum
Target:
Gamma-aminobutyric acid receptor-associated protein (GABARAP)
Rabbit anti-Autophagy-related protein 10 (ATG10) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
ATG10 plays a role in autophagy. It is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12-ATG5 conjugations and modificatioon of a soluble form of MAPLC3 1A, a homolog of yeast ATG8, to a membrane bound form. It is also able to directly interact either with ATG5 or ATG7.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A peptide (CLKNSQKINKNV) corresponding to the C-terminal of human ATG10 protein has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence. A dilution of 1:100 to 1:1000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Autophagy-related protein 10; APG10-like; ATG10
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Ryningen A et al (2012) Inhibition of Mammalian target of rapamycin in human acute myeloid leukemia cells has diverse effects that depend on the environmental in vitro stress. Bone Marrow Res. 2012;2012:329061.
Specificity:
IHC, WB and ELISA confirmed the specificity for ATG10. Human. Other species not yet tested.
Storage:
After reconstitution keep aliquots at minus 20ºC for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
MAP1A and MAP1B are microtubule-associated protein which mediate the physical interactions between microtubules and components of the cytoskeleton (probably involved in autophagosome formation). MAP1A and MAP1B each consist of a heavy chain subunit and 3 different light chain subunits (LC1, LC2 and LC3). MAP1LC3A is one of the light chain subunits and can associate with either MAP1A or MAP1B. The precursor form of MAP1LC3A is cleaved by APG4/ATG4B to form the cytosolic form LC3-1. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form the membrane-bound form, LC3-II. MAP1LC3A is most abundant in heart, brain, liver, skeletal muscle and testis but is absent in thymus and peripheral leukocytes.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (RSFADRCKEVQQI) corresponding to the N-terminal of human MAP1LC3 A protein conjugated to Blue Carrier Protein has been used as the immunogen. The sequence is homologous with mouse and rat MAP1LC3 A.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunohistochemistry on 4% PFA fixed or 2% PLP fixation, 1:100-1000 primary antibody dilution. IC, Immunocytochemistry: acetone fixed specimens recommended. 1:100-1:1000 primary antibody dilution. Western Blot: R-146-100 requires samples to be denatured ONLY by boiling in SDS solution, not reduced. No signal is achieved using reduced samples. (Samples treated with DTT or Beta mercaptoethanol). 1:500 overnight 4 degrees is recommended for primary antibody dilution in western blots. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
IHC, WB and ELISA confirmed the specificity for MAP1LC3 A. Human, rat. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Tyrosine Hydroxylase (TH) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Tyrosine hydroxylase (TH) is the rate-limiting enzyme in the synthesis of the catecholamines dopamine, epinephrine and norepinephrine. Therefore the regulation of the TH enzyme represents the central means for controlling the synthesis of these important catecholamines. FUNCTION: Plays an important role in the physiology of adrenergic neurons. CATALYTIC ACTIVITY: L-tyrosine + tetrahydrobiopterin + O2 = 3,4-dihydroxy-L-phenylalanine + 4a-hydroxytetrahydrobiopterin. COFACTOR: Fe(2+) ion. ENZYME REGULATION: Phosphorylation leads to an increase in the catalytic activity. PATHWAY: Catecholamine biosynthesis; first step. SUBUNIT: Homotetramer. PTM: In vitro, phosphorylation of Ser-19 increases the rate of Ser-40 phosphorylation, which results in enzyme opening and activation. SIMILARITY: Belongs to the biopterin-dependent aromatic amino acid hydroxylase family. The presence of different DNA sequences at the TH locus confers susceptibility to various disorders of the brain including manic-depression and schizophrenia. Parkinson's disease is also considered a TH deficiency as low dopamine levels are a consistent neurochemical abnormality.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (SPRFIGRRQSLIEDARK) as part of human Tyrosine Hydroxylase (aa: 32-47) conjugated to KLH
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
<b>Immunohistochemistry (IHC):</b> 0.5-1 ug/mL. This is a superb antibody for detection of tyrosine hydroxylase containing neurons exhibiting an intense labelling with a negligible background. This antiserum has proven extremely useful for staining of catecholaminergic neurons. It stains nicely and intensely dendritic processes and fine nerve terminals.<br><b>Western Blotting (WB):</b> 0.5-2 ug/mL. This antibody demonstrates clear immunoreactivity for TH at 60 kDa in rat PC12 cell lysate and mouse brain homogenate. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
IHC on brain shows a pattern of staining specific for TH containing neurons. This antibody is known to react with rat. Cross reactivity with other species has not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Tyrosine Kinase Receptor B (TrkB) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, ELISA.
Background Info:
TrkB is a member of the neurotrophic tyrosine receptor kinase family. It is a membrane-bound receptor and upon neurotrophin binding, it phosphorylates itself as well as MAPK pathways members. TrkB is the receptor for brain-derived neurotrophic factor (BDNF), neurotrophin-3 and neurotrophin-4/5 but not nerve growth factor (NGF). It is Involved in the development and/or maintenance of the nervous system. SUBUNIT: Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. SUBCELLULAR LOCATION: Membrane; single-pass type I membrane protein. ALTERNATIVE PRODUCTS: 4 named isoforms produced by alternative splicing. Additional isoforms seem to exist. TISSUE SPECIFICITY: The different forms are differentially expressed in various cell types. SIMILARITY: Belongs to the Tyr protein kinase family. Insulin receptor subfamily. SIMILARITY: Contains 2 Ig-like C2-type (immunoglobulin-like) domains. SIMILARITY: Contains 2 LRR (leucine-rich) repeats. SIMILARITY: Contains 1 protein kinase domain. Mutations in the TrkB gene have been associated with obesity and mood disorders.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
Extracellular domain of glycosylated mouse TrkB protein produced in CHO cells was used as the immunogen. As shown for similar antisera, it is anticipated that this antibody will block the TrkB receptor binding of corresponding neurotrophin ligand.
Applications:
ELISA,IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IF (1:1000-1:3000), 1-site ELISA (1:10,000 dilution). A dilution of 1:1000 to 1:3000 o/n is recommended for IF. 4% PFA frozen sections tested. Not yet tested on paraffin embedded tissues. Use triton X-100 permeabilizaiton with frozen sections. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rudolph M (2020). Mesolimbic GluA1 AMPA Receptor Signaling in Dopaminergic Neurons Plays a Critical Role in the Induction of Cross-Sensitization to Psychostimulants in Response to Social Stress. PhD Thesis. Application: IHC (IF), frozen sections. Species: Rat. Penzo MA et al. (2015). The paraventricular thalamus controls a central amygdala fear circuit. Nature. [Epub ahead of print]. Application: IHC (IF), 4% PFA, frozen sections. Species: Mouse.
Specificity:
Specificity was demonstrated by immunohistochemistry. This antibody was used to stain cryostat sections of the rat peripheral sensory ganglia. Reacts with rat and mouse TrkB. Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Adrenocorticotropic hormone (ACTH) Polyclonal Antibody (Unconjugated), suitable for IHC-Paraffin-embedded.
Background Info:
Adrenocorticotropic hormone (ACTH) is cleaved from the precursor pro-opiomelanocortin (POMC). The hormone is produced and secreted by the pituitary gland and stimulates release of cortisol by adrenal glands.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Pig,Rat
Immunogen:
Porcine Adrenocorticotropic hormone (ACTH) conjugated to BSA
Applications:
IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Corticotropin; ACTH; Pro-opiomelanocortin; POMC;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; rat; ACTH is highly conserved so cross-reactivity with other species is expected.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Human beta-endorphin is a 31 amino acid peptide cleaved from the precursor pro-opiomelanocortin (POMC). It is an endogenous opioid peptide neurotransmitter that interacts with opioid receptors.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic human beta-endorphin peptide (1-31 aa) conjugated to BSA.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. For radioimmunoassay (RIA), a working dilution of 1:10,000 is recommended. Sensitivity - 120 pg/sample; IC50-1 ng/ sample. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
-endorphin; Pro-opiomelanocortin; POMC;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by RIA against the synthetic peptide. Human; mouse; rat. Beta-endorphin is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Met-enkephalin 0.03%; with Leu-enkephalin 0.02%; with beta-lipotropin 0.34%.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Human beta-Lipotropin is a 93 amino acid polypeptide that is cleaved from carboxy-terminal fragment of the precursor pro-opiomelanocortin (POMC). It stimulates melanocytes to produce melanin, and can also be cleaved into smaller peptides including opioid peptides: gamma-lipotropin, alpha-MSH, beta-MSH, gamma-MSH, alpha-endorphin, beta-endorphin, gamma-endorphin and met-enkephalin
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic peptide (179-267 aa) of human beta-Lipotropin conjugated to thyroglobulin was used as the immunogen.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human; mouse; rat. Beta-Lipotropin is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Leu-enkephalin 0.01%; with Met-Enkephalin 0.01%; with beta-endorphin 0.01%
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Endomorphins 1 and 2 are endogenous opioid peptides which have the highest affinity for the mu-opioid receptors. Located in various parts of the brain and interacts with mu-opioid receptors and produces analgesia.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic human Endomorphin-1 (YPWF) peptide conjugated to BSA. Selectivity towards Endomorphin-1 was achieved by separating fraction of affinity purified antibodies which did not bind to Endomorphin-2.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
EM 1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; rat. Endomorphin-1 is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Endomorphin-2 <5%; Met-enkephalin <0.03%; with Leu-enkephalin 0.01%; with beta-endorphin<0.1%
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Rabbit anti-Endomorphin-1 and Endomorphin-2 (E-1/E-2) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded, ICC.
Background Info:
Endomorphins 1 and 2 are endogenous opioid peptides which have the highest affinity for the mu-opioid receptors. Located in various parts of the brain and interacts with mu-opioid receptors and produces analgesia.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Antibodies to human Endomorphins 1 and 2 were made by immunising rabbits with the human Endomorphin-1 peptide (YPWF) and then selecting those antibodies that cross-reacted with both human Endomorphins 1 and 2.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
EM 1; EM 2;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; rat. Endomorphin-1 is highly conserved molecule so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Endomorphin-2 = 70%; Met-enkephalin <0.03%; with Leu-enkephalin 0.01%; with beta-endorphin<0.1%.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Endomorphins 1 and 2 are endogenous opioid peptides which have the highest affinity for the mu-opioid receptors. Located in various parts of the brain and interacts with mu-opioid receptors and produces analgesia.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic Endomorphin-2 (YPFF) peptide conjugated to BSA. Selectivity towards Endomorphin-2 was achieved by separating fraction of affinity purified antibodies which did not bind to Endomorphin-1.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
EM 2;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Endomorphin-2 peptide
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Rabbit anti-Gastrin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded, ICC.
Background Info:
Human Gastrin is a 101 amino acid hormone produced by G cells of the duodenum, stomach and pancreas. It stimulates secretion of hydrochloric acid by parietal cells of the stomach. Gastrin is also secreted into bloodstream.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic human Gastrin peptide (76-85 aa) conjugated to BSA.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human Gastrin , Cross reactivity is expected with mouse, rat, other species not yet tested.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Rabbit anti-Leu-Enkephalin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded, ICC.
Background Info:
Leu-Enkephalin is cleaved from the precursor Proenkephalin-A. Leu-Enkephalin is an endogenous opioid peptide that interacts with opioid receptors and produces analgesic effects.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic human Leu-Enkephalin peptide (230 - 234) conjugated to BSA.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Proenkephalin-A; PENK;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; rat. Leu-Enkephalin is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Met-enkephalin 0.93%; with beta-lipotropin 0.01%; with beta-endorphin 0.01%
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
Rabbit anti-Met-Enkephalin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded, ICC.
Background Info:
Human Methionine enkephalin (Met-Enkephalin) is a small 5 amino acid peptide cleaved from the precursor pro-opiomelanocortin (POMC). Met-Enkephalin is an endogenous opioid peptide that interacts with opioid receptors and produces analgesic effects.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic human Met-enkephalin peptide (237-241) conjugated to BSA.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Pro-opiomelanocortin; POMC;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; rat. Met-Enkephalin is highly conserved so cross-reactivity with other species is expected. Cross-reactivity with other opioid peptides is as follows: with Leu-enkephalin 5.8%; with beta-lipotropin 0.01%; with beta-endorphin 0.01%
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent.Avoid freeze-thaw cycles
The hormone Atrial natriuretic peptide (ANP) is produced by cardiomyocites and is secreted into the bloodstream. ANP acts on convoluted tubules in kidney reducing sodium absorption which results in reducing the blood pressure.
Synthetic rat Atrial natriuretic peptide (123-150 aa) conjugated to BSA.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human; mouse; rat. Highly conserved and expected to interact with feline, canine, porcine, bovine, and equine ANP.
Storage:
At least 12 months after purchase at 2 - 8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for up to 6 months for a higher stability and at 2-8°C with an appropriate antibacterial agent for up to 2 weeks.Avoid freeze-thaw cycles
Rabbit anti-Sortilin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, ELISA.
Background Info:
FUNCTION: Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi. SUBUNIT: Interacts with LPL and SLC2A4. Interacts with the cytosolic adapter proteins GGA1 and GGA2. Interacts with numerous ligands including the receptor-associated protein LRPAP1/RAP, GM2A and PSAP. Forms a complex with NGFR which binds specifically to the precursor forms of NGFB (proNGFB) and BDNF (proBDNF). SUBCELLULAR LOCATION: Membrane; single-pass type I membrane protein. Localized to membranes of the endoplasmic reticulum, endosomes, Golgi stack, lysosomes and nucleus. A small fraction of the protein is also localized to the plasma membrane. May also be found in SLC2A4/GLUT4 storage vesicles (GSVs) in adipocytes. Localization to the plasma membrane in adipocytes may be enhanced by insulin. TISSUE SPECIFICITY: Expressed at high levels in brain, spinal cord, heart, skeletal muscle, thyroid, placenta and testis. Expressed at lower levels in lymphoid organs, kidney, colon and liver. INDUCTION: During osteoblast differentiation. DOMAIN: The N-terminal propeptide may facilitate precursor transport within the Golgi stack. Intrachain binding of the N-terminal propeptide and the extracellular domain may also inhibit premature ligand binding. DOMAIN: The extracellular domain may be shed following protease cleavage in some cell types. PTM: The N-terminal propeptide is cleaved by furin and possibly other homologous proteases. PTM: Contains 8 intrachain disulfide bonds. PTM: N-glycosylated. SIMILARITY: Contains 9 BNR repeats.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Extracellular domain of glycosylated human sortilin produced in CHO cells was used as the immunogen.
Applications:
ELISA,IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC, 1-site ELISA (1:5000 dilution). A dilution of 1:1000 is recommended for IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity was demonstrated by immunohistochemistry. Reacts with human, rat and mouse Sortilin. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Somatostatin Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded, ICC.
Background Info:
Somatostatin is secreted by neuroendocrine neurons in hypothalamus and interacts with somatostatin receptors inhibiting secretion of somatotropin.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with BSA
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic Somatostatin peptide (103-116) conjugated to BSA.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human Somatostatin. Cross reactivity is expected with mouse, rat, other species not yet tested.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for up to six months for a higher stability and at 2-8°C for one week with an appropriate antibacterial agent. Avoid freeze-thaw cycles
Synthetic human Neurotensin peptide (151-163 aa) conjugated to BSA
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
A dilution of 5-10 µg/mL is recommended for immunohistochemistry using formalin fixed and paraffin embedded tissues and for 4% paraformaldehyde fixed frozen tissues. A dilution of 5-15 µg/mL is recommended for immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neuromedin N; NTS; NN; NmN; NT; NmN-125;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human; mouse; rat. Highly conserved and expected to interact with bovine, feline and monkey
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
Rabbit anti-Tyrosine Kinase Receptor C (TrkC) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
TrkC is a member of the neurotrophic tyrosine receptor kinase family. TrkC is a membrane-bound receptor that upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. TrkC is the receptor for neurotrophin-3 (NT-3). Signalling through TrkC leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. SUBUNIT: Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. SUBCELLULAR LOCATION: Membrane; single-pass type I membrane protein. ALTERNATIVE PRODUCTS: 4 named isoforms produced by alternative splicing. Additional isoforms seem to exist. Mutations in TrkC have been associated with medulloblastomas, secretory breast carcinomas and other cancers.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Extracellular domain of glycosylated human TrkC protein produced in CHO cells was used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:1000 to 1:3000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity was demonstrated by immunohistochemistry. This antibody was used to stain cryostat sections of the rat peripheral sensory ganglia. Reacts with human, rat and mouse TrkC. Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Tyrosine Kinase Receptor A (TrkA) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, ELISA.
Background Info:
TrkA is a member of the neurotrophic tyrosine kinase receptor family. It is a membrane-bound receptor that upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. TrkA is required for high-affinity binding to nerve growth factor (NGF), neurotrophin-3 and neurotrophin-4/5 but not brain-derived neurotrophic factor (BDNF). TrkA leads to cell differentiations and may play a role in specifying sensory neuron subtypes. It has a crucial role in the development and function of the nociceptive reception system as well as establishment of thermal regulation via sweating. SUBUNIT: Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. SUBCELLULAR LOCATION: Cell membrane; single-pass type I membrane protein. Endocytosed to the endosomes upon treatment of cells with NGF. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. Both isoforms have similar biological properties. TISSUE SPECIFICITY: Isoform TrkA-II is primarily expressed in neuronal cells. Isoform TrkA-I is found in non-neuronal tissues. Mutations in TrkA have been associated with congenital insensitivity to pain, anhidrosis, self-mutalating behaviour, mental retardation and cancer.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Extracellular domain of glycosylated human TrkA protein produced in mammalian cells was used as the immunogen.
Applications:
ELISA,IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC (1:1000 dilution), Western Blotting (denaturing and <b>non-reducing</b> SDS-PAGE, 1:1000-1:2500 dilution), 1-site ELISA (1:5000 dilution). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Matusica D et al. (2020) Differentiation of the 50B11 dorsal root ganglion cells into NGF and GDNF responsive nociceptor subtypes. Mol Pain. 16:1744806920970368 Application: Rat, WB. Kobayashi K et al. (2015) Nerve Growth Factor Signals as Possible Pathogenic Biomarkers for Perineural Invasion in Adenoid Cystic Carcinom. Otolaryngol Head Neck Surg. 153(2):218-24 Application: Human, IHC. Uren RT et al. (2014) A novel role of suppressor of cytokine signaling-2 in the regulation of TrkA neurotrophin receptor biology. J Neurochem. 129(4):614-27 Application: Mouse, IF.
Specificity:
Specificity was demonstrated by immunohistochemistry. When used for immunohistochemistry in rat dorsal root ganglia, staining is restricted to the known distribution of TrkA, that is in small, nociceptive neurons. Reacts with human, rat and mouse TrkA. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Activity-regulated cytoskeleton-associated protein (Arg3.1) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Arc (also termed activity-regulated cytoskeleton-associated protein or Arg3.1), is an effector immediate early gene whose upregulation has been demonstrated during events of synaptic plasticity. Arg3.1 expression is detectable in neuronal cell bodies and dendrites in the brain regions including striatum and cortex hippocampus, hypothalamus, amygdala.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, containing no preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide from the C terminal of human Arg3.1 protein (ARC protein) conjugated to Blue Carrier Protein. The sequence is homologous with mouse and rat form of Arg3.1.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1: 50 to 1: 1000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specific for Arg3.1. Rat and Mouse. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability. Glycerol (1:1) may be added for an additional stability. Sodium azide or other appropriate antibacterial agent should be added if material is to be kept any length of time at 2-8°C. Avoid repetitive freeze/thaw cycles.
Purification:
Whole serum
Target:
Activity-regulated cytoskeleton-associated protein (Arg3.1)
Rabbit anti-Acetyl Lysine Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Lysine acetylation of histones and non-histone proteins plays an important part in many cellular processes such as chromatin and nuclear signaling, transcription, gene silencing, cell cycle progression, apoptosis, differentiation, DNA replication and repair.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Rabbit
Species Reactivity:
Species Independent
Immunogen:
Acetylated Lysine OVA
Applications:
WB
Antibody Isotype:
IgG
Application Details:
WB. Suggested dilution of 1:1,000-1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Acetyl-lysine;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Binds to proteins with acetylated lysine residues.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Endothelin B receptor (ET-BR) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
The Endothelin B receptor is a multi-pass membrane protein that belongs to the G-protein coupled receptor 1 family. It acts as a non-specific receptor for endothelin 1, 2, and 3.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A peptide from human Endothelin B receptor (299-313 aa).
Applications:
WB
Antibody Isotype:
IgG
Application Details:
WB. Suggested dilution of 1:1,000-1:5,000. Human Endothelin B receptor has a predicted length of 442 residues and MW of 50 kDa. Biosensis recommends that the optimal working dilution should be determined by the end user.
Rabbit anti-Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3 B) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
MAP1LC3B is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. MAP1LC3B is probably involved in formation of autophagosomal vacuoles (autophagosomes). SUBCELLULAR LOCATION: LC3-I: Cytoplasm. LC3-II: Intracytoplasmic membrane; lipid-anchor. Cytoplasmic vesicle; autophagosome; autophagosomal membrane; lipid-anchor. LC3-II binds to the autophagic membranes. TISSUE SPECIFICITY: Most abundant in heart, brain, skeletal muscle and testis. Little expression observed in liver. PTM: The precursor molecule is cleaved by APG4B/ATG4B to form LC3-I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form LC3-II. SIMILARITY: Belongs to the MAP1 LC3 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (FEQRVEDVRLIC) corresponding to the N-terminal of human MAP1LC3 B protein conjugated to Blue Carrier Protein has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from mouse and rat MAP1LC3 B protein.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence, WB. A dilution of 1:100 to 1:1000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Theron AE et al. (2013) Molecular crosstalk between apoptosis and autophagy induced by a novel 2-methoxyestradiol analogue in cervical adenocarcinoma cells. Cancer Cell Int. 2013 Aug 27;13(1):87. Pilchowski R. et al. (2011) Specific Protein Patterns Characterize Metastatic Potential of Advanced Bladder Cancer. J Urol. 2011 Jun 16.
Specificity:
IHC, WB and ELISA confirmed the specificity for MAP1LC3 B. Human, rat. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Whole serum
Target:
Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3 B)
Rabbit anti-Leptin Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Leptin is secreted by white adipocytes and functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. Leptin has a variety of other roles including endocrine functions, regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing (Ref Entrez Gene).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant human Leptin protein
Applications:
ELISA,WB
Antibody Isotype:
Mixed
Application Details:
WB and ELISA. Suggested dilution of 1:1,000-1:2,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Leptin; Obesity factor; Lep; Ob; Obese protein;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Leptin
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Leptin Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Leptin is secreted by white adipocytes and functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. Leptin has a variety of other roles including endocrine functions, regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing (Ref Entrez Gene).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
Recombinant rat Leptin protein
Applications:
ELISA,WB
Antibody Isotype:
Mixed
Application Details:
WB and ELISA. Suggested dilution of 1:1,000-1:4,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Leptin; Obesity factor; Lep; Ob; Obese protein;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Mouse, Rat
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
The elF2c (Argonaute, Ago) protein is a core protein of the RNA-induced silencing complex (RISC).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide corresponding to a sequence (845-860 aa) from the C-terminus of mouse elF2C conjugated to KLH.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,IP,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB), Immunochemistry (IHC) and Immunoprecipitation (IP). The recommended concentration for IHC in formalin fixed and paraffin embedded tissues and formalin/acetone fixed tissues is 1:200-1:500. For WB, the recommended concentration is 1:1,000 to 1:2,000. The elFC2 protein has a predicted length of 860 residues and the MW of the monomer is 94 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Protein argonaute-1; Protein argonaute-2; Protein argonaute-3; Argonaute1; Argonaute2; Argonaute3; mAgo1; mAgo2; Eukaryotic translation initiation factor 2C; eIF-2C 2; eIF-2C 1; eIF2C 2; Piwi/argonaute family protein meIF2C2 Protein slicer; Eif2c2; Ago1; Ago2;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Huang KL, Chadee AB, Chen CY, Zhang Y, Shyu AB. (2013)"Phosphorylation at intrinsically disordered regions of PAM2 motif-containing proteins modulates their interactions with PABPC1 and influences mRNA fate." RNA. 2013 Jan 22. [Epub ahead of print]. Lugli G. et al (2008) Expression of microRNAs and their precursors in synaptic fractions of adult mouse forebrain. J Neurochem. Jul;106(2):650-61. Lugli G. et al (2005) Dicer and eIF2c are enriched at postsynaptic densities in adult mouse brain and are modified by neuronal activity in a calpain-dependent manner. J Neurochem. Aug;94(4):896-905.
Specificity:
Specificity has been confirmed by IHC, WB and IP in mouse brain. This antibody is expected to recognise at least elF2c-1, 2 and 3 since they have identical C-termini. Human; mouse; rat; The Ago proteins are highly conserved so cross-reactivity with other species is expected.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
Rabbit anti-Autophagy-related protein 4 homolog C (ATG4C) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Cysteine protease required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form (form II). Form II, with a revealed C-terminal glycine, is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes. ENZYME REGULATION: Inhibited by N-ethylmaleimide. SUBCELLULAR LOCATION: Cytoplasm (Probable). SIMILARITY: Belongs to the peptidase C54 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (CTVYNSDVIDKQ) corresponding to the C-terminal of human ATG4C protein conjugated to Blue Carrier Protein has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from ATG4C protein in mouse and rat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence and WB. A dilution of 1:100 to 1:2000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Smuder AJ et al. (2011) Exercise protects against doxorubicin-induced markers of autophagy signaling in skeletal muscle. J Appl Physiol (1985). 2011 Oct;111(4):1190-8.
Specificity:
IHC, ELISA and WB confirmed the specificity for ATG4C. Human, rat. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Neurturin (NTN) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Neurturin (NTN) is a member of the GDNF family of neurotrophic factors. This protein is a potent survival factor for several populations of central and peripheral neurons in mature and developing rodents. FUNCTION: Supports the survival of sympathetic neurons in culture. May regulate the development and maintenance of the CNS. Might control the size of non-neuronal cell population such as haemopoietic cells. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. DISEASE: Defects in NRTN are a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, and possibly with other loci, defects in NRTN are involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human Neurturin (rh NTN)
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
Immunohistochemistry (IHC) at a suggested dilution of 1:2000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
NRTN; NTN;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity of this product was demonstrated by immunohistochemistry and dot blot showed no cross reactivity with GDNF. This antibody is known to react with human, mouse and rat.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Autophagy-related protein 4 homolog B (APG4B) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Cysteine protease required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form (form II). Form II, with a revealed C-terminal glycine, is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes. ENZYME REGULATION: Inhibited by N-ethylmaleimide. SUBCELLULAR LOCATION: Cytoplasm (Probable). ALTERNATIVE PRODUCTS: 5 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Mainly expressed in the skeletal muscle, followed by brain, heart, liver and pancreas. SIMILARITY: Belongs to the peptidase C54 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (CLERFFDSEDED) corresponding to the C-terminus of human ATG4B protein conjugated to Blue Carrier Protein has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from of ATG4B protein in mouse and rat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence, WB. A dilution of 1:100 to 1:2000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A. J. Smuder et al (2011) Exercise protects against doxorubicin-induced markers of autophagy signaling in skeletal muscle. J Appl Physiol. 2011 Jul 21
Specificity:
IHC, WB and ELISA confirmed the specificity for ATG4B. Human, rat. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Protein painting of fourth Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
Protein painting of fourth (Pof) is a probable RNA-binding protein that binds to the fourth chromosome and may bind a RNA that spreads the fourth chromosome (Ref: Swissprot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS (pH 7.4) with 0.02% Sodium azide added
Host Animal:
Rabbit
Species Reactivity:
Drosophila
Immunogen:
A synthetic peptide from Drosophila melanogaster Protein painting of fourth (22-36 aa) conjugated to KLH.
Applications:
ELISA
Antibody Isotype:
IgG
Application Details:
ELISA. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Zeste-interacting protein 16; Zip16; Pof;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Protein painting of fourth ;Zeste-interacting protein 16;
Storage:
Store lyophilized product at -20°C or below. After reconstitution, keep aliquots for 2-3 weeks at 2-8°C or at -20°C for up to 12 months. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Autophagy-related protein 16-1 (ATG16 L1) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA, ICC.
Background Info:
ATG16 L1 plays an essential role in autophagy. It is a homooligomer ant interacts with ATG5. Part of either the minor and major complexes respectively composed of 4 sets of ATG12-ATG5 and ATG16L1 (400 kDa) or 8 sets of ATG12-ATG5 and ATG16L1 (800 kDa). APG16 L1 localises to the cytoplasm, in particularly to preautophagosomal structure (PAS) where it is involved in the membrane targeting of ATG5. There are 5 named isoforms produced by alternative splicing. Genetic variation within ATG16 L1 are associated with susceptibility to inflammatory bowel disease type 1.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
N-terminal of human ATG16-L1 protein conjugated to Blue Carrier Protein has been used as the immunogen.
Applications:
ELISA,ICC,WB
Antibody Isotype:
Mixed
Application Details:
Non-reduced western blot: 1:100; IP: 1-50-1:100 (5-10 ?L/500uL lysate); ELISA: 1:2000-1:3000 direct detection only, recombinant immunogen.
Alternative Names:
Autophagy-related protein 16-1; APG16-like 1; ATG16L1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Cooney R et al (2009). NOD2 stimulation induces autophagy in dendritic cells influencing bacterial handling and antigen presentation. Nat. Med. Dec 6 2009 Scharl M. et al (2011). Protein tyrosine phosphatase nonreceptor type 2 regulates autophagosome formation in human intestinal cells. Inflamm Bowel Dis. 2011 Oct 10.
Specificity:
Detects human protein via non-reduced WB, and ELISA Human, rat. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Glutathione peroxidase 1 has a role in detoxification of hydrogen peroxide and is one of the most important antioxidant enzymes in humans. It exists as a homotetramer which localises to the cytoplasm. It belongs to the glutathione peroxidase family. Glutathione peroxidase 1 is one of few proteins in higher vertebrates to contain selenocysteine, which occurs at the active site of glutathione peroxidase and is coded by UGA, that normally functions as a translation termination codon. This protein has a polyalanine sequence polymorphism in the N-terminal region, which includes three alleles with five, six or seven alanine repeats. The allele with five alanine repeats is significantly associated with breast cancer risk. At least two alternatively spliced isoforms have been identified.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (RRYSRRFQTIDIEPDIEALL) corresponding to the amino acids 175-194 of human glutathione peroxidase 1 ( GPx-1) conjugated to diphtheria toxin has been used as the immunogen.
Applications:
ELISA,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB and ELISA. This antibody works superbly in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine IHC are 1: 200 to 1: 1,000 depending on tissue and detection method. For WB a dilution range of 1: 1,000 to 1: 4,000 is recommended. For ELISA, a dilution of 1: 1,000 to 1: 4,000 is recommended. This antiserum has extremely high titre, it stains human and rat glial cells intensely and to some extent also stains neurons. Other tissues have not yet been tested. On WB under reducing conditions recognises a 22kD protein in human brain tissue and Sigma glutathione peroxidase (G-4013) isolated from human erythrocytes. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human and rat cellular selenium dependent glutathione peroxidase. Human; rat;
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Glutathione peroxidase 4 (GPx-4) is involved in protecting cells against membrane lipid peroxidation and cell death.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (VNYTQLVDLHARYAEC) corresponding to the amino acids 78-93 of human glutathione peroxidase 4 (Isoform Mitochondrial) conjugated to KLH has been used as the immunogen. Human, rat and mouse sequences are identical.
Applications:
IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
WB, IHC. Typical working dilution for IHC is 1:200 to 1:1,000 depending on tissue and detection method. For WB, a dilution range of 1:1,000 to 1:2,000 is recommended. GPx-4 exists as a tetramer and can reform into multimeric complexes even under reduced conditions. The reported molecular weight of the GPx-4 monomer is 22 kDa but is reported to rapidly form oligomers, thus higher molecular weight bands greater than 22 kDa are expected. Mitochondrial preparations are also recommended to enhance signal. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human and rat mitochondrial glutathione peroxidase (GPx-4) Human; rat;
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Peroxiredoxin-1 has a role in redox regulation of the cell.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (PLVSDPKRTIAQDY) corresponding to the region 103-116 amino acids of human Peroxiredoxin-1 conjugated to diptheria toxin.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF of 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 4,000 is recommended. A dilution of 1: 1,000 to 1: 4,000 is recommended for ELISA. This antibody stains non-ciliated bronchiolar cells in rat airways and specific kidney tubule cells. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Rabbit anti-Autophagy-related protein 3 (ATG3) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
FUNCTION: GABARAPL1 (GABARAPL2 or GABARAP or MAP1LC3)-modifier protein conjugating enzyme involved in its E2-like covalent binding to PE. ATG7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with ATG3 (E2-like enzyme). Preferred substrate is MAP1LC3A. Formation of the GABARAPL1-PE conjugate is essential for autophagy. SUBUNIT: Interacts with ATG7 and ATG12. The complex, composed of ATG3 and ATG7, plays a role in the conjugation of ATG12 to ATG5. SUBCELLULAR LOCATION: Cytoplasm. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Widely expressed, with a highest expression in heart, skeletal muscle, kidney, liver and placenta. SIMILARITY: Belongs to the ATG3 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide corresponding to a central region of the human ATG3 protein conjugated to Blue Carrier Protein has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from ATG3 protein in mouse, rat, S. cerevisiae, Macaca mulatta (monkey) and Canis familiaris (dog).
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, immunofluorescence. A dilution of 1:50 to 1:3000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Autophagy-related protein 3; APG3; APG3-like; hApg3; Protein PC3-96 ; ATG3; APG3; APG3L
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Ryningen A et al (2012) Inhibition of Mammalian target of rapamycin in human acute myeloid leukemia cells has diverse effects that depend on the environmental in vitro stress. Bone Marrow Res. 2012;2012:329061.
Specificity:
IHC, WB and ELISA confirmed the specificity for ATG3. A 37 kDa band, that corresponds to the molecular weight of ATG3, is detected via western blot analysis. Human, rat, mouse. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Peroxiredoxin-2 has a role in redox regulation of the cell.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (VVDGAFKEVKLS) corresponding to region (20-31 aa) from human Peroxiredoxin-2 conjugated to diptheria toxin.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF of 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 4,000 is recommended. A dilution of 1: 1,000 to 1: 4,000 is recommended for ELISA. This antibody stains basal cells in rat airways and specific kidney tubule cells. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human Peroxiredoxin-2, no cross reactivity to other family members
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Peroxiredoxin-3 has a role in redox regulation of the cell.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (CEVVAVSVDSHFSHLAW) from a region (127-143 aa) on human Peroxiredoxin-3 conjugated to KLH.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF of 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 2,000 is recommended. This antibody detects a protein at approx 23 kDa on WB of human brain tissue which is the mature form of this protein. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Thioredoxin-dependent peroxide reductase, mitochondrial; Antioxidant protein 1; AOP-1; HBC189; Peroxiredoxin III; Prx-III; Peroxiredoxin-3; Protein MER5 homolog; PRDX3; AOP1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Peroxiredoxin-3 no cross reactivity to other family members
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Peroxiredoxin-4 has a probable role in redox regulation of the cell.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (SRVSVADHSLHLSKAKISK) corresponding to a region (65-83 aa) from human Peroxiredoxin-4 conjugated to diptheria toxin.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF of 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 4,000 is recommended. A dilution of 1: 1,000 to 1: 4,000 is recommended for ELISA. This antibody stains non-ciliated bronchiolar cells in rat lung and what appears to be sebaceous glands in rat skin. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Tam KC et al. (2018) Evidence for the interaction of peroxiredoxin-4 with the store-operated calcium channel activator STIM1 in liver cells. Cell Calcium. 2018 May 15;74:14-28.
Specificity:
Human Peroxiredoxin-4 no cross reactivity to other family members
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Peroxiredoxin-5 has a role in intracellular redox signaling.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (VKALNVEPDGTGLTC) corresponding to region (190-204 aa) of human Peroxiredoxin-5 conjugated to KLH. Human, mouse and rat sequences of this peptide are identical.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, IF, WB. This antibody works in IHC on frozen or wax embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for light microscopy are 1:500 to 1:1,000 and IF 1:50 to 1:100. For WB a dilution range of 1: 1,000 to 1: 2,000 is recommended. This antibody clearly detects a protein at approximately 22 kDa on WB of human brain tissue. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human Peroxiredoxin-5 no cross reactivity to other family members
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Superoxide dismutase [Mn], mitochondrial destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems (Ref: SwissProt).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized serum with 0.02% thimerosal
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (KHSLPDLPYDGALEPHINC) of human/rat/mouse mitochondrial manganese Superoxide Dismutase (SOD2), conjugated to Keyhole Limpet Hemocyanin.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
IF, WB. Typical working dilutions for light microscopy are 1:500 to 1:1,000 depending on tissue and detection method. For IF, a dilution range of 1:50 to 1:100 is recommended. For WB, a dilution range of 1: 1,000 to 1: 4,000 is recommended. This antibody clearly detects a protein at approximately 24 kDa on WB of human brain tissue. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Superoxide dismutase [Mn], mitochondrial;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Mitochondrial manganese Superoxide Dismutase (SOD2), no cross reactivity to SOD1
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles.
Rabbit anti-Autophagy-related protein 9A (ATG9A) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
FUNCTION: Plays a role in autophagy. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein (Potential). ALTERNATIVE PRODUCTS: 3 named isoforms produced by alternative splicing. SIMILARITY: Belongs to the ATG9 family. IN YEAST: FUNCTION: Involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Recruites ATG23 and ATG8 to the pre-autophagosomal structure. SUBUNIT: Interacts with ATG18, ATG2 and ATG23. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein. Preautophagosomal structure; preautophagosomal structure membrane; multi-pass membrane protein. Note=Pre-autophagosomal and other perivacuolar punctate structures. The proper trafficking of ATG9 between the pre-autophagosomal structure and the other punctate structures requires ATG2, ATG18, ATG23, the ATG1-ATG13 complex and the phosphatidylinositol 3-kinase complex I. SIMILARITY: Belongs to the ATG9 family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (CWHRRESDESGE) corresponding to the C-terminal of human APG9A (APG9L1) protein has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from APG9A (APG9L1) protein in mouse, rat, S. cerevisiae, Macaca mulatta (monkey) and Canis familiaris (dog).
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, immunofluorescence, WB. A dilution of 1:100 to 1:3000 dilution is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Autophagy-related protein 9A; APG9-like 1; Autophagy-related protein 9; APG9A; ATG9A; APG9L1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Park YE et al (2009) Autophagic degradation of nuclear components in mammalian cells. Autophagy. 2009 Aug;5(6):795-804.
Specificity:
IHC, WB and ELISA confirmed the specificity for ATG9A (APG9L1) . Human, rat. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Presenilin 1 (PS-1) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Presenilin-1 (PSEN1) is a multi-pass membrane protein and component of the gamma-secretase complex. PSEN1 is thought to play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. It may also play a role in hematopoiesis. Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3), a familial early-onset form of Alzheimer disease (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide corresponding to a region (1-20 aa) from the N-terminus of human Presenilin 1 conjugated to Diptheria toxoid.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
IF and WB. Suggested dilution of 1:2,000 is recommended for WB. On SDS-PAGE, the predominant form detected by this antibody is the N-terminal Presenilin 1 fragment of approx 29 kDa. The uncleaved form of Presenilin 1 migrates to approx 45 kDa. Human and mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3M), SDS (1%) in 62.5 mM Tris-HCl pH 6.8 sample buffer heated to 50C for 15 min. The suggested dilution for IF is 1:100 for acetone or paraformaldehyde fixed cells or tissue. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Presenilin 1; PS-1; Protein S182; PS1-CTF12; PSEN1; AD3; PS1; PSNL1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity confirmed by WB and IF using transfected cells, Presenilin 1 knock-out mouse cells, mouse and human brain.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Autophagy-related protein 7 (ATG7) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
FUNCTION: Functions as an E1 enzyme essential for multisubstrates such as GABARAPL1 and ATG12. Forms intermediate conjugates with GABARAPL1 (GABARAPL2, GABARAP or MAP1ALC3). Formation of the final GABARAPL1-PE conjugate is essential for autophagy. SUBUNIT: Homodimer (By similarity). Interacts with ATG3 and ATG12. The complex, composed of ATG3 and ATG7, plays a role in the conjugation of ATG12 to ATG5. SUBCELLULAR LOCATION: Cytoplasm (Probable). ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Widely expressed, especially in kidney, liver, lymph nodes and bone marrow. DOMAIN: The C-terminal part of the protein is essential for the dimerization and interaction with ATG3 and ATG12. SIMILARITY: Belongs to the ATG7 family. In yeast, ATG7 appears to be required for fusion of peroxisomal and vaculuolar membranes.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (DSTRDRTLDQQC) corresponding to the C-terminal of human APG7 protein conjugated to blue carrier protein has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from APG7 protein in mouse, rat, S. cerevisiae, Macaca mulatta (monkey) and Canis familiaris (dog).
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
Non-reduced western blot : 1:100; IF: acetone or 3.7% PFA fixed cells (HJ Lim et al 2013); 1:100; Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Chiu-Wei Chen, et al (2012) Inhibition of autophagy as a therapeutic strategy of iron-induced brain injury after hemorrhage Autophagy, 8(10):1510. Chien W.S. et al (2011) Suppression of autophagy in rat liver at late stage of polymicrobial sepsis Shock. 2011 Jan 14 Lee J.E. et al (2011) Autophagy Regulates Embryonic Survival During Delayed Implantation Endocrinology. 2011 Mar 1. Ryningen A et al (2012) Inhibition of Mammalian target of rapamycin in human acute myeloid leukemia cells has diverse effects that depend on the environmental in vitro stress. Bone Marrow Res. 2012;2012:329061. Oh HA et al (2013) Uncovering a role for endocannabinoid signaling in autophagy in preimplantation mouse embryos. Mol Hum Reprod. 2013 Feb;19(2):93-101.
Specificity:
IF, WB and ELISA confirmed the specificity for ATG7. Human, rat. Other species not yet tested.
Storage:
Store lyophilized antibody at 2-8ºC. After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Sequestosome 1 Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Sequestosome 1 is an adapter protein which binds ubiquitin and may regulate the activation of NFKB1 by TNF-alpha, nerve growth factor and interleukin-1. It may regulate signaling cascades through ubiquitination and may also be involved in cell differentiation, apoptosis, immune response and regulation of K(+) channels. It is present as a homooligomer or heterooligomer and localises to the cytoplasm, late endosome and nucleus. In cardiac muscles it localises to the sarcomeric band. It accumulates in neurofibrillary tangles and in Lewy bodies of neurons from individuals with Alzheimer and Parkinson disease respectively. It is also enriched in Rosenthal fibers of pilocytic astrocytoma and in liver cells it accumulates in Mallory bodies associated with alcoholic hepatitis, Wilson disease, indian childhood cirrhosis and in hyaline bodies associated with hepatocellular carcinoma. Sequestosome 1 is ubiquitously expressed and to date, there are 2 named isoforms produced by alternative splicing. Defects in sequestosome 1 cause sporadic and familial Page disease of bone (PDB). This is a metabolic bone disease characterised by focal areas of increased and disorganised bone turn-over due to activated osteoclasts.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Rat
Immunogen:
Peptide IGAALDTIQYSKH corresponding to the C-terminal part of human Sequestosome 1 (aa: 424-436) conjugated to the Blue Carrier Protein has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:500 to 1: 5000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa; ubiquitin-binding protein p62; EBI3-associated protein of 60 kDa; p60; EBIAP; SQSTM1; ORCA; OSIL
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity was confirmed by immunohistochemical analysis on paraffin embedded human brain. This antibody is expected to recognise p60 in mouse, rat and bovine.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
This gene encodes an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This gene product is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer's disease. Polymorphisms in this gene have been associated with Alzheimer's disease and mild cognitive impairment. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform. [provided by RefSeq, May 2010]
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Guinea Pig,Human,Pig,Rabbit,Rat
Immunogen:
A synthetic peptide (GLFSSYRLPGHTQDTLVAQKSS) as a part of porcine ChAT protein (aa: 167-188) conjugated to KLH
Applications:
ELISA,IHC-Frozen
Antibody Isotype:
IgG
Application Details:
IHC, 1 site ELISA. Use at a concentration of 1 µg/mL. This antiserum will superbly stain both cell bodies and nerve terminal. The optimal dilution should be determined by the end user.
Leong WK, Klaric TS, Lin Y, Lewis MD, Koblar SA.(2013) Upregulation of the neuronal Per-Arnt-Sim domain protein 4 (Npas4) in the rat corticolimbic system following focal cerebral ischemia. Eur J Neurosci. 2013 Feb 22. doi: 10.1111/ejn.12163. [Epub ahead of print] Application: IH; species Rat PubMed ID
Specificity:
This antibody stains cholinergic neurons in human, rat, guinea-pig and rabbit central and peripheral nervous systems. This antiserum is known to react with ChAT of origin: human, rat, guinea-pig and rabbit.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Tyrosine Hydroxylase (TH) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Tyrosine hydroxylase (TH) is the rate-limiting enzyme in the synthesis of the catecholamines dopamine, epinephrine and norepinephrine. Therefore the regulation of the TH enzyme represents the central means for controlling the synthesis of these important catecholamines. FUNCTION: Plays an important role in the physiology of adrenergic neurons. CATALYTIC ACTIVITY: L-tyrosine + tetrahydrobiopterin + O2 = 3,4-dihydroxy-L-phenylalanine + 4a-hydroxytetrahydrobiopterin. COFACTOR: Fe(2+) ion. ENZYME REGULATION: Phosphorylation leads to an increase in the catalytic activity. PATHWAY: Catecholamine biosynthesis; first step. SUBUNIT: Homotetramer. PTM: In vitro, phosphorylation of Ser-19 increases the rate of Ser-40 phosphorylation, which results in enzyme opening and activation. SIMILARITY: Belongs to the biopterin-dependent aromatic amino acid hydroxylase family. The presence of different DNA sequences at the TH locus confers susceptibility to various disorders of the brain including manic-depression and schizophrenia. Parkinson's disease is also considered a TH deficiency as low dopamine levels are a consistent neurochemical abnormality.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Guinea Pig,Human,Mouse,Rat
Immunogen:
A synthetic peptide (PRFIGRRQSLIEDARK) as part of human Tyrosine Hydroxylase (63-78) conjugated to KLH has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from TH protein in rat (31-47).
Applications:
IHC-Frozen
Antibody Isotype:
IgG
Application Details:
IHC. A concentration of 4-10 µg/mL is recommended for this application. This is a superb antibody for detection of tyrosine hydroxylase containing neurons exhibiting an intense labelling with a negligible background. This antiserum has proven extremely useful for staining of catecholaminergic neurons. It stains nicely and intensely dendritic processes and fine nerve terminals. We recommend mouse or rat brain containing catecholaminergic neurons as a positive control for this antibody, for example brain stem or striatum. Western blotting: A concentration of 5-15 µg/mL is recommended.Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Pierre S.R., Lemmens M.A., Figueiredo-Pereira M.E. (2009) Subchronic infusion of the product of inflammation prostaglandin J2 models sporadic Parkinson's disease in mice J Neuroinflammation. Jul 25;6:18 Takeoka A. et al (2010) Noradrenergic innervation of the rat spinal cord caudal to a complete spinal cord transection: effects of olfactory ensheathing glia J Exp Neurol. 2010 Mar;222(1):59-69. Brown R.E. et al (2008) Characterization of GABAergic neurons in rapid-eye-movement sleep controlling regions of the brainstem reticular formation in GAD67-green fluorescent protein knock-in mice. Eur J Neurosci. 2008 Jan;27(2):352-63. Bisem NJ et al (2012) Mapping of FGF1 in the Medulla Oblongata of Macaca fascicularis. Acta Histochem Cytochem. 2012 Dec 26;45(6):325-34.
Specificity:
IHC on brain shows a pattern of staining specific for TH containing neurons. This antibody is known to react with rat, mouse and guinea pig. Cross reactivity with other species has not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Clathrin Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Paraffin-embedded.
Background Info:
Clathrin is a major protein component of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice to either the plasma membrane or the trans-Golgi network. These specialised organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. Clathrin triskelions, composed of 3 heavy chains and 3 light chains, are the basic subunits of the clathrin coat. In the presence of light chains, hub assembly is influenced by both the pH and the concentration of calcium. Clathrin localises to the cytoplasmic face of coated pit and vesicle membranes.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Rat
Immunogen:
A synthetic peptide (KAGLLQRALEHFTDLYDIKR) corresponding to the amino acids 619-638 of rat clathrin conjugated to diphtheria toxin has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from clathrin protein in mouse, human and bovine.
Applications:
IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. This antibody works in immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 100 to 1: 4000 depending on tissue and detection method. It is usual to use approximately a 10-fold increase for confocal microscopy i.e. a dilution range of 1: 100 to 1: 400.For western blotting a dilution range of 1: 1000 to 1: 8000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Clathrin heavy chain; Clathrin heavy chain 1; CLH-17; CLTC
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody has been shown to be specific for clathrin. Rat
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent.
Rabbit anti-Growth Associated Protein 43 (GAP-43) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
GAP43 is very abundant protein which is found concentrated in neurons. One group discovered it as one of three proteins which becomes unregulated during the regeneration of the toad optic nerve (1). Three GAPs (Growth associated proteins) were discovered, and the number 43 comes from the apparent SDS-PAGE molecular weight of the one named GAP43. The HGNC name for this protein is, not surprisingly, GAP43. Later work showed that GAP43 does not run on SDS-PAGE in a fashion which accurately reflects its molecular weight, and that GAP43 proteins from different species may run at different apparent molecular weights. Partly due to these features GAP43 were independently discovered by several different groups and therefore has several alternate names, such as protein F1, pp46, neuromodulin, neural phosphoprotein B-50 and calmodulin-binding protein P-57. In each case the number reflects the apparent SDS-PAGE molecular weight, and underlines the unusual properties of this molecule. Mammalian GAP43 proteins contains only 226-243 amino acids, and so the real molecular weight is 23.61-25.14 kDa. GAP43 has been extensively studied and is known to be a major protein kinase C substrate and to bind calmodulin avidly. GAP43 is anchored to the plasma membrane by palmitoylation modifications.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Rat
Immunogen:
C-terminal peptide 217-227 of rat and mouse GAP43, which is KEDPEADQEHA, to which an N terminal Cysteine residue was added to allow chemical coupling to Keyhole Limpet Hemocyanin carrier protein.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A dilution of 1:5,000 - 1:20,000 is recommended. A dilution of 1:500-2,000 is recommended for Immunocytochemistry (ICC). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The antibody reacts with a 43 kDa band by Western blot on bovine cerebellum homogenate. The molecular weight of the protein recognized can vary (~43-57 kDa) depending on the species and the percentage acrylamide used in the SDS-PAGE gel. It has also been used successfully for immunocytochemistry.
Storage:
Store lyophilized, unopened vial at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C to -80°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-mCherry Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
mCherry is an engineered derivative of one of a family of proteins originally isolated from Cnidarians (jelly fish, sea anemones and corals). The mCherry protein was derived from DsRed, a red fluorescent protein from so-called disc corals of the genus Discosoma. DsRed is a 223 amino acid ~28 kDa protein similar in size and properties to GFP, but, obviously, produces a red rather than a green fluorochrome. The original DsRed was engineered extensively in the Tsien lab to prevent it from forming tetramers and dimers and to modify and improve the spectral properties (1-3). The resulting monomeric protein is useful for applications such as Foerster Resonance Energy Transfer (FRET, also known as Fluorescence Resonance Energy Transfer). Several further cycles of mutation, directed modification and evolutionary selection produced mCherry, which is monomeric and has an excitation maximum at 587 nm and and emission maximum at 610 nm (4).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Species Independent
Immunogen:
Recombinant full length mCherry.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunocytochemistry (IC). A dilution of 1:500 to 1:1,000 is recommended for WB. A dilution of 1:250 to 1:500 is recommended for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The antibody reacts with a band at ~28-30 kDa corresponding to intact full-length mCherry by Western blot on HEK293 cells transfected with mCherry vector. It has also been used successfully for immunocytochemistry.
Storage:
Store lyophilized, unopened vial at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C to -80°C for a higher stability. Avoid freeze-thaw cycles.
Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans Golgi network to lysosomes. Together with medium and small subunits, adaptins form a heterotetrameric complex called an adaptor whose role is to promote the formation of clathrin-coated pits and vesicles and to recognise sorting signals within the cytosolic tails of transmembrane cargo molecules. Gamma-adaptin protein belongs to the adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network and/or endosomes. SUBCELLULAR LOCATION: Golgi apparatus. Cytoplasmic vesicle, clathrin-coated vesicle membrane.
A synthetic peptide (IRLRELIRTIRTARTQAEER) corresponding to the amino acids 5-24 of human AP-1 complex subunit gamma-1 conjugated to diphtheria toxin has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from AP-1 complex subunit gamma-1 protein in mouse, rat, dog and zebra fish.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. This antibody works in immunohistochemistry on frozen or wax embedded tissue. Antigen retrieval has been used in testing but may not be necessary. Typical working dilution: Light microscopy 1/500 to 1/2000 depending on tissue and detection method; Immunofluorescence 1/50 to 1/200; Western blotting 1/1000 to 1/4000 is recommended depending on detection method. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
AP-1 complex subunit gamma-1; Adapter-related protein complex 1 subunit gamma-1; Gamma1-adaptin; Adaptor protein complex AP-1 subunit gamma-1; Golgi adaptor HA1/AP1 adaptin subunit gamma-1; Clathrin assembly protein complex 1 gamma-1 large chain; AP1G1; ADTG; CLAPG1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody has been shown to be specific for AP-1 Rat and human
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent.
Rabbit anti-Neurturin (NTN) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
<span itemprop="description">Neurturin (NTN) is a member of the GDNF family of neurotrophic factors. This protein is a potent survival factor for several populations of central and peripheral neurons in mature and developing rodents. FUNCTION: Supports the survival of sympathetic neurons in culture. May regulate the development and maintenance of the CNS. Might control the size of non-neuronal cell population such as haemopoietic cells. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. DISEASE: Defects in NRTN are a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, and possibly with other loci, defects in NRTN are involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.</span>
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Concentrated ammonium sulphate in PBS pH 7.4.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant human NRTN protein produced using CHO-based suspension cell line. Protein was purified from the cell culture supernatant.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western blot (WB) at a suggested dilution of 1:500-1:1,000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Antibody does not show cross-reactivity to other GDNF-family proteins.
Storage:
Store at 2-8°C upon receipt. As product is (NH4)2SO4 (ammonium sulfate) precipitate, mix well by pipetting or vortexing prior to use.
FUNCTION: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. SUBUNIT: Adaptor protein complex 1 (AP-1) is an heterotetramer composed of two large adaptins (gamma1/AP1G1 or gamma2/AP1G2 and beta1A/AP1B1 or beta1B/AP1B1), a medium adaptin (mu1A/AP1M1 or mu1B/AP1M2) and a small adaptin (sigma1A/AP1S1 or sigma1B/AP1S2 or sigma1C/AP1S3). SUBCELLULAR LOCATION: Golgi apparatus. Cytoplasmic vesicle; cytoplasmic vesicle membrane; peripheral membrane protein; cytoplasmic side. Note=Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. TISSUE SPECIFICITY: Widely expressed. DISEASE: Deletion of the AP1B1 gene may play a role in the tumorigenesis of meningiomas. SIMILARITY: Belongs to the adaptor complexes large subunit family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (C-KKGEIFELKAELNSDKKEK) corresponding to the amino acids 11-29 of human AP-1 complex subunit beta-1 conjugated to diphtheria toxin has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from AP-1 complex subunit beta-1 protein in mouse, rat and bovine.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. This antibody works superbly in immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 1000 to 1: 5000 depending on tissue and detection method. For western blotting a dilution range of 1: 100 to 1: 10000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Adapter-related protein complex 1 beta-1 subunit; Beta-adaptin 1; Adaptor protein complex AP-1 beta-1 subunit; Golgi adaptor HA1/AP1 adaptin beta subunit; Clathrin assembly protein complex 1 beta large chain; AP1B1; ADTB1; BAM22
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody has been shown to be specific for AP-1 complex subunit beta-1. Rat and human, other species have not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
CDNF (conserved dopamine neurotrophic factor) is a trophic factor for midbrain dopamine neurons in vivo. It prevents the 6-OHDA- (Lindholm et al. 20007; Voutilainen et al., 2011) and MPTP-induced degeneration (Airavaara et al., 2012) of dopamine neurons in rodent models of Parkinson's disease. When administered after 6-OHDA or MPTP -lesioning it restores the dopaminergic function and prevents degeneration of dopamine neurons in substantia nigra pars compacta.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Concentrated ammonium sulphate in PBS pH 7.4 containing no preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant human CDNF protein produced using CHO-based cell line. Purified from cell culture supernatant.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western blot (WB) at a suggested dilution of 1:6,000 - 1:10,000. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
ARMETL1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
CDNF (conserved dopamine neurotrophic factor)
Storage:
Store at 2-8°C upon receipt; Do not freeze. See reconstitution instructions for handling information.
MANF is a trophic factor for midbrain dopamine neurons in vivo. It prevents the 6-OHDA- induced degeneration of dopamine neurons in rodent models of Parkinson's disease (Lindholm et al., 2008, Voutilainen et al., 2009). When administered after 6-OHDA-lesioning it restores the dopaminergic function and prevents degeneration of dopamine neurons in substantia nigra pars compacta.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Concentrated ammonium sulfate in PBS pH 7.4 containing no preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant human MANF protein produced using CHO-based cell line. Immunogen is purified from cell culture supernatant.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western blot (WB) at a suggested dilution of 1:2,000 - 1:6,000. Immunohistochemistry (IHC) and Immunofluorescence (IF). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
ARMET, ARP
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
MANF (Mesencephalic astrocyte-derived neurotrophic factor). No cross-reactivity in MANF-knockout mouse. No cross-reactivity with CDNF in IHC, slightly cross-reacts with purified CDNF in WB. No cross-reactivity with CDNF in IHC, slightly cross-reacts with purified CDNF in WB.
Storage:
Store antibody stock solution at 2-8°C upon receipt. DO NOT FREEZE. This product is an (NH4)2SO4 precipitate. See reconstitution instructions for more information.
Rabbit anti-Presenilin 1 loop region Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Presenilin-1 (PSEN1) is a multi-pass membrane protein and component of the gamma-secretase complex. PSEN1 is thought to play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. It may also play a role in hematopoiesis. Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3), a familial early-onset form of Alzheimer disease (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (GDPEAQRRVSKNSKYNA-C) corresponding to human PS1 [301-317] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blot. Suggested dilution of 1:1,000 is recommended for WB. Full length presenilin 1 (467 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 19 kDa. Human or mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Presenilin 1; PS-1; Protein S182; PS1-CTF12; PSEN1; AD3; PS1; PSNL1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by Western blotting using transfected cells, presenilin 1 knock-out mouse cells and mouse and human brain.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
SOD1 binds copper and zinc ions ans is one of two isozymes responsible for destroying free superoxide radicals which are normally produced within the cells and which are toxic to biological systems. SOD1 is a soluble cytoplasmic protein, acting as a homodimer to convert superoxide radicals to molecular oxygen and hydrogen peroxide. Defects in SOD1 are the cause of amyotrophic lateral sclerosis type 1 (ALS1) which is a neurodegenerative disorder affecting upper and lower motor neurons and resulting in fatal paralysis.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A peptide (HEKADDLGKGGNEESTKTG) corresponding to the amino acids 121-139 of human superoxide dismutase (SOD1) conjugated to diphtheria toxin has been used as the immunogen.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. This antibody works superbly in immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 100 to 1: 1000 depending on tissue and detection method. For western blotting a dilution range of 1: 1000 to 1: 4000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Superoxide dismutase; SOD1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody has been shown to be specific for superoxide dismutase (SOD1) protein. Human. Does not detect mouse and rat SOD1.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Rabbit anti-Presenilin 2 loop region Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Autosomal dominant mutations in presenilin 2 are the second major cause of early-onset familial Alzheimer's disease. Presenilin 2 is a multi-transmembrane protein which undergoes endoprotelysis to form an N-terminal fragment of about 29 kDa and C-terminal fragment of about 22 kDa. Presenilin 2 forms the catalytic core of the gamma-secretase complex which cleaves type 1 transmembrane proteins including the amyloid precursor protein to generate the C-terminus of the amyloid beta peptide.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested dilution of 1:1,000 is recommended for WB. Full length presenilin 2 (448 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 22 kDa with this antibody. Human or mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. The suggested dilution for IP is 1:100 . Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
AD3LP, AD5, E5-1, STM-2
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by Western blot using mouse and human brain and knock down of presenilin 2 in vitro using siRNA see ref 6 below. Not reactive with presenilin 1.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-DJ-1/PARK7 Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Autosomal recessive mutations in DJ-1 cause early-onset familial Parkinson's disease. DJ-1 is considered a redox-sensitive cytoplasmic protein found in brain as well as other cell types.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (ASKRALVILAKGAEE-C) corresponding to human DJ-1 [2-16] in the N-terminal domain conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
WB and IHC. Suggested dilution of 1:5,000 is recommended for WB. DJ-1 is a soluble protein of 189 amino acids and detected with 23 kDa mobility by western blotting. The suggested dilution for IHC is 1:100. Detected astrocyte cytoplasmic labelling in human brain formaldehyde-treated tissue. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
PARK7
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using soluble mouse and human brain extracts, reactivity for major product diminished by peptide absorption.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Beta-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Beta-synuclein is a soluble cytoplasmic protein associated with synaptic vesicles and a member of the synuclein family. Mutations in alpha-synuclein cause early onset Parkinson's disease. Expression of beta synuclein may modulate alpha-synuclein aggregation found in Parkinson's disease.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (AQEAAEEPLIEPLME-C) corresponding to human _-synuclein [99-113] in the C-terminal domain conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
WB and IHC. A dilution of 1:500 to 1:1,000 is recommended for Western blot. _-synuclein is a soluble protein of 134 amino acids and detected with 17 kDa mobility by western blotting. By IHC the antibody detects synaptic sites in human brain formaldehyde-treated frozen tissue. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using soluble mouse and human brain extracts, reactivity for major product diminished by peptide absorption. Does not detect alpha-synuclein as tested with recombinant protein and does not react with Lewy bodies in human Dementia with Lewy Bodies or Parkinson's disease brain tissue sections.
Storage:
Lyophilized at 2-8°C. After reconstitution, store at -20°C in undiluted aliquots for up to 6 months. The antibody may be stored short term at 2-2-8°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
Rabbit anti-Nicastrin, C-terminal Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Nicastrin, a type 1 membrane glycoprotein, is an essential component of the gamma secretase complex which is critical for the cleavage of the amyloid precursor protein and other membrane proteins. Nicastrin is widely expressed in different tissue types. This antibody detects all processed forms of Nicastrin.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (C-NAKADVLFIAPREPGAVSY) corresponding to human Nicastrin [691-709] in the C-terminal region conjugated via additional N-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested concentration of 3-10 µg/mL is recommended for WB. Human or mouse brain samples commonly prepared with reducing (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Unprocessed full length human Nicastrin is 709 amino acids, however this protein contains an N-terminal signal peptide which is considered to undergo cleavage during processing and transit to the cell plasma membrane, in addition the protein undergoes glycosylation to produce a glycoprotein of about 145 kDa apparent MW by SDS PAGE. Biosensis recommends that the optimal working dilution should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using peptide absorption.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Nicastrin, Central region Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Nicastrin, a type 1 membrane glycoprotein, is an essential component of the gamma secretase complex which is critical for the cleavage of the amyloid precursor protein and other membrane proteins. Nicastrin is widely expressed in different tissue types. This antibody reacts with immature forms of Nicastrin. Detection of higher mol. wt. mature forms is likely to be blocked by glycosylation in this region of the protein.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (C-QGETFDYIGSSRMVYD) corresponding to human Nicastrin [331-346] in the central region conjugated via additional N-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested concentration of 3-10 µg/mL is recommended for WB. Human or mouse brain samples commonly prepared with reducing (50 mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Unprocessed full length human Nicastrin is 709 amino acids, however this protein contains an N-terminal signal peptide which is considered to undergo removal/cleavage during processing and transit to the cell plasma membrane, in addition the protein undergoes glycosylation to produce a glycoprotein of about 145 kDa apparent MW by SDS PAGE. Biosensis recommends that the optimal working dilution should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using peptide absorption.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Nicastrin, N-terminal Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Nicastrin, a type 1 membrane glycoprotein, is an essential component of the gamma secretase complex which is critical for the cleavage of the amyloid precursor protein and other membrane proteins. Nicastrin is widely expressed in different tissue types. This antibody detects all processed forms of Nicastrin.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (RGNSVERKIYIPL-C) corresponding to human Nicastrin [32-44] in the N-terminal region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested concentration of 3-10 µg/mL is recommended for WB. Human or mouse brain samples commonly prepared with reducing (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Unprocessed full length human Nicastrin is 709 amino acids, however this protein contains an N-terminal signal peptide which is considered to undergo cleavage during processing and transit to the cell plasma membrane, in addition the protein undergoes glycosylation to produce a glycoprotein of about 145 kDa apparent MW by SDS PAGE. Biosensis recommends that the optimal working dilution should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using peptide absorption.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Adenylate cyclase type III (ACIII) Polyclonal Antibody (Unconjugated), suitable for WB, IHC, ICC.
Background Info:
Adenylate cyclases are enzymes which interact with and are activated by the GTP bound alpha subunits of trimeric G-proteins. Activated adenylate cyclases are responsible for the production of the important "second messenger" signalling molecule cyclic-AMP, which is generated from ATP. The type III adenylate cyclase enzyme is localized in the membranes surrounding the cilia in neurons, and our antibody is an excellent marker of neuronal cilia in the brain and in cells in tissue culture. Adenylate cyclase type III is a large complex molecule of, in the human, 1145 amino acids with a deduced molecular weight of 129 kDa. The protein may be variably glycosylated, so that on SDS-PAGE and western blots it runs as a diffuse band of about 160 kDa in cortex and about 200 kDa in olfactory epithelium. The molecule has a complex structure, with 12 transmembrane domains and two cyclase domains. Each cyclase domain is immediately C-terminal to 6 transmembrane segments, but only the second, C-terminal cyclase is believed to be catalytically active.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human (Predicted),Mouse,Other Mammals (Predicted),Rat
Immunogen:
20 amino acid peptide identical to the C-terminus of rat ACIII (amino acids PAAFPNGSSVTLPHQVVDNP)
Applications:
ICC,IHC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:1,000-1:2,000 is recommended for WB. A dilution of 1:5,000-1:10,000 is recommended for ICC and IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The antibody stains a band at about 200 kDa in olfactory epithelium which is rich in cilia. Fewer cilia are found in frontal cortex, and the protein is less heavily glycosylated, and a less prominent band is seen at about 160 kDa. It has also been used successfully for immunocytochemistry on mixed neuron/glia cultures. The antibody has been directly tested for reactivity in rat. It is expected that it will work on human due to homology with the immunogen and possibly other mammal tissues (Human, horse, cow, pig, chicken, mouse).
Storage:
Store lyophilized, unopened vial at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C to -80°C for a higher stability. Avoid freeze-thaw cycles.
FUNCTION: Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. SUBUNIT: Homotetramer. SUBCELLULAR LOCATION: Cytoplasm. Lysosome. Also found in lung secretory organelles. MISCELLANEOUS: The active site is the redox-active Cys-47 oxidized to Cys-SOH. Cys-SOH may rapidly react with a Cys-SH of the other subunit to form an intermolecular disulfide with a concomitant homodimer formation. The enzyme may be subsequently regenerated by reduction of the disulfide by thioredoxin . MISCELLANEOUS: Irreversibly inactivated by overoxidation of Cys-47 (to Cys-SO(3)H) upon oxidative stress. SIMILARITY: Belongs to the ahpC/TSA family. Rehydrin subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Rat recombinant Peroxiredoxin-6. The sequence is homologous in human and mouse peroxiredoxin-6.
Applications:
ELISA,ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works superbly in Immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 100 to 1: 1000 depending on tissue and detection method. For western blotting a dilution range of 1: 1000 to 1: 4000 is recommended. A dilution of 1: 1000 to 1: 4000 is recommended for ELISA. This antiserum stains the cytoplasm of epithelial cells in the rat and mouse lung and rat and human brain astrocytes. It stains human brain astrocytes in Parkinson's and Alzheimer 's disease and the central core of some Lewy bodies in Parkinson's disease and dementia with Lewy bodies. Other tissues have not yet been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Walsh B. et al. (2010) Overexpression of Prdx6 and resistance to peroxide-induced death in Hepa1-6 cells: Prdx suppression increases apoptosis. Redox Rep. 2009;14(6):275-84. Gardiner F. et al. (2010) Induction of Prdx1 and Prdx6 in Liver Cellsby Serum and TPA. Intl J. Biol. Vol. 2, No. 1
Specificity:
This antibody has been shown to be specific for Peroxiredoxin-6 protein. Rat, human and mouse, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Rabbit anti-Spectrin, alpha II Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
The spectrin family of proteins were originally discovered as major components of the submembraneous cytoskeleton of osmotically lysed red blood cells (1). The lysed blood cells could be seen as clear red blood cell shaped objects in the light microscope and were referred to as red cell "ghosts". The major proteins of these ghosts proved to be actin, ankyrin, band 4.1 and several other proteins, including two major bands running at about 240 kDa and 260 kDa on SDS-PAGE gels. This pair of bands was named "spectrin" since they were discovered in these red blood cell ghosts (1). Later work showed that similar high molecular bands were seen in membrane preparations from other eukaryotic cell types. Work by Levine and Willard described a pair of about ~240-260 kDa molecular weight bands which were transported at the slowest rate along mammalian axons (2). They named these proteins "fodrin" as antibody studies showed that they were localized in the sheath under the axonal membrane, but not in the core of the axon (2; fodros is Greek for sheath). Subsequently fodrin was found to be a member of the spectrin family of proteins, and the spectrin nomenclature is now normally used (3). Spectrins form tetramers of two alpha and two beta subunits, with the alpha corresponding to the lower molecular weight ~240 kDa band and the beta corresponding to the ~260 kDa or in some case much larger band. Most spectrin tetramers are about 0.2microns or 200nm long, and each alpha and beta subunit has a cell type specific expression pattern. The basic structure of each spectrin subunit is the spectrin repeat, which is a sequence of about 110 amino acids which defines a compact domain contain three closely packed alpha-helices. Each spectrin subunit contains multiple copies of this repeat, with 20 in each of the alpha subunits. The beta I-IV subunits each contain 17 spectrin repeats, while the beta V subunit, also known as beta-heavy spectrin, contains 30 of these repeats. The various subunits also contain several other kinds of functional domain, allowing the spectrin tetramer to interact with a variety of protein, ionic and lipid targets. The alpha-subunits each contain one calmodulin like calcium binding region and one Src-homology 3 (SH3) domain, an abundant domain involved in specific protein-protein interactions. The beta subunits all have a N-terminal actin binding domain and may also have one SH3 domain and one pleckstrin homology domain, a multifunctional type of binding domain which in beta I spectrin at least binds the membrane lipid PIP2 (5). Spectrins are believed to have a function in giving mechanical strength to the plasma membrane since the tetramers associate with each other to form a dense submembraneous geodesic meshwork (3). They also bind a variety of other membrane proteins and membrane lipids, and the proteins they bind to are therefore themselves localized in the membrane. Diseases may be associated with defects in one or other of the spectrin subunits (6). For example, some forms of hereditary spherocytosis, the presence of spherical red blood cells which are prone to lysis, can be traced to mutations in some of the spectrin subunits (7). The alpha-II subunit is widely expressed in tissues but, in the nervous system, is found predominantly in neurons. The antibody can therefore be used to identify neurons and fragments derived from neuronal membranes in cells in tissue culture and in sectioned material.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
The antibody was raised against a mix of five recombinant constructs containing the entire C-terminal region of human alpha-II spectrin (amino acids 676-2,400).
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunocytochemistry (IC). Suggested dilution for WB is 1:5,000-10,000 and 1:500-1,000 for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The antibody reacts with a 240 kDa band by Western blot on mouse sciatic nerve extract. Minor bands below may be seen and this likely represents in vivo proteolytic fragments of alpha-II spectrin. It has also been used successfully for immunocytochemistry.
Storage:
Store lyophilized, unopened vial at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C to -80°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Lamin A/C Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
The Lamin proteins are members of the intermediate filament protein family but are located inside the nucleus rather than in the cytoplasm (1). The lamins function as skeletal components tightly associated with the inner nuclear membrane. Originally the proteins of the nuclear cytoskeleton were named Lamin A, B and C, from top to bottom as visualized on SDS-PAGE gels. Subsequently it was found that Lamins A and C were coded for by a single gene (2), while the Lamin B band may contain two proteins encoded by two genes now called Lamin B1 and Lamin B2. Lamin A has a mass of about 74 kDa while Lamin C is 65 kDa. The Lamin A protein includes 98 amino acids missing from Lamin C, while Lamin C has a C-terminal 6 amino acid peptide not present in Lamin A. Apart from these regions Lamin A and C are identical so that antibodies raised against either protein are likely to cross react with the other, as is the case with this monoclonal. Lamin polymerization and depolymerization is regulated by phosphorylation by cyclin dependent protein kinase 1 (CDK1), the key component of "maturation promoting factor", the central regulator of cell division. Activity of this kinase increases during cell division and is responsible for the breakdown of the nuclear lamina. Mutations in the LMNA gene are associated with several serious human diseases, including Emery-Dreifuss muscular dystrophy, familial partial lipodystrophy, limb girdle muscular dystrophy, dilated cardiomyopathy, Charcot-Marie-Tooth disease type 2B1, and Hutchinson-Gilford progeria syndrome. This family of diseases belong to a larger group which are often referred to as Laminopathies, though some laminopathies are associated in defects in Lamin B1, B2 or one or other of the numerous nuclear lamina binding proteins. A truncated version of lamin A, commonly known as progerin, causes Hutchinson-Gilford progeria syndrome, a form of premature aging (3).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Other Mammals (Predicted)
Immunogen:
Full length recombinant human Lamin C
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Immunocytochemistry (ICC) and Western Blotting (WB). A dilution of 1:1,000-1:5,000 is recommended for WB. A dilution of 1:1,000-1:5,000 is recommended for ICC. The optimal dilution should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Lamin A and Lamin C. The antibody reacts with a 74 kDa and 65 kDa band by Western blot on HeLa cell extract. It has also been used successfully for immunocytochemistry on HeLa cell cultures.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Vimentin Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Vimentin is the major protein subunit of the 10nm or intermediate filaments protein found in many kinds of mesenchymal and epithelia cells. Vimentin is also found in many kinds of cells in tissue culture and in developing neuronal and astrocytic precursor cells in the central nervous system. Vimentin frequently forms copolymers with other intermediate filament proteins, such as GFAP (in many kinds of astrocytes), with desmin (in muscle cells) and neurofilament proteins (in developing neurons). Antibodies to vimentin are useful in studies of stem cells and generally to reveal the filamentous cytoskeleton.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted)
Immunogen:
Recombinant human Vimentin purified from E. coli.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:1,000-5,000 is recommended for ICC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specific for the ~55 kDa Vimentin protein.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Glyceraldehyde 3-Phosphate Dehydrogenase (GAPDH) is a metabolic enzyme responsible for catalyzing one step in the glycolytic pathway, the reversible oxidative phosphorylation of glyceraldehyde 3-phosphate. GAPDH may have other roles in the activation of transcription and in the regulation of apoptosis as well as Alzheimer's disease and Huntington's disease. The immunogen used to raise this particular antibody was extensively purified pig GAPDH. This antibody can be used as a loading control for western blotting experiments, allowing comparison between the level of this protein and others in a cell or tissue.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted)
Immunogen:
Full length recombinant human GAPDH expressed in and purified from E. coli
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:10,000-1:30,000 is recommended for WB. A dilution of 1:1,000-1:10,000 is recommended for ICC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rabbit anti-Phospho-calcium/calmodulin-dependent protein kinase type II subunit alpha, Thr253 (alpha-CaMKII, Thr253) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Calcium/calmodulin-stimulated protein kinase II (CaMKII) is composed of four different chains (alpha, beta, gamma, and delta) and is abundantly expressed in neurons. CaMKII is involved in regulating many aspects of neuronal function, including neurotransmitter synthesis and release, modulation of ion channel activity and cellular transport. The enzymatic function of CaMKII is regulated by its multiple phosphorylation sites and targeting to sub-cellular locations through interactions with protein binding partners. Phosphorylation of Thr253 has been identified in vivo and found to alter the interaction of CaMKII with binding partners, but not change its enzymatic activity. Thus, phosphorylation of Thr253 is suggested to modulate functional responses based on its binding partner and subsequently its sub-cellular localization.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Rat
Immunogen:
A synthetic peptide (NKmLpTINPSC) corresponding to the sequence around Thr253 (AA 249-257) in alpha-CaMKII was synthesized, purified to 95% purity by HPLC, analyzed by mass spectroscopy and coupled to diphtheria toxoid.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (1:200 - 1:1000). Other applications have not been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Skelding KA et al (2012) J J Cereb Blood Flow Metab 32 (12), 2181-2192. Skelding KA et al (2010) Cell Signal 22 (5), 759-769. Gurd JW et al (2008) Brain Res 1218, 158-165. Migues PV et al (2006) J Neurochem 98 (1), 289-299.
Specificity:
Rat Predicted from gene analysis to react with human and mouse alpha-CaMKII.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
Phospho-calcium/calmodulin-dependent protein kinase type II subunit alpha, Thr253 (alpha-CaMKII, Thr253)
BDNF belongs to the neurotrophin family and promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. POst translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from a solution containing PBS pH 7.4, 3% trehalose, with 0.05% sodium azide.
Host Animal:
Rabbit
Species Reactivity:
Human,Other Mammals (Predicted)
Immunogen:
Antibody was raised against a GST-tagged rhBDNF fusion protein and expressed in and purified from E. coli.
Applications:
ELISA
Antibody Isotype:
IgG
Application Details:
<b>Western Blotting (denaturing and reducing):</b> 0.2 to 1 µg/mL. Antibody detects 14 kDa mature BDNF monomer and 32 kDa proBDNF monomer in cell lysate and tissue homonenate. Antibody has only been tested on cell lysate and tissue homogenate of human origin. Acid-treated samples may give cleaner blots, and enhance signals for BDNF. R-1707-100 is not recommended for human serum samples. For human serum analysis, we recommend mouse monoclonal antibody to rhBDNF (M-1744-50/100), or rabbit polyclonal antibody to BDNF peptide 1-10 (R-083-100, whole serum; R-066-500, IgG).<br><br><b>Flow Cytometry:</b> ~2 µg per 10^6 cells, methanol fixation. Note: R-1707-100 cannot be used to distinguish the flow cytometry signal originating from mature BDNF versus proBDNF.<br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Brain-derived neurotrophic factor; Abrineurin
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human, rat and mouse BDNF. Expected to detect BDNF from other species due to sequence homology. No cross-reactivity with other neurotrophins.
Storage:
Store lyophilized antibody at 2-8°C protected from moisture. After reconstitution divide antibody into useful aliquots and keep aliquots at -20°C to -80°C for a higher stability. Working aliquots can be kept at 2-8°C for up to 1 month. Avoid repetitive freeze/thaw cycles.
GPx-P belongs to the glutathione peroxidase family which are responsible for the detoxification of hydrogen peroxide. It protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. GPx-P is secreted in plasma and exists as a homotetramer.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (FEKGDVNGEKEQKFYTFLKN) corresponding to the amino acids 135-154 of human glutathione peroxidase 3 (GPx-P) conjugated to diphtheria toxin has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from glutathione peroxidase 3 (GPx-P) protein in mouse, rat, orangutan and bovine.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC, only. A dilution o f 1: 1000 to 1: 5000 is recommended for immunohistochemistry depending on detection method but end user will need to determine dilution to suit application. Antigen retrieval is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
This antibody has been shown to be specific for glutathione peroxidase 3 protein (GPx-P) through staining and blocking studies. Human and rat, other species have not yet been ested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Neuropeptide Y (NPY) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Neuropeptide Y is a 36 amino acid neurotransmitter found in the brain and autonomic nervous system. It has been associated with numerous physiologic processes in the brain, including the regulation of energy balance, memory and learning, and epilepsy. The main effect is increased food intake and decreased physical activity. It is also implicated in the secretion of gonadotrophin-release hormone. It is secreted by the hypothalamus and it is one of the most abundant peptides in the nervous system. It is also found in some chromaffin cells of the adrenal medulla. The sheep form of NPY is 94% homologous with human NPY.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat,Sheep
Immunogen:
Sheep Neuropeptide Y (29-64: NB. includes only the NPY peptide and not either of the flanking peptides) conjugated to keyhole limpet hemocyanin.
Corder KM et al. (2018) Prefrontal cortex-dependent innate behaviors are altered by selective knockdown of Gad1 in neuropeptide Y interneurons. PLoS One. 2018 Jul 19;13(7):e0200809 Application: IHC/IF, frozen sections.
Specificity:
Specificity has been confirmed by direct ELISA against the antigen. Sheep, Human, Mouse & Rat.
Storage:
Maintain lyophilized material at 2-8°C for up to 12 months. After reconstitution keep aliquots at -20°C for up to six months or at 2-8°C with an appropriate antibacterial agent for up to 4 weeks. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified on antigen column. Refer to vial label for antibody concentration after reconstitution.
The protein named TrkB (also named Neurotrophic tyrosine kinase receptor type 2 (NTRK2), GP145-TrkB or Tropomyosin-related kinase B is a receptor tyrosine kinase involved in the development and the maturation of the central and the peripheral nervous systems and is important in the regulation of neuron survival, proliferation, migration, differentiation, and synapse formation and plasticity. TrkB may also play a role in neutrophin-dependent calcium signaling in glial cells and mediate communication between neurons and glia. TrkB is the primary receptor for BDNF (brain-derived neurotrophic factor. TrkB also binds NT4 and NT3 but less efficiently. Upon ligand-binding, the receptor undergoes homodimerization, autophosphorylation and activation. TrkB activation recruits, phosphorylates and/or activates several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that each regulate distinct overlapping signaling cascades within cells. Through SHC1, FRS2, SH2B1, SH2B2, these activate the GRB2-Ras-MAPK cascade that regulates, for instance, neuronal differentiation including neurite outgrowth. These same effectors also control the Ras-PI3 kinase-AKT1 signaling cascade that mainly regulates growth and survival. TrkB, via activation of PLCG1 and the downstream protein kinase C-regulated pathways, also controls synaptic plasticity, and thus plays a role in learning and memory by regulating both short term synaptic function and long-term potentiation. PLCG1 also leads to NF-Kappa-B activation and the transcription of genes involved in cell survival. One such consequence is that PLCG1 activation via TrkB is able to suppress anoikis, the apoptosis resulting from loss of cell-matrix interactions. (Reference: www.uniprot.org)
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized.
Host Animal:
Rabbit
Species Reactivity:
Chicken (Predicted),Human,Mouse,Rat (Predicted)
Immunogen:
Synthetic peptide immunogen, AKASPV[pY]LDILG
Applications:
WB
Antibody Isotype:
IgG
Application Details:
<b>Western Blotting (0.5 2 µg/mL).</b> High skim milk concentration (5%) causes suppression of pY817 signal, suggesting that 5% skim milk should be avoided as blocking buffer and antibody diluent. Strongest signal is obtained in 5% BSA blocking buffer, however, many non-specific bands are present. An equal mixture of skim milk and BSA (2.5% each) appears to provide the best compromise between signal and noise. However, optimization of blocking condition is recommended for each particular sample, with excess of BSA over skim milk likely to be beneficial for best results.<br><br>Other applications have not been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Detects full-length TrkB phosphorylated at amino acid Y817 in humans (Y816 in mouse and rat).
Physical State:
Solid
Positive Control:
Retinoic acid- and BDNF-treated NSC34 cells
Specificity:
Human TrkB (pY817). Antibody has been shown to be specific for TrkB phosphorylated on tyrosine 817 by phospho-peptide absorption dot blots, and on cell lysates from cell lines induced with retinoic acid and BDNF. Antibody detects a clear band in retinoic acid (RA) and BDNF-treated NSC34 cell lysates at ~120 kDa only, demonstrating that the phosphorylated TrkB receptor is being detected. While not fully tested, this antibody may detect phosphorylated TrkA (pY791/794, human/rodent) and TrkC (pY834/820/859, human/mouse/rat) due to high degree of amino acid homology surrounding the phosphorylation site.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Product Validation Info:
Antibody detects a clear band in retinoic acid (RA) and BDNF-treated NSC34 cell lysates at ~120 kDa only
The protein named TrkB (also named Neurotrophic tyrosine kinase receptor type 2 (NTRK2), GP145-TrkB or Tropomyosin-related kinase B is a receptor tyrosine kinase involved in the development and the maturation of the central and the peripheral nervous systems and is important in the regulation of neuron survival, proliferation, migration, differentiation, and synapse formation and plasticity. TrkB may also play a role in neutrophin-dependent calcium signaling in glial cells and mediate communication between neurons and glia. TrkB is the primary receptor for BDNF (brain-derived neurotrophic factor. TrkB also binds NT4 and NT3 but less efficiently. Upon ligand-binding, the receptor undergoes homodimerization, autophosphorylation and activation. TrkB activation recruits, phosphorylates and/or activates several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that each regulate distinct overlapping signaling cascades within cells. Through SHC1, FRS2, SH2B1, SH2B2, these activate the GRB2-Ras-MAPK cascade that regulates, for instance, neuronal differentiation including neurite outgrowth. These same effectors also control the Ras-PI3 kinase-AKT1 signaling cascade that mainly regulates growth and survival. TrkB, via activation of PLCG1 and the downstream protein kinase C-regulated pathways, also controls synaptic plasticity, and thus plays a role in learning and memory by regulating both short term synaptic function and long-term potentiation. PLCG1 also leads to NF-Kappa-B activation and the transcription of genes involved in cell survival. One such consequence is that PLCG1 activation via TrkB is able to suppress anoikis, the apoptosis resulting from loss of cell-matrix interactions. (Reference: www.uniprot.org)
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized.
Host Animal:
Rabbit
Species Reactivity:
Chicken (Predicted),Human,Mouse,Rat
Immunogen:
Synthetic peptide immunogen, SNDDDSA[pS]PLHHIS
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
<b>Western Blotting (0.5 - 2 µg/mL).</b> Cell lysates or membrane preparations prepared from isolated brain or spinal cord tissues are recommended. This antibody works on skim milk blocked membranes, however, best results are obtained with a equal mixture of 2.5% skim milk / 2.5% highly purified BSA as blocking reagent and antibody diluent.<br><b>Immunohistochemistry (1 - 5 µg/mL).</b> Antibody has been shown to work on PFA fixed, frozen sections. TBS is preferred for buffer preparation.<br> Other applications have not been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Detects full-length TrkB phosphorylated at amino acid S479 in humans (S478 in mouse and rat).
Physical State:
Solid
Positive Control:
Retinoic acid- and BDNF-treated NSC34 cells
Product references:
Turnbull MT et al. (2018), Acute Down-regulation of BDNF Signaling Does Not Replicate Exacerbated Amyloid-? Levels and Cognitive Impairment Induced by Cholinergic Basal Forebrain Lesion. Front Mol Neurosci. 2018 Feb 22;11:51. Species: Mouse ; Application: WB, hippocampal lysates. Matusica D et al. (2016), Inhibition of motor neuron death in vitro and in vivo by a p75 neurotrophin receptor intracellular domain fragment. J Cell Sci. 2016 Feb 1;129(3):517-30. doi: 10.1242/jcs.173864. Epub 2015 Oct 26. Species: Mouse ; Application: WB, spinal cord lysates.
Specificity:
Human TrkB (pS478). Antibody has been shown to be specific for TrkB phosphorylated on serine 478 by phospho-peptide absorption dot blots, and on cell lysates from cell lines induced with retinoic acid and BDNF. Antibody detects a clear band in retinoic acid (RA) and BDNF-treated NSC34 cell lysates at ~120 kDa only, demonstrating that the phosphorylated TrkB receptor is being detected. Additional non-specific bands at lower molecular weight may be observed in lysates and homogenates with the antibody and these bands have not been characterized.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Product Validation Info:
Antibody is specific for TrkB serine phosphorylation at amino acid 478/479 (rodents/human). Lambda-phosphatase treatment obliterates positive staining.
Rabbit anti-Activity-regulated gene 3.1 protein homolog (Arg3.1) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Arc (also termed activity-regulated cytoskeleton-associated protein or Arg3.1), is an effector immediate early gene whose upregulation has been demonstrated during events of synaptic plasticity. Arg3.1 expression is detectable in neuronal cell bodies and dendrites in the brain regions including striatum and cortex hippocampus, hypothalamus, amygdala.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide from the C terminal of human Arg3.1 protein (ARC protein) conjugated to Blue Carrier Protein. The sequence is homologous with mouse and rat form of Arg3.1.
Applications:
IHC-Frozen
Antibody Isotype:
IgG
Application Details:
IHC. A concentration of of 2-4 µg/mL is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specific for Arg3.1. Rat and Mouse. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Protein G purified IgG
Target:
Activity-regulated gene 3.1 protein homolog (Arg3.1)
FUNCTION: Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. In the heterodimer, FOS and JUN/AP-1 basic regions each seems to interact with symmetrical DNA half sites. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. In growing cells, activates phospholipid synthesis, possibly by activating CDS1 and PI4K2A. This activity requires Tyr-dephosphorylation and association with the endoplasmic reticulum. SUBUNIT: Heterodimer. Interacts with DSIPI; this interaction inhibits the binding of active AP1 to its target DNA. Interacts with MAFB. SUBCELLULAR LOCATION: Nucleus. INDUCTION: C-fos expression increases upon a variety of stimuli, including growth factors, cytokines, neurotransmitters, polypeptide hormones, stress and cell injury. SIMILARITY: Belongs to the bZIP family. Fos subfamily. SIMILARITY: Contains 1 bZIP domain (Ref: uniprot.org).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Full length, E.coli-derived recombinant human c-FOS protein.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Immunocytochemistry (ICC): 1:2,000-1:10,000.<br><br>Immunohistochemistry (IHC): 1:20,000-1:50,000. This antibody has been shown to work on 4% PFA fixed mouse brain sections. Note that non-specific staining has been observed on tissue sections when using this antibody at dilutions of 1:5,000 or lower.<a class="newA" target="_blank" href="https://www.biosensis.com/documents/enhancedinfo/R-1751-50_IHC Method_as_at_March2018.pdf"> Click here </a> for instructions on use of this antibody in IHC on free-floating brain sections.<br><br>Western blotting (WB): 1:1,000-1:2,000. This antibody detects bands between 50-65 kDa, which only appear in stimulated cells. <br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Cellular oncogene fos; G0/G1 switch regulatory protein 7; cFOS
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Lin King JV (2020). Stinging Sensations: Activation Mechanisms of the Wasabi Receptor, TRPA1. PhD Thesis. Application: IHC (IF) . Species: Mouse. Lin King JV et al. (2019). A Cell-Penetrating Scorpion Toxin Enables Mode-Specific Modulation of TRPA1 and Pain. Cell. [Epub ahead of print]. Application: IHC . Species: Mouse.
Storage:
Store lyophilized, unopened vial at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human (aa: 139-149), mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
BDNF belongs to the neurotrophin family and promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. Post translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Immunogen:
A synthetic peptide (C-ELLDEDQKVRPNEE) as a part of human BDNF precursor protein (aa: 69-82) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, WB. 1-5 µg/mL is recommended for both applications, Flow Cytometry (2?g/10^6 cells). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Le Blanc J et al. (2020) Platelets Selectively Regulate the Release of BDNF, But Not That of Its Precursor Protein, proBDNF. Front Immunol. 11:575607 Application: Human, WB. Macias M et al. (2007) Locomotor exercise alters expression of pro-brain-derived neurotrophic factor, brain-derived neurotrophic factor and its receptor TrkB in the spinal cord of adult rats. Eur J Neurosci. 25(8):2425-44 Application: Rat
Specificity:
Used in western blot, this antiserum detects a 35 kDa band corresponding to the molecular weight of proBDNF. No cross reactivity with other proneurotrophins was detected. This antibody is known to react with human, mouse and rat proBDNF and also expected to recognise other mammalian proBDNF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Beta casein protein Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Beta-casein has an important role in determination of the surface properties of the casein micelles. it is cleaved into 3 chains (casoparan, casohypotensin and antioxidant peptide). Casoparan acts as a macrophage activator, increasing the phagocytic activity of macrophages and peroxide release from macrophages. It also acts as a bradykinin-potentiating peptide. Casohypotensin acts as a bradykinin-potentiating peptide and induces hypotension in rats. Acts as a strong competitive inhibitor of endo-oligopeptidase A. Antioxidant peptide has antioxidant activity (ref: uniprot.org.).<br /><br />Bovine milk contains two types of beta-casein protein, A2 or A1. Recent studies have shown that milk containing the A1 beta casein protein can contribute to issues including gastrointestinal discomfort after ingestion. There is some evidence of a link between ingestion of A1 beta casein protein and the development of Type 1 diabetes.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS, pH 7.4, with 0.02% sodium azide as preservative. Refer to the product label for antibody concentration.
Host Animal:
Rabbit
Species Reactivity:
Bovine
Immunogen:
Bovine beta-casein peptides
Applications:
ELISA,WB
Antibody Isotype:
IgG
Application Details:
ELISA and western blotting (1:5,000 - 1: 20,000). Do not use skim milk for blocking and dilution of assay reagents, BSA is recommended. Biosensis recommends that optimal working dilutions should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Physical State:
Liquid.
Product references:
Indyk HE et al. (2021) The determination of intact ?-casein in milk products by biosensor immunoassay. J. Food Compos. Anal. 101:103946 Application: Immunoassay.
Specificity:
Bovine beta-casein. Detects both A1 and A2 beta-casein isoforms.
Storage:
Spin vial briefly before opening and centrifuge to remove any insoluble material. After opening maintain at -20°C in undiluted aliquots for up to 6 months. For short-term storage, keep aliquot at 2-8°C for up to one week. Avoid repeated freeze-thaw cycles.
Calretinin is a calcium-binding protein which is abundant in auditory neurons. Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Rat
Immunogen:
Full-length recombinant human protein
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:5,000-1:10,000), Immunohistochemistry (1:5,000-1:10,000) and Immunocytochemistry (1:1,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
CR, 29 kDa calbindin
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human, Cow, Rat, Mouse. Antibody is specific for calretinin and does not recognize closely related proteins parvalbumin and calbindin as determined by Western Blotting.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
May participate in RNA metabolism in the myelinating cell, CNP is the third most abundant protein in central nervous system myelin. Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Full-length recombinant human protein
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunocytochemistry (1:1,000-1:2,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human, Rat, Mouse.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Ki-67 Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly (PubMed:27362226). Associates with the surface of the mitotic chromosome, the perichromosomal layer, and covers a substantial fraction of the chromosome surface (PubMed:27362226). Prevents chromosomes from collapsing into a single chromatin mass by forming a steric and electrostatic charge barrier: the protein has a high net electrical charge and acts as a surfactant, dispersing chromosomes and enabling independent chromosome motility (PubMed:27362226). Binds DNA, with a preference for supercoiled DNA and AT-rich DNA (PubMed:10878551). Does not contribute to the internal structure of mitotic chromosomes (By similarity). May play a role in chromatin organization (PubMed:24867636). It is however unclear whether it plays a direct role in chromatin organization or whether it is an indirect consequence of its function in maintaining mitotic chromosomes dispersed (Probable). Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant human Ki-67 protein (amino acids 1,111-1,490) expressed in and purified from <i>E. coli.</i>
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:2,000-1:10,000) and Immunocytochemistry (1:1,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
KI-67
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human only. Does not react with Mouse or Rat.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Laminin-111 Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organisation of cells into tissues during embryonic development by interacting with other extracellular matrix components. Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
Laminin-111 isolated from mouse EHS cells
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunohistochemistry (1:1,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Laminin 1, Laminin _1_1_1.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Mouse,reacts with Mouse and Rat, other species not tested. This antibody recognizes laminin isotypes alpha-1 (440 kDa), beta-1 (220 kDa) and gamma-1 (220 kDa). It also binds laminin binding protein at 120 kDa which always co-expresses with laminin.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Methyl-CpG- binding protein 2 (MeCP2) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Chromosomal protein that binds to methylated DNA. It can bind specifically to a single methyl-CpG pair. It is not influenced by sequences flanking the methyl-CpGs. Mediates transcriptional repression through interaction with histone deacetylase and the corepressor SIN3A. Binds both 5-methylcytosine (5mC) and 5-hydroxymethylcytosine (5hmC)-containing DNA, with a preference for 5-methylcytosine (5mC). Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (REEPVDSRTPVTERVS, aa: 471-486) of C-terminus of human protein.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunohistochemistry (1:1,000) Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
CNPase
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human, Mouse, Rat.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Nestin Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Required for brain and eye development. Promotes the disassembly of phosphorylated vimentin intermediate filaments (IF) during mitosis and may play a role in the trafficking and distribution of IF proteins and other cellular factors to daughter cells during progenitor cell division. Required for survival, renewal and mitogen-stimulated proliferation of neural progenitor cells (By similarity). Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Part of recombinant human protein (amino acids 315-630).
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunocytochemistry (1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human. Other species not tested.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation. Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
C-terminal peptide of human IBA1 protein coupled to KLH.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunohistochemistry (1:2,000-1:5,000); Immunocytochemistry (1:1,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Allograft inflammatory factor 1, AIF-1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human, Rat, Mouse.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Ubiquitin Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, ICC.
Background Info:
Ubiquitin is a highly conserved 76 amino acid protein with an estimated molecular weight of 8.56 kDa which has a central role in regulated protein degradation. It is a protein modifier which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Several types of polymeric chains can be formed depending on the lysine used for the assembly. Attachment to proteins as a polymer leads to their degradation by the 26S proteosome; a complex, multicatalytic cytosolic and nuclear protease. Attachment to proteins as a monomer or as an alternatively linked polymer does not lead to proteasomal degradation and may be required for numerous functions, including maintenance of chromatic structure, regulation of gene expression, stress response, ribosome biogenesis and DNA repair. Ubiquitin is synthesized as a polyubiquitin precursor with exact head to tail repeats, the number of repeats of which differ between species and strains. In some species there is a final amino-acid after the last repeat, here in bovine a Cys. Some ubiquitin genes contain a single copy of ubiquitin fused to a ribosomal protein (either L40 or S27a).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.2, 100mM NaCl, 15mM sodium azide.
Ubiquitin isolated from cow erythrocytes and conjugated to chicken gammaglobulins with glutaraldehyde.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
This antibody is recommended for IHC, WB and immunoprecipitation. This antibody can be used for labelling formalin-fixed, paraffin-embedded tissue sections at a dilution range of 1:150 to 1:300. This antibody is also useful for investigating neurodegenerative diseases such as Alzheimer 's disease and Parkinson's disease. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
RPS27A; UBA52; UBB; UBC
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been determined by indirect ELISA against ubiquitin conjugated to keyhole limpet haemocyanin. The antibody does not react with kehole limpet haemocyanin alone. Specificity has also been demonstrated by WB against endometrial tissue homogenates. Cross reacts with human, baboon and rat ubiquitin. Other species have not been tested. Ubiquitin protein sequence is 100% conserved in all higher mammals and most eukarotes.
Storage:
After reconstitution keep aliquots at -20°C for higher stability or at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
LRRK2 is a member of the leucine-rich repeat kinase family. Its role is yet unknown but it may play a role in the phoshorylation of proteins central to parkinson diseases. LRRK2 contains an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a mLK-like domain and a WD40 domain. LRRK2 is present in the cytoplasm but also associates with the mitochondrial outer membrane. Defects in LRRK2 are the cause of Parkinson disease 8 (PARK8). Parkinson disease is characterised by bradykinesia, resting tremor, muscular rigidity and postural instability, as well as by a clinically significant response to treatment with levodopa. The pathology involves the loss of dopaminergic neurons in the substantia nigra and the presence of Lewy bodies (intraneuronal accumulations of aggregated proteins), in surviving neurons in various areas of the brain. PARK8 is an autosomal-dominant late-onset parkinsonism, characterized by onset from 50 to 65 years, with slow progression and relatively benign course.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (CLKRKRKILSSDDSLRSS) corresponding to amino acids 946 - 962 of the human LRRK2 protein conjugated to diptheria toxin was used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
IgG
Application Details:
IHC. A dilution range of 1:500 to 1:1000 is recommended. Other applications have not yet been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity was demonstrated by immunohistochemistry. The antibody stains positive tangles in inferior temporal cortex of human brain affected by Alzheimer's disease. This antiserum has been successfully tested in human. Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Green fluorescent protein (GFP) Polyclonal Antibody (Unconjugated), suitable for WB, IHC.
Background Info:
The green fluorescent protein (GFP) is a 27 kDa protein isolated originally from the jellyfish Aequoria victoria. It has an endogenous fluorochrome activity with excitation maximum at 395nm and emission maximum at 509 nm, which is similar to that of fluorescein. GFP can be expressed in fluorescent form in essentially any prokaryotic or eukaryotic cell. This GFP rabbit antibody was made against a recombinant GFP construct originating from an Aequoria species which was engineered to improve spectral properties and prevent oligomerization (1). This form of GFP, referred to as AcGFP, is 94% identical to the eGFP developed by Tsien and co-workers. The antibody can be used to verify the expression, size and stability of both AcGFP and eGFP fusion proteins in western blotting experiments and to amplify GFP signals in tissues of transgenic animals.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Species Independent
Immunogen:
Recombinant AcGFP purified from E. coli
Applications:
IHC,WB
Antibody Isotype:
IgG
Application Details:
Immunocytochemistry (1:2,000 - 1:5,000) and Western Blot (1:1,000 - 1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Aequorea victoria green fluorescent protein
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
GFP, cross reactivity with other mutant forms is expected as immunogen was a whole molecule GFP
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Rabbit anti-Microtubule-associated protein Tau (MAPT) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
FUNCTION: Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization. SUBCELLULAR LOCATION: Cytoplasm; cytosol. Cell membrane. Mostly found in the axons of neurons, in the cytosol and in association with plasma membrane components. ALTERNATIVE PRODUCTS: 8 named isoforms produced by alternative splicing. Additional isoforms seem to exist. Isoforms differ from each other by the presence or absence of up to 5 of the 15 exons. One of these optional exons contains the additional tau/MAP repeat. TISSUE SPECIFICITY: Expressed in neurons. Isoform PNS-tau is expressed in the peripheral nervous system while the others are expressed in the central nervous system. DEVELOPMENTAL STAGE: Four-repeat (type II) tau is expressed in an adult-specific manner and is not found in fetal brain, whereas three-repeat (type I) tau is found in both adult and fetal brain. DOMAIN: The tau/MAP repeat binds to tubulin. In Alzheimer disease, the neuronal cytoskeleton in the brain is progressively disrupted and replaced by tangles of paired helical filaments and straight filaments, mainly composed of hyperphosphorylated forms of Microtubule-associated protein Tau. Defects in Microtubule-associated protein Tau are a cause of frontotemporal dementia and parkinsonism linked to chromosome 17, as well as a number of other neurodegenerative diseases.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Pig
Immunogen:
Recombinant human Microtubule-associated protein Tau, purified from E.coli.
Applications:
ELISA,WB
Antibody Isotype:
Mixed
Application Details:
WB and direct ELISA (Human). For WB a dilution of 1:500 is recommended. This antibody has been shown to detect the purified recombinant Tau expressed in E.Coli as well as a number of Tau isoforms in porcine cytosol. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neurofibrillary tangle protein; Paired helical filament-tau; PHF-tau; MAPT; MTBT1; TAU
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Ballaz S, Morales I, Rodriguez M, Obeso JA. (2013) Ascorbate prevents cell death from prolonged exposure to glutamate in an in vitro model of human dopaminergic neurons. J. Neurosci Res. Aug 30 2013 [E print]
Specificity:
Specificity was demonstrated by western blot. 20ng recombinant Tau is easily detected with smaller fragments likely representing degradation products from the purified protein, which has been expressed in E. Coli. This antiserum is known to react with human and pig Microtubule-associated Tau proteins. Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Beta-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Non-amyloid component of senile plaques found in Alzheimer disease. Could act as a regulator of SNCA aggregation process. Protects neurons from staurosporine and 6-hydroxy dopamine (6OHDA)-stimulated caspase activation in a p53/TP53-dependent manner. Contributes to restore the SNCA anti-apoptotic function abolished by 6OHDA. Not found in the Lewy bodies associated with Parkinson disease (Ref: uniprot.org).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Full-length human recombinant ?-synuclein protein expressed in and purified from E. Coli.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:2,000) and Immunohistochemistry (frozen sections, 1:1,000-1:2,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Beta-synuclein, ?-synuclein
Biosensis Brand:
Biosensis®
Cellular Localisation:
Intracellular, cytosolic.
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Immunogen length:
Full-length recombinant protein.
Physical State:
Solid.
Specificity:
Specific for ?-synuclein, does not cross-react with ?- or ?-synuclein.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Product Validation Info:
Validated by western blotting and immunohistochemical procedures.
Purification:
Affinity-purified from rabbit serum using the immunogen.
Rabbit anti-Pan-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, FC.
Background Info:
A family of homologous proteins known as alpha-, beta-, and gamma-synuclein are abundantly expressed in brain, especially in the presynaptic terminal of neurons. Although the precise function of these proteins remains unknown, alpha-synuclein has been implicated in synaptic plasticity associated with avian song learning as well as in the pathogenesis of Parkinson's disease (PD), dementia with LBs (DLB), some forms of Alzheimer's disease (AD), and multiple system atrophy (MSA).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.2-7.6, containing 0.1% trehalose without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (AKEGVVAAAEKTKQGV) as a consensus part of human alpha-, beta-, and gamma synuclein proteins has been used as the immunogen.
Applications:
FC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (0.5-2 ?g/mL). Flow Cytometry (10-20 ?g/mL). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Immunogen epitope location:
Amino acids 11-26 of human alpha-synuclein protein.
Immunogen length:
16 amino acids.
Physical State:
Solid.
Specificity:
This antibody recognises human, mouse, rat alpha-, beta- and gamma-synuclein.
Storage:
After reconstitution keep aliquots at -20°C for long-term stability. Working aliquots can be kept at 2-8°C for up to 4 weeks, or longer with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Product Validation Info:
Validated by western blotting and flow cytometry.
Purification:
Purified by affinity chromatography against the peptide immunogen.
Rabbit Polyclonal Antibody to Neurofilament NF-L C-terminus (Unconjugated), suitable for WB, IF, ICC.
Background Info:
Neurofilaments are the 10nm or intermediate filament proteins found specifically in neurons, and are composed predominantly of three major proteins called NF-L, NF-M and NF-H, though other filament proteins may be included also. The major function of neurofilaments is likely to control the diameter of large axons. NF-L is the neurofilament light or low molecular weight polypeptide and runs on SDS-PAGE gels at 68-70kDa with some variability across species. Antibodies to NF-L are useful for identifying neuronal cells and their processes in cell culture and sectioned material. NF-L antibody can also be useful for the visualization of neurofilament rich accumulations seen in many neurological diseases, such as Lou Gehrigs disease (ALS), giant axon neuropathy, Charcot-Marie Tooth disease and others.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Pig,Rat
Immunogen:
C-terminal synthetic peptide of rat NF-L protein,(GEEEDTKESEEEEKKEESAGEEQAAKKKD) with an N-terminal Cys for coupling to KLH.
Applications:
FC,ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (IHC) and Flow Cytometry (2 ug per 10^6 cells). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:100 - 1:500 is recommended for IC and IH. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neurofilament light polypeptide; 68 kDa neurofilament protein; Neurofilament triplet L protein
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Physical State:
Solid
Product references:
Bacioglu M et al. (2016) Neurofilament light chain in blood and CSF as a marker of disease progression in mouse models and in neurodegenerative diseases. Neuron. 27292537 Application: Mouse and Human.
Specificity:
No cross reactivity with other proteins.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Fox3 is one of a family of mammalian homologues of Fox-1. The Fox proteins are about 46 kDa in size, and each includes a central highly conserved RRM type RNA recognition motif. Much interest has focused on Fox3 as a result of the recent finding that this protein corresponds to NeuN, a neuronal nuclear antigen. NeuN/Fox-3 has a function in RNA splicing and is expressed heavily and specifically in neuronal nuclei and cytoplasm. Our antibody was raised against the N-terminal 100 amino acids of human Fox3 as expressed in and purified from E. coli. We did not use full length Fox3 as immunogen since the three mammalian Fox homologues, namely Fox1, Fox2 and Fox3, include virtually identical RRM motifs. The N-terminal region of the three molecules are much more variable in the three molecules so antibodies specific for each of the three molecules can therefore be generated.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Peptide corresponding to amino acids 5-24 of human FOX3 coupled to KLH.
Applications:
ICC,IHC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:500 - 1:1,000 is recommended for WB. A dilution of 1:5,000 - 1:10,000 is recommended for ICC and IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Feminizing locus on X; Fox-1; Fox3; NeuN; NeuN antigen; Neuronal nuclei antigen; Fox-1 homolog C; RNA binding protein fox-1 homolog 3
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Rabbit anti-Beta Amyloid Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
The beta Amyloid peptide is derived from the cleavage of the Amyloid precursor protein and varies in length from 39 to 43 amino acids. Beta amyloid peptides are the major constituents of the plaques and tangles that occur in Alzheimer's disease.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (DAEFRHDSGYEVHH) conjugated to bovine serum albumin (BSA) corresponding to amino acid sequence 1-14 of mature human beta amyloid.
Applications:
ELISA
Antibody Isotype:
Mixed
Application Details:
ELISA. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human beta amyloid, cross reactivity to APP has not bee tested.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
2 mM Sodium Phosphate, 0.03 M Sodium Chloride, pH 7.8, 10 mg/ml Sucrose
Preservative:
0.04% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10mM Sodium Phosphate, 0.5 M Sodium Chloride, pH 7.6
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Bovine IgG (H&L)
Purity:
> 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Bovine IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on bovine IgG · light chains on all bovine immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin bovine serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Bovine IgG (H&L)
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Bovine IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on bovine IgG · light chains on all bovine immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin bovine serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Bovine IgG (H&L)
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Bovine IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on bovine IgG · light chains on all bovine immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin bovine serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Bovine IgG (H&L)
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Bovine IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on bovine IgG · light chains on all bovine immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin bovine serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Bovine IgG (H&L)
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Bovine IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on bovine IgG · light chains on all bovine immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin bovine serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on chicken IgG/Y · light chains on all chicken immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin chicken serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Chicken IgG/Y, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on chicken IgG/Y · light chains on all chicken immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin chicken serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Chicken IgG/Y, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on chicken IgG/Y · light chains on all chicken immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin chicken serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Chicken IgG/Y, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on chicken IgG/Y · light chains on all chicken immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin chicken serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on cat IgG · light chains on all cat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin cat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Guinea Pig IgG
Purity:
> 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Guinea Pig IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on guinea pig IgG · light chains on all guinea pig immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin guinea pig serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Guinea Pig IgG
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Guinea Pig IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on guinea pig IgG · light chains on all guinea pig immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin guinea pig serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Guinea Pig IgG
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Guinea Pig IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on guinea pig IgG · light chains on all guinea pig immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin guinea pig serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Guinea Pig IgG
Purity:
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Guinea Pig IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on guinea pig IgG · light chains on all guinea pig immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin guinea pig serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to:<br>ââ¬Ã¢ non-immunoglobulin goat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 0.55 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 0.55 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified goat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 0.55 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG · light chains on all goat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · IgG from human, mouse or rat
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · Goat IgG F(ab)'2 fragment
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · Goat IgG F(ab)'2 fragment
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · Goat IgG F(ab)'2 fragment
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · Goat IgG F(ab)'2 fragment
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · goat IgG, F(ab)2 fragment · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · goat IgG, F(ab)2 fragment · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · goat IgG, F(ab)2 fragment · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Goat IgG, Fc fragment
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on goat IgG
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin goat serum immunoglobulins · light chains on all goat immunoglobulins · goat IgG, F(ab)2 fragment · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Hamster IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on hamster IgG · light chains on all hamster immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin hamster serum immunoglobulins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified human IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
CAA10835
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified human IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
CAA10835
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on human IgG · light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: ¢heavy (γ) chains on human IgG ¢light chains on all human immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: ¢non-immunoglobulin human serum proteins ¢Mouse IgG and serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (µ) chains on human IgM
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins · light chains on all human immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgM (µ chain)
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (µ) chains on human IgM
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins · light chains on all human immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgM (µ chain)
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (µ) chains on human IgM
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins · light chains on all human immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgM (µ chain)
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (µ) chains on human IgM
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins · light chains on all human immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Human IgM (µ chain)
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (µ) chains on human IgM
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin human serum immunoglobulins · light chains on all human immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Storage:
2-8 °C
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Storage:
2-8 °C
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human Visfatin
Cross Reactivity:
Not
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 0.11 ml of deionized water and let stand 30 minutes at room temperature to dissolve. Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Specificity:
Human Resistin
Cross Reactivity:
Not Tested Against Other Species
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Na/K Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store at 2-8°C for use within 1-3 weeks or -20°C for long term storage, avoid repeat freeze thaws.
Specificity:
Human IL6
Cross Reactivity:
Not Tested Against Other Species
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human Omentin
Cross Reactivity:
Not Tested Against Other Species
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human gACRP-30
Cross Reactivity:
Not Tested Against Other Species
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
AAQ19986
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
AAQ19986
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
AAQ19986
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Accession Number:
AAQ19986
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Llama IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Llama IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Llama IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on llama IgG · light chains on all llama immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin llama serum immunoglobulins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Mouse IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin mouse serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
> 90% based on SDS-PAGE Small amounts of intact IgG may be present.
Host:
Rabbit
Immunogen:
Purified Whole Molecule Mouse IgG
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Cross Reactivity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on mouse IgG · light chains on all mouse immunoglobulins
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store at 2-8°C for use within 1-3 weeks or -20°C for long term storage, avoid repeat freeze thaws.
Specificity:
Mouse IL6
Cross Reactivity:
Not Tested Against Other Species
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
1mg/ml
Conjugate:
DyLight® 488 (Ex = 493 nm; Em = 518 nm)
Form:
Liquid
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
DyLight® 550
Form:
Liquid
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
1mg/ml
Conjugate:
DyLight® 650 (Ex = 652 nm; Em = 672 nm)
Form:
Liquid
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 2 mM Sodium Azide
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Human influenza hemagglutinin (HA) tagged proteins
Concentration:
R-Phycoerythrin (R-PE)
Form:
Lyophilized
Purification:
Affinity Purified Using solid phase HA
Buffer:
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 2 mM Sodium Azide
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
25 mM Tris, 150 mM NaCl, 5 mM MgCl2, 0.12 mM ZnCl2, 2 mM Sodium Azide (pH7.4)
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 2 mM Sodium Azide
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
25 mM Tris, 150 mM NaCl, 5 mM MgCl2, 0.12 mM ZnCl2, 2 mM Sodium Azide (pH7.4)
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
2-8 °C, DO NOT FREEZE
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM NaPO4 (pH 7.4), 100 mM NaCl, 2 mM Sodium Azide
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
25 mM Tris, 150 mM NaCl, 5 mM MgCl2, 0.12 mM ZnCl2, 2 mM Sodium Azide (pH7.4)
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
100 mM Sodium Phosphate (pH 7.4), 100 mM NaCl, 50 mM Sucrose, 1.5% BSA and 0.01% Thimerosal
Storage:
-20C or colder
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Product is stable for up to 4 weeks at 2-8°C after rehydration. For extended storage after rehydration, add an equal volume of glycerol and store at -20°C.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Trademark:
DyLight® is a trademark of Thermo Fisher Scientific, Inc. and its subsidiaries.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
30 mM Triethanolamine, pH 7.2, 5 mM Magnesium Chloride, 0.1 mM Zinc Chloride, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
Store undiluted liquid at 2-8 °C. For storage at -20 °C, dilute with an equal volume of glycerol to prevent loss of enzymatic activity. Prepare working dilutions prior to use and then discard.
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Rat IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rat IgG · light chains on all rat immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rat serum proteins · human serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on sheep IgG · light chains on all sheep immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin sheep serum proteins
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Rabbit
Immunogen:
Purified Sheep IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.25 M Sodium Chloride, pH 7.6
Reconstitution:
Rehydrate with 1.5 ml of deionized water and centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on Sheep IgG · light chains on all Sheep immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin Sheep serum proteins
Country Of Origin:
Rabbit serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rat Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rat Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rat Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Rat Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Fibroblast growth factors (FGFs), a heparin binding growth factor, exhibit widespread mitogenic and neurotrophic activities in a variety of different cells including mesenchymal, neuroectodermal and endothelial cells. aFGF (FGF-1) and bFGF (FGF-2) are present in relatively high levels in CNS. aFGF is expressed by a subset of neuronal populations, while bFGF is expressed by astrocytes, both lack signal peptides. Human bFGF is a 17.2 kDa protein containing 155 amino acid residues. FUNCTION: The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors. SUBUNIT: Monomer. Interacts with CSPG4 and FGFBP1. Found in a complex with FGFBP1, FGF1 and FGF2. MISCELLANEOUS: This protein binds heparin more strongly than does aFGF. SIMILARITY: Belongs to the heparin-binding growth factors family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human basic FGF
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC (frozen), WB. Recommended to be used at a dilution of 1: 1000 to 1:2000 for both applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Lee HJ et al (2010) Effects of sevoflurane on collagen production and growth factor expression in rats with an excision wound. Acta Anaesthesiol Scand. 2010 Aug;54(7):885-93.
Specificity:
A high level of specificity for bFGF was shown by immunohistochemistry for this antiserum. This antibody is known to react with human, mouse and rat basic FGF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Neurturin (NTN) is a member of the GDNF family of neurotrophic factors. This protein is a potent survival factor for several populations of central and peripheral neurons in mature and developing rodents. FUNCTION: Supports the survival of sympathetic neurons in culture. May regulate the development and maintenance of the CNS. Might control the size of non-neuronal cell population such as haemopoietic cells. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. DISEASE: Defects in NRTN are a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, and possibly with other loci, defects in NRTN are involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human Neurturin (rh NTN)
Applications:
ELISA,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, immunoblot, 1-site ELISA. Recommended to be used at a dilution of 1:2000-3000 for immunohistochemistry and Western blot, 1: 2000 to 1:4000 for ELISA. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neurturin; NRTN;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Dot blot shows no cross reactivity to GDNF. This antibody is known to react with human, mouse and rat. Not yet tested against other species.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
BDNF belongs to the neurotrophin family and promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. Post translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
Recombinant human BDNF
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, Inhibition of biological activity in vitro/in vivo, ELISA. Recommended to be used at an amount of 1-10 µg/mL for immunohistochemistry on Zamboni's fixed, frozen tissue. Not recommended for paraffin embedded tissues. Primary use is for biological activity in vitro and in vivo. Use neat for in vivo studies at 2-10 µg/mL (ED50). This antibody does not react to BDNF in western blot, thus western blot is not a recommended application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Beros J. et al. (2021) Age Related Response of Neonatal Rat Retinal Ganglion Cells to Reduced TrkB Signaling in vitro and in vivo. Front Cell Dev Biol. 9:671087. Beros J. (2020) Pretreatment of ovaries with collagenase before vitrification keeps the ovarian reserve by maintaining cell-cell adhesion integrity in ovarian follicles. PhD Thesis. Hayashida K., Eisenach JC. (2010) Spinal alpha2-adrenoceptor-mediated analgesia in neuropathic pain reflects brain-derived nerve growth factor and changes in spinal cholinergic neuronal function. Anesthesiology. 2010 Aug;113(2):406-12. Geremia NM. et al. (2010) Endogenous BDNF regulates induction of intrinsic neuronal growth programs in injured sensory neurons. Exp Neurol. 2010 May;223(1):128-42.
Specificity:
A cross reactivity of less than 1% against mouse NGF, recombinant human NT3 or NT4/5 has been shown by one site ELISA. Known to react with BDNF from rat and human.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
BDNF belongs to the neurotrophin family and promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. POst translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human BDNF
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, Inhibition of biological activity in vitro/in vivo. Recommended to be used at a dilution of 1:200-2000 for immunohistochemistry on Zamboni's fixed frozen tissue; not recommended for formalin fixed paraffin embedded tissues. 1:10 to 1:50 for inhibition of biological activity in vitro. Use neat for in vivo studies at 5-10 µL/g body weight. Whole serum format will caused immune responses, purified format is preferred for most in vivo work. Not recommended for western blots. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% against mouse NGF, recombinant human NT3 or NT4/5 has been shown by one site ELISA. This antiserum recognises BDNF from rat, mouse and human.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
GDNF is a glycosylated, disulfide-bonded homodimer molecule. It was first discovered as a potent survival factor for midbrain dopaminergic neurons and was then shown to rescue these neurons in animal models of Parkinson's disease. GDNF is about 100 times more efficient survival factor for spinal motor neurons than the neurotrophins. FUNCTION: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. DISEASE: Defects in GDNF may be a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, defects in GDNF may be involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. DISEASE: Defects in GDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human GDNF
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, WB. A dilution of 1 µg/mL is recommended for both applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
No cross reactivity with NTN has been observed in western blot analysis. This antibody is known to react with human, mouse and rat GDNF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
GDNF is a glycosylated, disulfide-bonded homodimer molecule. It was first discovered as a potent survival factor for midbrain dopaminergic neurons and was then shown to rescue these neurons in animal models of Parkinson's disease. GDNF is about 100 times more efficient survival factor for spinal motor neurons than the neurotrophins. FUNCTION: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. DISEASE: Defects in GDNF may be a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, defects in GDNF may be involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. DISEASE: Defects in GDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human GDNF
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. Recommended to be used at a dilution of 1:1000 to 1:3000 for Western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
No cross reactivity with NTN has been observed in western blot analysis. This antibody is known to react with human, mouse and rat GDNF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Myelin basic protein (MBP) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Myelin is a membrane characteristic of the nervous tissue and functions as an insulator to increase the velocity of the stimuli being transmitted between a nerve cell body and its target. Myelin isolated from human and bovine nervous tissue is composed of approximately 80% lipid and 20% protein, and 30% of the protein fraction constitutes myelin basic protein (MBP). MBP is an 'intrinsically unstructured' protein with a high proportion (approximately 75%) of random coil, but postulated to have core elements of beta-sheet and alpha-helix. MBP is a major protein in CNS myelin and is expressed specifically in the nervous system. A detailed immunochemical examination of monoclonal and polyclonal antibody responses to MBP and its peptides has revealed the existence of as many as 27 antigenic determinants, many of them conformational. Topological mapping of the potential antigenic determinants onto a model of MBP secondary structure places these determinants within 11 separate regions of the molecule, including those portions that have been found to be encephalitogenic. The message for myelin basic protein is selectively translocated to the ends of the cell processes. Immunization with myelin-associated antigens including MBP significantly promotes recovery after spinal cord contusion injury in the rat model. FUNCTION: Is, with PLP, the most abundant protein component of the myelin membrane in the CNS. Has a role in both the formation and stabilization of this compact multilayer arrangement of bilayers. Each splice variant and charge isomer may have a specialized function in the assembly of an optimized, biochemically functional myelin membrane (By similarity). SUBUNIT: Homodimer (By similarity). SUBCELLULAR LOCATION: Myelin membrane; peripheral membrane protein; cytoplasmic side. Cytoplasmic side of myelin. TISSUE SPECIFICITY: Found in both the central and the peripheral nervous system. PTM: At least 5 charge isomers; C1 (the most cationic, least modified, and most abundant form), C2, C3, C4 and C5 (the least cationic form); are produced as a result of optional posttranslational modifications such as phosphorylation of serine or threonine residues, deamidation of glutamine or asparagine residues, citrullination and methylation of arginine residues. C1 and C2 are unphosphorylated, C3 and C4 are monophosphorylated and C5 is phosphorylated at two positions. SIMILARITY: Belongs to the myelin basic protein family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Guinea Pig,Human,Rat
Immunogen:
A synthetic peptide (YG SLPQKSQRSQ DENPVV, aa: 68-86) as part of guinea pig MBP protein conjugated to KLH
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:1000 to 1:4000 is recommended. Immunostaining for MBP of abnormal appearing oligodendrocytic process and cell bodies in demyelinating areas. This antibody recognises only areas of myelin degeneration when tested in injured spinal cord and lesioned sciatic nerves. It also stains discrete white matter in the brain of multiple system atrophy. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Myelin Basic Protein
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum recognizes MBP in demyelinated nerve tissues. Immunohistochemical analysis of lesioned rat spinal cord indictaes a high level of specificity for this antiserum. This antiserum reacts with human and rat MBP.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Alpha-synuclein Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Alpha synuclein is an abundant 140 amino acid neuronal protein, expressed primarily at presynaptic terminals in the central nervous system. Alpha synuclein has been associated with several neurodegenerative diseases. A point mutation in the gene coding for the alpha-synuclein protein was the first discovery linking this protein to a rare familial form of Parkinson's disease (PD). Subsequently, other mutations in the alpha-synuclein gene have been identified in familial PD. The aggregated proteinaceous inclusions called Lewy bodies found in PD and cortical Lewy body dementia (LBD) were discovered to be predominantly alpha-synuclein. Aberrant aggregation of alpha-synuclein has been detected in an increasing number of neurodegenerative diseases, collectively known as synucleopathies. Alpha-synuclein exists physiologically in both soluble and membrane-bound states, in unstructured and alpha-helical conformations, respectively. The physiological function of alpha-synuclein appears to require its translocation between these subcellular compartments and interconversion between the 2 conformations. Abnormal processing of alpha-synuclein is predicted to lead to pathological changes in its binding properties and function.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (CMPVDPDNEAYEMPSEE) as part of human alpha synuclein (aa: 116-131) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC with 1:1000 to 1:2000 dilution. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Wu W et al. (2022) "Intermediate-length CGG repeat expansion in NOTCH2NLC is associated with pathologically confirmed Alzheimers disease" Neurobiol. Aging 80(1):447-458; Application: IHC Species: Human Cong C et al. (2021) "Contribution of Alzheimer's Disease Neuropathologic Change to the Cognitive Dysfunction in Human Brains with Lewy Body-Related Pathology." J Alzheimers Dis. 80(1):447-458; Application: IHC Species: Human Zhang W et al. (2020) "Contribution of Alzheimer's Disease Neuropathologic Change to the Cognitive Dysfunction in Human Brains with Lewy Body-Related Pathology." Neurobiol. Aging [In press]; Application: IHC Species: Human
Specificity:
Immunohistochemistry shows a high specificity for alpha-synuclein. This antibody is known to react with human, rat and mouse alpha-synuclein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
CNTF is a survival promoting factor for different types of neurons in vitro and in vivo. The essential structural features for the biological function of human CNTF were investigated by Thier, M. et al. They showed that deletion of 14 N-terminal and 18 C-terminal amino acids significantly increased bioactivity compared to wild-type CNTF. FUNCTION: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. TISSUE SPECIFICITY: Nervous system. PHARMACEUTICAL: CNTF is being tested under the name Axokine by Regeneron Pharmaceuticals for treatment of human motor neuron diseases, such as amyotrophic lateral sclerosis (ALS). As it induces substantial weight loss, preferentially of fat as opposed to lean body mass, it is being used for obesity treatment. SIMILARITY: Belongs to the CNTF family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human CNTF
Applications:
ELISA,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. A dilution of 1:500 to 4000 is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Ciliary neurotrophic factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody specifically detects CNTF shown by western blot. This antiserum to known to react with rat, mouse and human CNTF protein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. SUBUNIT: Heterodimer. Interacts with DSIPI; this interaction inhibits the binding of active AP1 to its target DNA. Interacts with MAFB. SUBCELLULAR LOCATION: Nucleus. INDUCTION: C-fos expression increases upon a variety of stimuli, including growth factors, cytokines, neurotransmitters, polypeptide hormones, stress and cell injury. SIMILARITY: Belongs to the bZIP family. Fos subfamily. SIMILARITY: Contains 1 bZIP domain
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Hamster,Human,Rabbit,Rat
Immunogen:
A synthetic peptide (MFSGFNADYEASSSRC; aa 2-17) conjugated to diphtheria toxoid has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from cFos protein human, rat, mouse, hamster and cat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC: Use at an amount of 10 µg/mL with an incubation time of 1-3 days at 4ºC. This antiserum works in paraffin and 4% PFA fixed frozen sections. Penetration is the key to success. Over-fixed tissue is problematic. Not recommended for western blotting applications. Mouse monoclonal antibody M-1752-100 or rabbit polyclonal antibody R-1751-50 are excellent alternatives for western blotting. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
c-Fos; Proto-oncogene protein cFOS; cellular oncogene fos; G0/G1 switch regulatory protein 7; FOS; G0S7
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum shows a high level of specificity for c-FOS confirmed by immunohistochemistry. This antiserum is known to react with rat and rabbit and hamster cFOS.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Ancient ubiquitous protein 1 (AUP1) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
AUP1 contains a domain with homology to the ancient conserved region of the archain 1 gene and a domain thay may be involved in binding ubiquitin-conjugating enzymes. The unprocessed precusor is of 476 amino acids in length and has an estimated molecular weight of 53 kDa. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing.TISSUE SPECIFICITY: Ubiquitous. SIMILARITY: Belongs to the AUP1 family. SIMILARITY: Contains 1 CUE domain.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Bovine,Human,Rat,Sheep
Immunogen:
A synthetic peptide (HVFLVSCALPDSV) corresponding to the amino acids 48-60 of human ancient ubiquitous protein 1 conjugated to Blue carrier protein has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from bovine, mouse and rat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. Use at a dilution of 1:500 to 1:6000. This antiserum works superbly in both paraffin embedded and frozen tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
AUP1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum is specific for ancient ubiquitous protein 1. This antibody is known to react with bovine, sheep, human and rat ancient ubiquitous protein 1. Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Beta-synuclein Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Beta-synuclein is a non-amyloid component of senile plaques found in Alzheimer disease. It could act as a regulator of SNCA aggregation. It protects nerurons from staurosporine and 6 hydroxy dopamine -stimulated capspase activation in a p53-dependent manner. It localises to the cytoplasm and it is predominantly expressed in the brain where it is most concentrated in presynaptic nerve terminals. This protein is phosphorylated. This protein is also associated with the disease Brain iron accumulation type 1 (NBIA1).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (IEPLMEPEGSYEDPPQE) as part of human beta synuclein protein (aa: 108-125) conjugated to diphteria toxid has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:3000 to 1:8000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
SNCB
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Known to be specific for beta synuclein. This antiserum is know to react with human, rat and other rodent beta synuclein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Pan-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Detects human alpha-, beta-, and gamma synuclein proteins. A family of homologous proteins known as alpha-, beta-, and gamma-synuclein are abundantly expressed in brain, especially in the presynaptic terminal of neurons. Although the precise function of these proteins remains unknown, alpha-synuclein has been implicated in synaptic plasticity associated with avian song learning as well as in the pathogenesis of Parkinson's disease (PD), dementia with LBs (DLB), some forms of Alzheimer's disease (AD), and multiple system atrophy (MSA).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (AKEGVVAAAEKTKQGV) as a consensus part of human alpha-, beta-, and gamma synuclein proteins conjugated to diphteria toxoid has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, WB. A concentration of 3 µg/mL is recommended for immunohistochemistry (frozen & paraffin embedded sections) and 1 µg/mL for western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Overlap specific immunohistochemical staining of alpha-, beta- and gamma synucleins This antiserum recognises human and rat alpha-, beta- and gamma synucleins.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified and dialysed against PBS. Contains 0.02% sodium azide.
FUNCTION: Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. SUBUNIT: Heterodimer. Interacts with DSIPI; this interaction inhibits the binding of active AP1 to its target DNA. Interacts with MAFB. SUBCELLULAR LOCATION: Nucleus. INDUCTION: C-fos expression increases upon a variety of stimuli, including growth factors, cytokines, neurotransmitters, polypeptide hormones, stress and cell injury. SIMILARITY: Belongs to the bZIP family. Fos subfamily. SIMILARITY: Contains 1 bZIP domain
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Hamster,Human,Rabbit,Rat
Immunogen:
A synthetic peptide (MFSGFNADYEASSSRC; aa 2-17) conjugated to diphtheria toxoid has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from cFos protein human, rat, mouse, hamster and cat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IH on PFA fixed, frozen tissues. Not yet tested on formalin fixed, paraffin embedded tissue but expected to react. Affinity purified antibody is extremely powerful. A concentration of 1 -5 µg/mL is recommended most uses with short (1-8 hour) incubations. If using enhanced brightfield or amplified detection methods dilutions and long primary antibody incubations dilutions will need to be increased substantially to inhibit background staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.<br><br>Not recommended for western blotting applications. Mouse monoclonal antibody M-1752-100 or rabbit polyclonal antibody R-1751-50 are excellent alternatives for western blotting.
Alternative Names:
Proto-oncogene protein cFOS; c-FOS
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum shows a high level of specificity for cFOS confirmed by immunohostochemistry. This antiserum is known to react with rat, rabbit and hamster cFOS.
Storage:
Store lyophilized product at 2-8°C. After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. It stimulates division and differentiation of sympathetic and embryonic sensory neurons. SUBUNIT: Homodimer, associated by noncovalent forces. SUBCELLULAR LOCATION: Secreted protein. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Avian,Human,Mouse,Rat
Immunogen:
Native mouse beta NGF purified from submaxillary salivary gland (95% purity by PAGE)
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, 1-site ELISA, WB, immunoblot, inhibition of biological activity. A dilution of 1:1000-1:5000 is recommended for IHC, western blot and immunoblot; 1:15000 for ELISA; for inhibition of biological activity: 1:10-50 for in vitro, 5-10 µL/g body weight for in vivo. This antiserum completely inhibits neuronal survival and the outgrowth actions of murine NGF in chicken DRG in vitro. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Beta-nerve growth factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
A cross reactivity of less than 1% to recombinant human BDNF, NT3, NT4/5 by ELISA has been shown. This antiserum is known to cross react with mouse, rat, human and avian NGF but not bovine NGF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. It stimulates division and differentiation of sympathetic and embryonic sensory neurons. SUBUNIT: Homodimer, associated by noncovalent forces. SUBCELLULAR LOCATION: Secreted protein. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Avian,Human,Mouse,Rat
Immunogen:
Native mouse beta NGF purified from submaxillary salivary gland (95% purity by PAGE)
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, 1-site ELISA, WB, immunoblot, inhibition of biological activity. A concentration of 1-3 µg/mL is recommended for IHC, western blot and immunoblot, ELISA, inhibition of biological activity in vitro. Use neat for in vivo studies at 2-10 µg/mL (ED50). This antiserum completely inhibits neuronal survival and the outgrowth actions of murine NGF in chicken DRG in vitro. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Beta-nerve growth factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
A cross reactivity of less than 1% to recombinant human BDNF, NT3, NT4/5 by ELISA has been shown. This antiserum is known to cross react with mouse, rat, human and avian NGF but not bovine NGF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. It stimulates division and differentiation of sympathetic and embryonic sensory neurons. SUBUNIT: Homodimer, associated by noncovalent forces. SUBCELLULAR LOCATION: Secreted protein. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Avian,Human,Mouse,Rat
Immunogen:
Native mouse beta NGF purified from submaxillary salivary gland (95% purity by PAGE)
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, 1-site ELISA, WB, immunoblot, inhibition of biological activity. A concentration of 1-3 µg/mL is recommended for IHC, western blot and immunoblot, ELISA, inhibition of biological activity in vitro. Use neat for in vivo studies at 2-10 µg/mL (ED50). This antiserum completely inhibits neuronal survival and the outgrowth actions of murine NGF in chicken DRG in vitro. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Beta-nerve growth factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Feron F et al (2008) Neurotrophin expression in the adult olfactory epithelium. Brain Res. 1196:13-21 Application: IHC ; Species: Rat
Specificity:
A cross reactivity of less than 1% to recombinant human BDNF, NT3, NT4/5 by ELISA has been shown. This antiserum is known to cross react with mouse, rat, human and avian NGF but not bovine NGF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human, mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A dilution of 1:500 to 1:2000 is recommended for IHC, western blot. For inhibition of biological activity: 1:10-50 for in vitro, 5-10 µL/g body weight for in vivo. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human, mouse and rat NT3 protein conjugated to BSA
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
Recombinant human NT3
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA, WB, dot blot, inhibition of biological activity. A dilution of 1:200 to 1:2000 is recommended for IHC, ELISA and western blot. For inhibition of biological activity: 1:10-50 for in vitro, 5-10 µL/g body weight for in vivo. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% to mouse NGF, recombinant human BDNF and 5% to NT4/5 has been shown by 1-site ELISA. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
Recombinant human NT3
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. This antiserum will neutralise NT3 but not other neurotrophins. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% to mouse NGF, recombinant human BDNF and 5% to NT4/5 has been shown by 1-site ELISA. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Primate,Rat
Immunogen:
Recombinant human NT4
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA (1 site), Western Blot, dot blot, inhibition of biological activity in vitro/in vivo. Recommended to be used at a dilution of 1:500 to 1:2000 for immunohistochemistry, ELISA and Western blot. 1:10 to 1:50 for inhibition of biological activity in vitro. Use neat for in vivo studies at 5-10 µL/g body weight. Note that the concentration of NT4 is generally low in most tissues nevertheless, neonatal testes of rat can be used as a good positive control. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Less than 1% cross-reactivity against NGF, recombinant human BDNF and 5% to NT3 has been shown by 1-site ELISA. Known to react with NT4 from rat and human, mouse and monkey.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Primate,Rat
Immunogen:
Recombinant human NT4
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA (1 site), Western Blot, inhibition of biological activity in vitro/in vivo. Recommended to be used at a concentration of 2-10 µg/mL for immunohistochemistry, ELISA and Western blot and inhibition of biological activity in vitro. Use neat for in vivo studies at 2-10 µg/mL (ED50). Note that the concentration of NT4 is generally low in most tissues nevertheless, neonatal testes of rat can be used as a good positive control. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Beros J et al. (2021) Age Related Response of Neonatal Rat Retinal Ganglion Cells to Reduced TrkB Signaling in vitro and in vivo. Front Cell Dev Biol. 9:671087. Application: Rat, Block/Inhibit. Beros J (2020) Pretreatment of ovaries with collagenase before vitrification keeps the ovarian reserve by maintaining cell-cell adhesion integrity in ovarian follicles. PhD Thesis Application: Rat, Block/Inhibit. Feron F et al. (2008) Neurotrophin expression in the adult olfactory epithelium. Brain Res. 1196:13-21 Application: Rat, IHC.
Specificity:
Less than 1% cross-reactivity against NGF, recombinant human BDNF and 5% to NT3 has been shown by dot blot. Known to react with NT4 from rat and human, mouse and monkey.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Seems to promotes the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human, mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Connexin-45 (Cx45) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Connexin-45 is a component of gap junctions, which are composed of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low molecular weight diffuse from one cell to a neighboring cell. SUBUNIT: A connexon is composed of a hexamer of connexins. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein. SIMILARITY: Belongs to the connexin family. Alpha-type (group II) subfamily. Alternatively spliced isoforms have been described.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human
Immunogen:
A synthetic peptide (QAYSHQN NPHGPRE) as part of human Connexin-45 protein (aa: 354-367) conjugated to diphtheria toxoid has been used as the immunogen.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
<b>Immunohistochemistry:</b> Antibody detects sparse Cxn45-IR in caudal artery and heart tissue (see Rummery, NM et al 2002 for more staining specifics). Antibody was used at 1:100 to 1:250, but Biosensis recommends optimal dilutions/concentrations should be determined by the end user. In the original work the specificity of the antibody was shown by incubation either without primary antibody or with primary antibody that had previously been pre-incubated for 1 hour at room temperature with 10-fold excess by weight of the peptide against which the antibody was raised.<br><br><b>Western Blot:</b> Antibody is not recommended for western blotting by Biosensis, however, it does react in westerns with Cxn 45 specific material. The authors report that the antibody develops numerous bands in westerns blots, only some of which are removed upon peptide treatment (see Rummery, NM et al 2002). The Cx45/354 antibody revealed the presence of a specific 45-kDa band in all tissues tested, although it was very weak in the arteries. A higher molecular weight band, which was blocked by peptide, was also seen in the brain (see Rummery, NM et al 2002, online Figure VIIB, -/+ peptide).
Alternative Names:
Gap junction gamma-1 protein; Gap junction alpha-7 protein; Cx45; GJC1; GJA7
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Original Reference Rummery NM, Hickey H, McGurk G, Hill CE. (2002) "Connexin37 is the major connexin expressed in the media of caudal artery. Arterioscler Thromb Vasc Biol. 22(9):1427-32. PMID: 12231561 This antibody is referred to as Cx45/354 in Rummery, NM et al 2002.
Specificity:
Western blotting of cell membranes of COS cells transiently transfected with cDNA encoding Connexin-45 shows a singular band of molecular weight 47 kDa which is abolished by preincubation with the immunising peptide. No such band is detected in western blots of membranes from non-transfected cells or cells transfected with cDNA encoding Connexin-37 or Connexin-40. This antiserum reacts to human Connexin-45.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Connexin-40 (Cx40) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
FUNCTION: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low molecular weight diffuse from one cell to a neighboring cell. SUBUNIT: A connexon is composed of a hexamer of connexins. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein. TISSUE SPECIFICITY: Highly expressed in lung. SIMILARITY: Belongs to the connexin family. Alpha-type (group II) subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Rat
Immunogen:
A synthetic peptide consisting of amino acids 254 to 270 of the C-terminus of rat Cx40 (Cx40/254) conjugated to diphtheria toxoid has been used as the immunogen.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
<br><b>Immunohistochemistry</b>: Antibody detects Cxn 40 in rat tissues and arterial endothelial cells. The authors report that the density of Cx40 plaques was significantly greater in the caudal artery (CA) than in the thoracic aorta (ThA), whereas no such difference was seen for Cx37 and Cx43. Expression of Cx40 was absent from the media of both thoracic and caudal artery tissues (see Rummery, NM et al 2002 for more staining specifics). <br><b>Published Method</b>: Unfixed 10 µm thick sections cryosections or lightly fixed (2% paraformaldehyde in 0.1 mol/L sodium phosphate buffer) whole mount sections have been tested, see Rummery, NM et al 2002). Pretreatments include pre-incubation for 30 minutes in a blocking solution of 2% bovine serum albumin (BSA), 0.2% Triton-X in PBS, followed by primary antibody incubation. Antibody was used at 1:100 to 1:250 for 1 hour in the original work but Biosensis recommends optimizing the conditions for the best results. Original detection was via Cy3- conjugated anti-goat immunoglobulins (Jackson Immunoresearch Laboratories Inc, PA, 1:100) in 0.01% Triton-X in PBS, but other secondary conditions should work as well once optimized. In the original work the specificity of each antibody was tested by incubation either without primary antibody or with primary antibody that had previously been pre-incubated for 1 hour at room temperature with 10-fold excess by weight of the peptide against which the antibody was raised. (Adapted from Rummery, NM et al 2002).<br><b>Western Blot</b>: <U>Antibody is not recommended for western blots by Biosensis</u>, however, it does react in westerns with Cxn 40 specific material. The authors report that the antibody develops numerous bands in westerns blots, only some of which are removed upon peptide treatment (see Rummery, NM et al 2002). The Cx40/254 antibody specifically recognized a band of 40 kDa from lung, caudal artery (CA), and thoracic aorta (ThA) but not liver (online Figure VIIA, +/- peptide). In the lung, however, a band at 45 kDa also appeared to be reduced with Cxn 40 peptide addition.<br><b>Published Method</b>: Brain, heart, liver, lung, thoracic aorta and caudal arteries were removed from 5-6 week old Wistar rats and snap frozen in liquid nitrogen Tissues were ground under liquid nitrogen in a mortar and pestle and resuspended in 1mL of lysis buffer (1 mM NaHCO3 pH 7.05, 10 mM EDTA, 10 mM Iodoacetamide, 10 mM tetra-sodium pyrophosphate, 1 mM PMSF and 1 µg/mL each of antipain, aprotinin, pepstatin-A, chymostatin and leupeptin). Tissues were further disrupted by grinding in a polytron blender. Unbroken cells and large debris were removed by centrifugation at 1000 g for 5 minutes at 4oC, the supernatant was then removed and centrifuged at 3000 g for 5 minutes. The pellet was discarded, and the supernatant centrifuged at 20000 g for 15 minutes at 4°C. The supernatant was discarded, and the membrane-enriched pellet was resuspended in lysis buffer. Protein concentration was measured using the Bio-Rad protein assay kit. Membrane-bound connexins were subsequently solubilized by incubation in 2x SDS sample buffer (5% SDS, 125 mM Tris-Cl (pH 6.8), 20% glycerol, 2 mM _- mercaptoethanol, 0.1% (w/v) bromophenol blue) for 60 minutes at 37°C. Aliquots containing 5 µg of protein were separated by SDS-PAGE on 12% polyacrylamide gels and blotted onto PVDF membranes. Blots were probed with sheep antibodies against Cx40 (1:1000, Cx40/254) and detected via ECL using anti-Goat poly HRP secondary antibodies 1:4000, 1 hr. (<I>adapted from Rummery, NM et al 2002</I>).Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Gap junction alpha-5 protein; Cx40; Gja5; Cxn-40
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Original Reference Rummery NM, Hickey H, McGurk G, Hill CE. (2002) "Connexin37 is the major connexin expressed in the media of caudal artery. Arterioscler Thromb Vasc Biol. 22(9):1427-32. PMID: 12231561 This antibody is referred to as Cx40/254 in Rummery, NM et al 2002.
Specificity:
It is reported that the Cx40/254 antibody did not cross react with rat Cx43 but may with Cx45 in Western blots only (Rummery, NM et al 2002).
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
SUMO-1 binds to a wide range of target proteins as part of a post-translational modification system. Unlike ubiquitin, it does not seem to target protein for degradation, but is involved in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis, apoptosis, protein stability and signal transduction. SUBUNIT: Covalently attached to a number of proteins such as PmL, RANGAP1, HIPK2, SP100, p53, p73alpha, MDM2, JUN and DNMT3B. Also interacts with HIF1A, HIPK2, HIPK3, CHD3, PIAS1, EXOSC9, TDG, RAD51 and RAD52. SUBCELLULAR LOCATION: Nucleus; nuclear membrane. Nucleus; nucleoplasm; nuclear speckle. Cytoplasm. SIMILARITY: Belongs to the ubiquitin family. SMT3 subfamily. SIMILARITY: Contains 1 ubiquitin-like domain. PTM: Cleavage of the last four amino acids of the carboxy-terminus of the precursor form by SENP1 or SENP2 is necessary for function. Several pseudogenes have been reported as well as a number of alternatively spliced isoforms.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (AKPSTEDLGDKKEGEY) as part of human SUMO-1 peptide (aa: 6-21) conjugated to diphtheria toxoid has been used as the immunogen. This antigen is homologous with SUMO-1 of rat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1:2000 to 1:4000 is recommended for immunohistochemistry and 1:4000 to 1:8000 for western blot. Cell lysate from Hela and NIH-3T3 cell lysates may be used as a positive control, and for IHC, lung carcinoma may be used. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Small ubiquitin-related modifier 1; Ubiquitin-like protein SMT3C; SMT3 homolog 3; Ubiquitin-homology domain protein PIC1; Ubiquitin-like protein UBL1; GAP-modifying protein 1; GMP1; Sentrin; SUMO1; SMT3C; SMT3H3; UBL1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum recognises human SUMO-1 and not ubiquitin. This antiserum is known to cross react with rat and human SUMO-1.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Gamma-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Gamma synuclein belongs to the synuclein family which are believed to be involve in the pathogenesis of neurodegenerative diseases. High levels of gamma synuclein have been identified in andvanced breast carcinomas suggesting a correlation between gamma synuclein overexpression and breast tumor development. Gama synuclein plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway. SUBUNIT: May be a centrosome-associated protein. SUBCELLULAR LOCATION: Cytoplasm; perinuclear region. Centrosome. Spindle. Associated with centrosomes in several interphase cells. In mitotic cells, localized to the poles of the spindle. TISSUE SPECIFICITY: Highly expressed in brain, particularly in the substantia nigra. Also expressed in the corpus callosum, heart, skeletal muscle, ovary, testis, colon and spleen. Weak expression in pancreas, kidney and lung. PTM: Phosphorylated. Phosphorylation by GRK5 appears to occur on residues distinct from the residue phosphorylated by other kinases. DISEASE: Brain iron accumulation type 1 (NBIA1, also called Hallervorden-Spatz syndrome), a rare neuroaxonal dystrophy, is histologically characterized by axonal spheroids, iron deposition, Lewy body (LB)-like intraneuronal inclusions, glial inclusions and neurofibrillary tangles. SNCG is found in spheroids but not in inclusions.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (EKEEVAEEAQSGGD) as part of human gamma synuclein protein (114-127) conjugated to diphteria toxid has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, WB. A concentration of 2-5 µg/mL is recommended for both applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Persyn; Breast cancer-specific gene 1 protein; Synoretin; SR; SNCG
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Immunohistochemical/western blot anlysis indicate a high level of specificity for this antiserum for gamma synuclein. This antiserum is known to react with human and rat gamma synuclein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified and dialysed against PBS. Contains 0.02% sodium azide.
LRRK2 is a member of the leucine-rich repeat kinase family. It role is yet unknown but it may play a role in the phoshorylation of proteins central to parkinson diseases. LRRK2 contains an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a mLK-like domain and a WD40 domain. LRRK2 is present in the cytoplasm but also associates with the mitochondrial outer membrane. Defects in LRRK2 are the cause of Parkinson disease 8 (PARK8). Parkinson disease is characterised by bradykinesia, resting tremor, muscular rigidity and postural instability, as well as by a clinically significant response to treatment with levodopa. The pathology involves the loss of dopaminergic neurons in the substantia nigra and the presence of Lewy bodies (intraneuronal accumulations of aggregated proteins), in surviving neurons in various areas of the brain. PARK8 is an autosomal-dominant late-onset parkinsonism, characterized by onset from 50 to 65 years, with slow progression and relatively benign course.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human
Immunogen:
A synthetic peptide (LKRKRKILSSDDSLRSS; aa 946-962) as part of human LRRK2 protein conjugated to the Blue Carrier Protein has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution range of 1:500-1:10000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Sheep anti-C-reactive protein Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
C-reactive protein has several roles associated with host defence such as; promoting agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. COFACTOR: Binds 2 calcium ions per subunit. C-reactive protein exists as a homopentamer. Pentaxin (or Pentraxin) have a discoid arrangement of 5 non-covalently bound subunits. There are 2 alternatively spliced isoforms. C-reactive protein is found in plasma and its concentration increases greatly during acute phase response to tissue injury, infection or other inflammatory stimuli. It is induced by IL-1 and IL-6.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with 0.01% Thimerosal
Host Animal:
Sheep
Species Reactivity:
Human
Immunogen:
Human recombinant C-Reactive protein
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. Extremely high titre antibody. For western blot a dilution of 1: 10,000 to 1: 100000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
CRP; PTX1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
It has been shown to be specific for C-reactive protein by WB. Human, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent.
Glutathione peroxidase 1 has a role in detoxification of hydrogen peroxide and is one of the most important antioxidant enzymes in humans. It exists as a homotetramer which localises to the cytoplasm. It belongs to the glutathione peroxidase family. Glutathione peroxidase 1 is one of few proteins in higher vertebrates to contain selenocysteine, which occurs at the active site of glutathione peroxidase and is coded by UGA, that normally functions as a translation termination codon. This protein has a polyalanine sequence polymorphism in the N-terminal region, which includes three alleles with five, six or seven alanine repeats. The allele with five alanine repeats is significantly associated with breast cancer risk. Two alternatively spliced isoforms have been identified.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (RRYSRRFQTIDIEPDIEALL) corresponding to the amino acids 175-194 of human lutathione peroxidase 1 ( GPx-1) conjugated to diphtheria toxin has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. This antibody works superbly in Immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 2000 to 1: 20000 depending on tissue and detection method. For western blotting a dilution range of 1: 10000 to 1: 100000 is recommended. For ELISA, a dilution of 1: 2000 to 1: 20000 is recommended. This antiserum has extremely high titre, it stains human and rat brain microglia intensely and to some extent also stains neurons. Other tissues have not yet been tested. On Western blotting under reducing conditions recognises a 22kD protein in human brain tissue and Sigma glutathione peroxidase (G-4013) isolated from human erythrocytes. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
This antibody has been shown to be specific for glutathione peroxidase 1 (GPx-1) protein. Human and rat, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Involved in redox regulation of the cell. Can reduce hydrogen peroxide and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. SUBUNIT: Homotetramer. May interact with HTR2A. SUBCELLULAR LOCATION: Cytoplasm. Lysosome. Also found in lung secretory organelles. MISCELLANEOUS: The active site is the redox-active Cys-47 oxidized to Cys-SOH. Cys-SOH may rapidly react with a Cys-SH of the other subunit to form an intermolecular disulfide with a concomitant homodimer formation. The enzyme may be subsequently regenerated by reduction of the disulfide by thioredoxin . MISCELLANEOUS: Irreversibly inactivated by overoxidation of Cys-47 (to Cys-SO(3)H) upon oxidative stress. SIMILARITY: Belongs to the ahpC/TSA family. Rehydrin subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Rat recombinant Peroxiredoxin-6
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works superbly in Immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 100 to 1: 1000 depending on tissue and detection method. For western blotting a dilution range of 1: 500 to 1: 2000 is recommended. A dilution of 1: 1000 to 1: 2000 is recommended for ELISA. This antiserum stains the cytoplasm of epithelial cells in the rat and mouse lung and rat and human brain astrocytes. It stains human brain astrocytes in Parkinson's and Alzheimer 's disease and the central core of some Lewy bodies in Parkinson's disease and dementia with Lewy bodies. Other tissues have not yet been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
This antibody has been shown to be specific for Peroxiredoxin-6 protein. Rat, human and mouse, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Alpha synuclein is an abundant 140 amino acid neuronal protein, expressed primarily at presynaptic terminals in the central nervous system. Alpha synuclein has been associated with several neurodegenerative diseases. A point mutation in the gene coding for the alpha-synuclein protein was the first discovery linking this protein to a rare familial form of Parkinson's disease (PD). Subsequently, other mutations in the alpha-synuclein gene have been identified in familial PD. The aggregated proteinaceous inclusions called Lewy bodies found in PD and cortical Lewy body dementia (LBD) were discovered to be predominantly alpha-synuclein. Aberrant aggregation of alpha-synuclein has been detected in an increasing number of neurodegenerative diseases, collectively known as synucleopathies. Alpha-synuclein exists physiologically in both soluble and membrane-bound states, in unstructured and alpha-helical conformations, respectively. The physiological function of alpha-synuclein appears to require its translocation between these subcellular compartments and interconversion between the 2 conformations. Abnormal processing of alpha-synuclein is predicted to lead to pathological changes in its binding properties and function.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (CMPVDPDNEAYEMPSEE) of human alpha synuclein protein (aa: 116-131) conjugated to diphtheria toxoid has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC): 1-4 µg/mL (paraffin sections)<br>Western Blotting (WB): 0.5 - 2.0 µg/mL. Fixing of proteins on membrane with 0.4% formaldehyde (30 min at room temperature) recommended, see Lee & Kamitani, 2011.<br>Flow Cytometry: 2 µg antibody per ~10^6 cells, methanol-fixed.<br>Immunocytochemistry (ICC): 1-4 µg/mL, 4% formaldehyde-fixed cells.<br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Kuo Y.M. et al. (2010) Extensive enteric nervous system abnormalities in mice transgenic for artificial chromosomes containing Parkinson disease-associated alpha-synuclein gene mutations precede central nervous system changes. Hum Mol Genet. May 1;19(9):1633-50 Pelkonen A. et al. (2010) Stimulated dopamine overflow and alpha-synuclein expression in the nucleus accumbens core distinguish rats bred for differential ethanol preference. J Neurochem. 2010 Aug;114(4):1168-76. Alves et al. (2008) Striatal and nigral pathology in a lentiviral rat model of Machado-Joseph disease Hum Mol Genet. 2008 Jul 15;17(14):2071-83.
Specificity:
This antiserum specifically detects alpha synuclein. This antibody is known to react with alpha synuclein of human, mouse, rat and other rodents.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified and dialysed against phosphate buffered saline (PBS).
Sheep anti-Beta-synuclein Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Beta-synuclein is a non-amyloid component of senile plaques found in Alzheimer disease. It could act as a regulator of SNCA aggregation. It protects neurons from staurosporine and 6 hydroxy dopamine -stimulated capspase activation in a p53-dependent manner. It localises to the cytoplasm and it is predominantly expressed in the brain where it is most concentrated in presynaptic nerve terminals. This protein is phosphorylated. This protein is also associated with the disease Brain iron accumulation type 1 (NBIA1).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Affinity purified and dialysed against PBS. Contains 0.02% sodium azide.
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (IEPLMEPEGSYEDPPQE) of human beta synuclein protein (aa: 108-125) conjugated to diptheria toxid has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
IgG
Application Details:
IHC. A working concentration of 1 µg/mL is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
SNCB
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Known to be specific for beta synuclein. This antiserum is known to react with beta synuclein of human, rat and other rodents.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Alpha-synuclein Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
Alpha synuclein is an abundant 140 amino acid neuronal protein, expressed primarily at presynaptic terminals in the central nervous system. Alpha synuclein has been associated with several neurodegenerative diseases. A point mutation in the gene coding for the alpha-synuclein protein was the first discovery linking this protein to a rare familial form of Parkinson's disease (PD). Subsequently, other mutations in the alpha-synuclein gene have been identified in familial PD. The aggregated proteinaceous inclusions called Lewy bodies found in PD and cortical Lewy body dementia (LBD) were discovered to be predominantly alpha-synuclein. Aberrant aggregation of alpha-synuclein has been detected in an increasing number of neurodegenerative diseases, collectively known as synucleopathies. Alpha-synuclein exists physiologically in both soluble and membrane-bound states, in unstructured and alpha-helical conformations, respectively. The physiological function of alpha-synuclein appears to require its translocation between these subcellular compartments and interconversion between the 2 conformations. Abnormal processing of alpha-synuclein is predicted to lead to pathological changes in its binding properties and function.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (PQEGILEDMPVDPC) of human alpha synuclein protein (aa: 108-120) conjugated to diphtheria toxoid has been used as the immunogen.
Applications:
IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
IHC. Recommended to be used at a concentration of 1 µg/mL for immunohistochemistry (Paraffin sections). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Immunihistochemical analysis of human and rat brain indicates a high level of specificity for this antiserum. Specificity was also confirmed by western blot. This antiserum is known to react with human and rat alpha synuclein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified and dialysed against PBS. Contains 0.02% sodium azide.
Brain derived neurotrophic factor (BDNF) is synthesized as a precursor (proBDNF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proBDNF is synthesized in neurons and glia (eg., microglia), transported anterogradely and retrogradely and may be released in an activity dependent manner. This antibody is raised in sheep to detect the prodomain of BDNF and not the mature peptide.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
The recombinant prodomain fragment of human brain-derived neurotrophic factor
Applications:
ELISA,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
ELISA, Western Blot, biological neutralization of proBDNF, Immunocytochemistry/Immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Proform brain derived neurotrophic factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed to react with purified human proBDNF, crossreact with mouse and rat proBDNF Cross reactivity with other species than human, mouse and rat has not yet been tested
Storage:
After reconstitution keep aliquots at -20ºC for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Nerve growth factor (NGF) is synthesized as a precursor (proNGF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proNGF is synthesized in target tissues and glia, transported retrogradely and may be released. This antibody is raised in sheep to detect the prodomain of NGF not the mature peptide.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
The recombinant prodomain fragment of human nerve growth factor
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, Immunofluorescence, ELISA, Western Blot, biological neutralization of proNGF. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
pro-brain nerve growth factor; proNGF; NGF;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Sugimoto J et al. (2021). Fabry disease-associated globotriaosylceramide induces mechanical allodynia via activation of signaling through proNGF p75NTR but not mature NGF TrkA. Eur. J. Pharmacol. 895. Application: Neutralising ( in-vivo ). Ryu JC et al. (2018). Role of proNGF/p75 signaling in bladder dysfunction after spinal cord injury. J Clin Invest. [Epub ahead of print]. Application: Western Blotting.
Specificity:
The specificity of this antibody has been confirmed by WB. It does NOT crossreact with proBDNF, proNT-3 or mature NGF. Confirmed to react with purified human proNGF and crossreact with mouse and rat proNGF
Storage:
Maintain lyophilized antibody at 2-8°C for up to 12 months after date of receipt. After reconstitution keep undiluted aliquots at -20°C for up to 6 months for higher stability or at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Catenin beta is an adherens junction protein and has a role in the regulation of cell adhesion and in signal transduction through the Wnt pathway. At least 2 isoforms are produced by alternative splicing.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from 10 mM sodium HEPES (pH 7.5), 150 mM NaCl, and 0.05 % sodium azide.
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (C-QSYLDSGIHSGATTTAPSL) corresponding to the amino acid region 28-46 of human Catenin beta coupled to carrier protein KLH. This antibody was designed to detect the active form of Catenin beta . The antibody exhibits a strong preference for dephosphorylated beta catenin protein by western blot but the antibody may show cross reactivity with phosphorylated catenin beta under certain conditions.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunocytochemistry. A concentration of 2.0 µg/mL is recommended for WB. Human Catenin beta (isoform 1) has a predicted length of 781 residues and MW of 86 kDa. It has been observed as a 92 kDa band in SDS-reducing gels. A concentration of 4.0 µg/mL is recommended for Immunocytochemistry. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB against the antigen. Human; mouse; rat;
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Sheep anti-Catenin beta Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Catenin beta is an adherens junction protein and has a role in the regulation of cell adhesion and in signal transduction through the Wnt pathway. At least 2 isoforms are produced by alternative splicing.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from 10 mM sodium HEPES (pH 7.5), 150 mM NaCl, and 0.05 % sodium azide.
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (C-SNQLAWFDTDL) corresponding to the amino acid region 771-781 of human Catenin beta coupled to carrier protein KLH.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunoprecipitation. A concentration of 1.0 µg/mL is recommended for WB. Human Catenin beta (isoform 1) has a predicted length of 781 residues and MW of 86 kDa. A concentration of 5 µg/500 µg of lysate is recommended for immunoprecipitation. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB against the antigen. This antibody was also validated for immunoprecipitation in rat liver lysate (data not shown). Human; mouse; rat;
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Normal sheep IgG from non-immunized animal, Sheep Polyclonal Antibody
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4, without preservatives.
Host Animal:
Sheep
Species Reactivity:
Non-Reactive (Negative Control)
Immunogen:
None. Sheep IgG is obtained from non-immunized animals.
Applications:
Negative Control
Antibody Isotype:
IgG
Application Details:
Use as negative control for IgG-purified sheep primary antibodies and at matching concentration.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Uncharacterized serum control
Storage:
Store lyophilized sheep IgG at -20°C to -80°C protected from moisture. After reconstitution divide IgG into useful aliquots and keep aliquots at -20°C to -80°C for a higher stability. Working aliquots can be kept at 2-8°C for up to 1 month. Avoid repetitive freeze/thaw cycles.
Normal sheep serum from non-immunized animal, Sheep Polyclonal Antibody
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Sheep
Species Reactivity:
Non-Reactive (Negative Control)
Immunogen:
None. Sheep serum is obtained from non-immunized animals.
Applications:
Negative Control
Antibody Isotype:
Mixed
Application Details:
Use as negative control for IgG-purified sheep primary antibodies and at matching concentration.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Uncharacterized serum control
Storage:
Store lyophilized sheep whole serum at -20°C to -80°C protected from moisture. After reconstitution, divide whole serum nto useful aliquots and keep aliquots at -20°C to -80°C for a higher stability. Working aliquots can be kept at 2-8°C for up to 1 month. Avoid repetitive freeze/thaw cycles.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Sheep Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Storage:
2-8 °C
Country Of Origin:
US Origin
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Country Of Origin:
Normal Sheep Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
C1-inhibitor (C1-inh, C1 esterase inhibitor) is a protease inhibitor belonging to the serpin superfamily. Its main function is the inhibition of the complement system to prevent spontaneous activation.
Concentration:
> 4.5 mg/ml (E 1% at 280 nm = 13.0)
Conjugate:
Unconjugated
Form:
Clear, colorless liquid, 0.2 µm filtered
Purification:
Affinity purified using solid phase Human C1 Inhibitor
Purity:
> 95% based on SDS-PAGE
Host:
Sheep
Immunogen:
Human C1 Inhibitor
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human C1 Inhibitor
Country Of Origin:
Sheep serum was obtained from healthy animals of UK origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Human Alpha-1-Antichymotrypsin
Purity:
> 95% based on SDS-PAGE
Host:
Sheep
Immunogen:
Human Alpha-1-Antichymotrypsin
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human Alpha-1-Antichymotrypsin
Country Of Origin:
Goat serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Human Alpha-2-HS Glycoprotein
Purity:
> 95% based on SDS-PAGE
Host:
Sheep
Immunogen:
Human Alpha-2-HS Glycoprotein
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human Alpha-2-HS Glycoprotein
Country Of Origin:
Sheep serum was obtained from healthy animals of UK origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified using solid phase Human Complement C5
Purity:
> 95% based on SDS-PAGE
Host:
Sheep
Immunogen:
Human Complement C5
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Human Complement C5
Country Of Origin:
Sheep serum was obtained from healthy animals of UK origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rabbit IgG · light chains on all rabbit immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rabbit serum proteins
Country Of Origin:
Sheep serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Sheep
Immunogen:
Purified Rabbit IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.8, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rabbit IgG · light chains on all rabbit immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rabbit serum proteins
Country Of Origin:
Sheep serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Sheep
Immunogen:
Purified Rabbit IgG, whole molecule
Buffer:
PBS, 1% BSA & 0.1% proclin 150
Preservative:
0.1% (v/v) Kathon CG
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
Store freeze-dried powder at 2-8 °C.
Shelf Life:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, dilute with 50% glycerol and store at -20 °C as a liquid.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rabbit IgG · light chains on all rabbit immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rabbit serum proteins
Country Of Origin:
Sheep serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Affinity purified antibody is > 95% based on SDS-PAGE
Host:
Sheep
Immunogen:
Purified Rabbit IgG, whole molecule
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2, 1 % (w/v) BSA, Protease/IgG free
Preservative:
0.05% (w/v) Sodium Azide
Reconstitution:
Rehydrate with 1.1 ml of deionized water and let stand 30 minutes at room temperature to dissolve. (Product has been overfilled to ensure complete recovery.) Centrifuge to remove any particulates. Prepare fresh working dilution daily.
Storage:
2-8 °C
Shelf Life:
1 year from date of receipt. Prepare working dilution prior to use and then discard.
Specificity:
Based on IEP, this antibody reacts with: · heavy (γ) chains on rabbit IgG · light chains on all rabbit immunoglobulins
Cross Reactivity:
Based on IEP, no reactivity is observed to: · non-immunoglobulin rabbit serum proteins
Country Of Origin:
Sheep serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Human Serum/Plasma was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Human Serum/Plasma was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
Non-immune Ku-Ming (KM) Mouse Strain
Country Of Origin:
Normal Mouse Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 5.5 ml of deionized water. (Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
Non-immune Ku-Ming (KM) Mouse Strain
Country Of Origin:
Normal Mouse Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Rabbit Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Goat Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Goat Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Sheep Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Sheep Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Rat Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 5.5 ml of deionized water. (Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Rat Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Bovine Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Bovine Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Chicken Serum (unspecified gender) was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Chicken Serum (unspecified gender) was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Guinea Pig Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 5.5 ml of deionized water. (Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Guinea Pig Serum was obtained from healthy animals of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Syrian Hamster Serum was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 5.5 ml of deionized water. (Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Syrian Hamster Serum was obtained from healthy donors of US origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Horse Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Horse Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Donkey serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Donkey serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Pig Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Pig Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Cross Reactivity:
Serum may may contain anti-feline calicivirus antibodies. Not suitable as negative control within calicivirus assay.
Country Of Origin:
Normal Cat Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Cross Reactivity:
Serum may may contain anti-feline calicivirus antibodies. Not suitable as negative control within calicivirus assay.
Country Of Origin:
Normal Cat Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Dog Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
non-immune
Country Of Origin:
Normal Dog Serum was obtained from healthy animals of Chinese origin.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 11.0 ml of deionized water.(Product has been overfilled to ensure complete recovery.) Swirl gently and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Country Of Origin:
Normal Llama Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Lipid extracted and dialyzed against 10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Buffer:
10 mM Sodium Phosphate, 0.15 M Sodium Chloride, pH 7.2
Reconstitution:
Rehydrate with 2.2 ml of deionized water. (Product has been overfilled to ensure complete recovery) Swirl gentle and let stand for up to 2 hours at 18-25 °C. Centrifuge reconstituted serum to remove any precipitates.
Storage:
Store lyophilized material at 2-8 °C. For long term storage after reconstitution, prepare small aliquots and store at -20 °C . For storage at 2-8 °C, add a preservative to prevent growth of bacteria.
Specificity:
Non-immune
Country Of Origin:
Normal Llama Serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
Black-Gold II is a novel haloaurophosphate complex which localises myelin within the central nervous system. The Black Gold II Ready-to-Dilute (RTD) Staining Kit allows you to localise myelin, both individual fibres and tracts, along with the option of co-localising cell bodies via the Toluidine Blue counter stain. Black Gold II labelled myelinated fibres appear nearly black while the Toluidine Blue O labelled cellular Nissl bodies are blue under bright field illumination. Black Gold II can demonstrate and characterise specific myelin changes associated with exposure to diverse neurotoxicants including kainic acid, domoic acid, 3-nitropropionic acid, Fluoro-Gold and isoniazid. Black Gold II can also be combined with other histochemical markers including Nissl stains, retrogradely transported fluorescent tracers and fluorescent markers of neuronal degeneration. The advantages associated with the Black-Gold II include high resolution, high contrast, short histochemical processing time, versatility and consistent reproducibility.
Product Type:
Staining Reagent
Format:
The reagents in the Black Gold kit (10X) are all supplied in a liquid format and are ready-to-dilute.
Species Reactivity:
Mammals
Applications:
IHC-Frozen,IHC-non-Paraffin-embedded
Application Details:
Black Gold II is a high resolution myelin stain with amyloid plaque counter stain. Its use is tailored to studies using formalin or paraformaldehyde fixed, non-paraffin embedded, non-solvent processed brain tissue. It can be used with both thick and thin sections. For thick sections, gelatin coated slides or slides specially designed to bind tissues sections should be use to avoid section loss. Free-floating sections can be used as well but sections are easier to handle and transfer when mounted on slides. A suggested method for thick sections is provided as a guide: Either frozen or vibratome sections are cut at a thickness of 20-50 ?m and collected in 0.1 M neutral phosphate buffer. The sections are then typically mounted on 1% gel-coated slides and then air dried on a slide warmer (at 50°C) for at least an hour until throughly dried and adhered to the slide. The sections can be stained loose, although the sections are easier to handle when mounted on slides. The mounted sections were rehydrated in distilled water for 2 minutes before being processed in the staining solutions.
Alternative Names:
BlackGold, Black and Gold
Biosensis Brand:
Biosensis® RTD
Detection Method:
Colorimetric
Shelf Life:
Unopened kit 6 months at 2-8ºC protected from light. See Storage instructions for working solutions recommendations.
Use:
For research use only.
Kit Components:
Black-Gold II (Dilute 1:10 prior to use) - 10 mL Sodium Thiosulfate, fixative (Dilute 1:10 prior to use) - 10 mL Toluidine Blue O (Dilute 1:10 prior to use) - 10 mL Acetic Acid (Dilute 1:10 prior to use) - 10 mL
Product references:
Lee J et al. (2022) PRMT1 is required for the generation of MHC-associated microglia and remyelination in the central nervous system. Life Sci Alliance. [Epub ahead of print] Germundson DL & Nagamoto-Combs K. (2022) Potential Role of Intracranial Mast Cells in Neuroinflammation and Neuropathology Associated with Food Allergy. Cells. 11(4):738. Kihara Y et al. (2021) Ponesimod inhibits astrocyte-mediated neuroinflammation and protects against cingulum demyelination via S1P1-selective modulation. FASEB J. 36(2):e22132. Toomey LM et al. (2021) Cuprizone feed formulation influences the extent of demyelinating disease pathology. Sci Rep. 11(1):22594. Del Fiacco M et al. (2018) TRPV1-Like Immunoreactivity in the Human Locus K, a Distinct Subregion of the Cuneate Nucleus. Cells. 2018 Jul 8;7(7). pii: E72. Ying YL et al. (2014) Adult neural precursor cells from the subventricular zone contribute significantly to oligodendrocyte regeneration and remyelination. J Neurosci. 2014 Oct 15;34(42):14128-46
Specificity:
Black-Gold II is a novel haloaurophosphate complex which localises myelin within the central nervous system.
Storage:
The kit can be transported at room temperature. Once received, the kit canbe stored for up to 12 months at 2-8°C protected from light. Diluted solutionscan be stored up to one month at 2-8°C protected from light.
The causes and effects of neuronal degeneration are of major interest to a wide variety of neuroscientists. Paralleling this growing interest is an increasing number of methods applicable to the detection of neuronal degeneration. Fluoro-Jade C stains all degenerating neurons regardless of specific insult or mechanism of cell death. Fluoro-Jade C exhibits the greatest signal to background ratio, as well as the highest resolution. This translates to a stain of maximal contrast and affinity for degenerating neurons. This makes it ideal for localising not only degenerating nerve cell bodies but also distal dendrites, axons and terminals. The dye is highly resistant to fading and is compatible with virtually all histological processing and staining protocols.
Product Type:
Staining Reagent
Format:
The reagents in the Fluoro Jade kit (10X) are all supplied in a liquid format and are ready-to-dilute.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
FC,ICC,IHC-Frozen,IHC-Paraffin-embedded
Application Details:
The Fluoro-Jade C 'Ready to Dilute' (RTD) Staining Kit provides an easy to use assortment of Fluoro-Jade C, DAPI, sodium hydroxide and potassium permanganate in liquid form. Following our detailed protocol, Fluoro-Jade C labelled degenerating neurons are visualised with blue light excitation while DAPI counter stained cell nuclei are visualised with ultra-violet illumination. The Fluoro-Jade C Staining Kit can be used on all kinds of preserved tissues, including fresh-frozen, paraformaldehyde or formalin fixed, and formalin fixed, paraffin-embedded tissues.
Alternative Names:
FJC
Biosensis Brand:
Biosensis® RTD
Detection Method:
Fluorescence
Excitation/Emission:
FJC visualization is accomplished using blue light or a 488 nm Laser. Excitation Peak: 495 nm Emission Peak: 521 nm Filter system for visualizing: Fluorescein/FITC
Shelf Life:
Unopened kit 6 months at 2-8ºC protected from light. See Storage instructions for working solutions recommendations.
Use:
For research use only.
Kit Components:
Materials provided: Sodium Hydroxide, Solution A (Dilute 1:10 prior to use) - 40 mL Potassium Permanganate, Solution B (Dilute 1:10 prior to use) - 40 mL Fluoro-Jade C, Solution C (Dilute 1:10 prior to use) - 40 mL DAPI, Solution D (Add to diluted Fluoro-Jade C) - 40 mL Equipment and Reagents required: Gelatin coated microscope slides Staining dishes/Coplin jars Cover slips DPX mounting media Slide warmer Convection oven Distilled water Ethanol Xylene Number of slides processed: The actual number of slides processed by this kit will depend largely upon the vessel that is used to incubate the slides. If using a standard Coplin Jar, its capacity is 50 mL and typically holds 5 slides per jar. If using such a device, then 80-100 slides stained per 50 ml of working solution (or, 5 ml of stock solution) could be processed in one day. Note the diluted dye is NOT stable and will not store overnight. It is best to use freshly diluted dye each time an experimental batch is started. Final working concentrations of FJC: 0.0001% Final working concentration of KMnO4: 0.06%
Product references:
Total Number of References: 153 Latest Publications (2020-2022):
Li L et al. (2022) "A selective degeneration of cholinergic neurons mediated by NRADD in an Alzheimer's disease mouse model" Cell Insight. [Epub ahead of print] . Application: IF. Species: Mouse. Karino K et al. (2022) "Inhibitor of nuclear factor kappa-B kinase epsilon contributes to neuropsychiatric manifestations in lupus-prone mice through microglial activation" Arthritis Rheumatol. [Epub ahead of print] . Application: IF. Species: Mouse. Chen J et al. (2022) "Flufenamic acid improves survival and neurologic outcome after successful cardiopulmonary resuscitation in mice" J Neuroinflammation. 19(1):214 . Application: IF. Species: Mouse. Zou Y et al. (2022) "Learning and memory impairment and transcriptomic profile in hippocampus of offspring after maternal fructose exposure during gestation and lactation" Food Chem Toxicol. [Epub ahead of print] . Application: IF. Species: Rat. Jin P et al. (2022) "Aprepitant attenuates NLRC4-dependent neuronal pyroptosis via NK1R/PKC? pathway in a mouse model of intracerebral hemorrhage" J Neuroinflammation. 19(10):198 . Application: IF. Species: Mouse. Koike-Kumagai M et al. (2022) "Sirolimus relieves seizures and neuropsychiatric symptoms via changes of microglial polarity in tuberous sclerosis complex model mice" Neuropharmacology. [Epub ahead of print] . Application: IF. Species: Mouse. Wang D et al. (2022) "Mesenchymal stromal cell treatment attenuates repetitive mild traumatic brain injury-induced persistent cognitive deficits via suppressing ferroptosis" Neuroinflammation. 19(1):185 . Application: IF. Species: Mouse. Seo Y et al. (2022) "Mesenchymal stem cells target microglia via galectin-1 production to rescue aged mice from olfactory dysfunction" Biomed Pharmacother. 153:113347 . Application: IF. Species: Mouse. Duan R et al. (2022) "Recurrent de novo single point variant on the gene encoding Na+/K+ pump results in epilepsy" Prog Neurobiol. 216:102310 . Application: IF. Species: Mouse. Liu P et al. (2022) "Suppression of phosphodiesterase IV enzyme by Roflumilast ameliorates cognitive dysfunction in aged rats after sevoflurane anesthesia via PKA-CREB and MEK/ERK pathways" Eur J Neurosci. [Epub ahead of print] . Application: IF. Species: Rat. Boucher ML et al. (2022) "Titrating the Translational Relevance of a Low-Level Repetitive Head Impact Model" Front Neurol. 13:857654 . Application: IF. Species: Mouse. Qian L et al. (2022) "Interleukin-35 attenuates blood-brain barrier dysfunction caused by cerebral ischemia-reperfusion injury through inhibiting brain endothelial cell injury" Ann Transl Med. 10.21037 . Application: IF. Species: Mouse. Buentello DC et al. (2022) "Use of standard U-bottom and V-bottom well plates to generate neuroepithelial embryoid bodies" PLoS One. 17(5): e0262062 . Application: IF. Species: Human. Jin P et al. (2022) "Activation of LRP6 with HLY78 Attenuates Oxidative Stress and Neuronal Apoptosis via GSK3?/Sirt1/PGC-1? Pathway after ICH" Oxid Med Cell Longev. 2022: 7542468 . Application: IF. Species: Mouse. Wang J et al. (2022) "Irisin protects against sepsis-associated encephalopathy by suppressing ferroptosis via activation of the Nrf2/GPX4 signal axis" Free Radic Biol Med. [Epub ahead of print] . Application: IF. Species: Mouse. Tang T et al. (2022) "Ginkgetin Promotes M2 Polarization of Microglia and Exert Neuroprotection in Ischemic Stroke via Modulation of PPAR? Pathway" Neurochem Res. [Epub ahead of print] . Application: IF. Species: Rat. Zhang Z et al. (2022) "Inhibiting Microglia-Derived NLRP3 Alleviates Subependymal Edema and Cognitive Dysfunction in Posthemorrhagic Hydrocephalus after Intracerebral Hemorrhage via AMPK/Beclin-1 Pathway" Oxid. Med. Cell. Longev. [Epub ahead of print] . Application: IF. Species: Rat. Ren R et al. (2022) "Kynurenine/Aryl Hydrocarbon Receptor Modulates Mitochondria-Mediated Oxidative Stress and Neuronal Apoptosis in Experimental Intracerebral Hemorrhage" Antioxid Redox Signal. [Epub ahead of print] . Application: IF. Species: Mouse. Deforzh E et al. (2022) "Promoter and enhancer RNAs regulate chromatin reorganization and activation of miR-10b/HOXD locus, and neoplastic transformation in glioma" Mol Cell. [Epub ahead of print] . Application: IF. Species: Human, Mouse. Chen X et al. (2022) "Mechanism of Baicalein in Brain Injury After Intracerebral Hemorrhage by Inhibiting the ROS/NLRP3 Inflammasome Pathway" Inflammation. 45(2):590-602 . Application: IF. Species: Rat. Komatsu A et al. (2022) "Ammonia induces amyloidogenesis in astrocytes by promoting amyloid precursor protein translocation into the endoplasmic reticulum" J Bio; Chem. [Epub ahead of print] . Application: IF. Species: Mouse. Jin P et al. (2022) "Activation of LRP6 with HLY78 Attenuates Oxidative Stress and Neuronal Apoptosis via GSK3 ?/Sirt1/PGC-1 ? Pathway after ICH" Oxid Med Cell Longev. 7542468 . Application: IF. Species: Mouse. Hong Y et al. (2022) "Ultrasound stimulation improves inflammatory resolution, neuroprotection, and functional recovery after spinal cord injury" Sci Rep. 12(1):3636 . Application: IF. Species: Rat. Li J et al. (2022) "Inhibition of LRRK2-Rab10 Pathway Improves Secondary Brain Injury After Surgical Brain Injury in Rats" Front Surg. 8:749310 . Application: IF. Species: Rat. Yamashima T et al. (2022) "Hydroxynonenal Causes Lysosomal and Autophagic Failure in the Monkey." J Alzheimers Dis Parkinsonism. 12:529 . Application: IF. Species: Monkey. Salvadores N et al. (2022) "A? oligomers trigger necroptosis-mediated neurodegeneration via microglia activation in Alzheimer's disease." Acta Neuropathol Commun. 10(1):31 . Application: IF. Species: Mouse. Shi M et al. (2022) "Downregulation of TREM2/NF-?B signaling may damage the blood-brain barrier and aggravate neuronal apoptosis in experimental rats with surgically injured brain." Brain Res Bull. [Epub ahead of print] . Application: IF. Species: Rat. Zhao Y et al. (2022) "ATAD3A oligomerization promotes neuropathology and cognitive deficits in Alzheimers disease models." Nat Commun. 13(1):1121 . Application: IF. Species: Mouse. Fan X et al. (2022) "Inhibiting Sphingosine 1-Phosphate Receptor Subtype 3 Attenuates Brain Damage During Ischemia-Reperfusion Injury by Regulating nNOS/NO and Oxidative Stress." Front Neurosci. 16:838621 . Application: IF. Species: Mouse. Yu S et al. (2022) "BMS-470539 Attenuates Oxidative Stress and Neuronal Apoptosis via MC1R/cAMP/PKA/Nurr1 Signaling Pathway in a Neonatal Hypoxic-Ischemic Rat Model." Oxid Med Cell Longev. 2022:4054938 . Application: IF. Species: Rat. Kim EC et al. (2021) "Spontaneous seizure and memory loss in mice expressing an epileptic encephalopathy variant in the calmodulin-binding domain of Kv7.2." Proc Natl Acad Sci USA. 118(51):e2021265118 . Application: IF. Species: Mouse. Zhang Y et al. (2021) "GSK-3? inhibition elicits a neuroprotection by restoring lysosomal dysfunction in neurons via facilitation of TFEB nuclear translocation after ischemic stroke." Brain Res. [Epub ahead of print] . Application: IF. Species: Rat. Kondoh D et al. (2021) "Cotton rats (Sigmodon hispidus) with a high prevalence of hydrocephalus without clinical symptoms." Neuropathology. [Epub ahead of print] . Application: IF. Species: Rat. Iwasa K et al. (2021) "A peripheral lipid sensor GPR120 remotely contributes to suppression of PGD2-microglia-provoked neuroinflammation and neurodegeneration in the mouse hippocampus." J Neuroinflammation. 18(1):304 . Application: IF. Species: Mouse. Rodriguez-Masso SR et al. (2021) "The Bradykinin B2 Receptor Agonist (NG291) Causes Rapid Onset of Transient BloodBrain Barrier Disruption Without Evidence of Early Brain Injury." Front Neurosci. 15:791709 . Application: IF. Species: Rat. Li N et al. (2021) "Postcooling But Not Precooling Benefits Motor Recovery by Suppressing Cell Death after Surgical Spinal Cord Injury in Rats." World Neurosurg. [Epub ahead of print] . Application: IF. Species: Rat. Estrada H et al. (2021) "High-resolution fluorescence-guided transcranial ultrasound mapping in the live mouse brain. Sci Adv. 7(50):eabi5464 . Application: IF. Species: Mouse. Gu R et al. (2021) "Rh-CXCL-12 Attenuates Neuronal Pyroptosis after Subarachnoid Hemorrhage in Rats via Regulating the CXCR4/NLRP1 Pathway." Oxid Med Cell Longev. 2021:6966394 . Application: IF. Species: Rat. Huang L et al. (2021) "Docosahexaenoic acid reduces hypoglycemia-induced neuronal necroptosis via the peroxisome proliferator-activated receptor ?/nuclear factor-?B pathway." Brain Res. [Epub ahead of print] . Application: IF. Species: Mouse. Yaguchi A et al. (2021) "Efficient protein incorporation and release by a jigsaw-shaped self-assembling peptide hydrogel for injured brain regeneration." Nat Commun. 12(1):6623 . Application: IF. Species: Mouse. Liu Y et al. (2021) "Neuroprotection of minocycline by inhibition of extracellular matrix metalloproteinase inducer expression following intracerebral hemorrhage in mice." Neurosci Lett. [Epub ahead of print] . Application: IF. Species: Mouse. Lam V et al. (2021) "Synthesis of human amyloid restricted to liver results in an Alzheimer disease-like neurodegenerative phenotype." PLoS Biol. 19(9):e3001358 . Application: IF. Species: Mouse. Wu Z et al. (2021) "Melibiose Confers a Neuroprotection against Cerebral Ischemia/Reperfusion Injury by Ameliorating Autophagy Flux via Facilitation of TFEB Nuclear Translocation in Neurons." Life. 11(9), 948 . Application: IF. Species: Rat. Fang Y et al. (2021) "Pituitary adenylate cyclase-activating polypeptide attenuates mitochondria-mediated oxidative stress and neuronal apoptosis after subarachnoid hemorrhage in rats." Free Radic Biol Med. 174:236-248 . Application: IF. Species: Rat. Huan PS et al. (2021) "3,6'-Dithiopomalidomide Ameliorates Hippocampal Neurodegeneration, Microgliosis and Astrogliosis and Improves Cognitive Behaviors in Rats with a Moderate Traumatic Brain Injury." Int J Mol Sci. 22(15):8276 . Application: IF. Species: Mouse. Han M et al. (2021) "Localized Modification of Water Molecule Transport After Focused Ultrasound-Induced BloodBrain Barrier Disruption in Rat Brain." Front Neurosci. 15:685977 . Application: IF. Species: Rat. Gong Y et al. (2021) "Inhibition of the p?SPAK/p?NKCC1 signaling pathway protects the blood?brain barrier and reduces neuronal apoptosis in a rat model of surgical brain injury." Mol Med Rep. 24(4):717 . Application: IF. Species: Rat. Zhu L et al. (2021) "Neuroprotective effects of salidroside on ageing hippocampal neurons and naturally ageing mice via the PI3K/Akt/TERT pathway." Phytother Res. [Epub ahead of print] . Application: IF. Species: Mouse. Huang Y et al. (2021) "Kisspeptin-54 attenuates oxidative stress and neuronal apoptosis in early brain injury after subarachnoid hemorrhage in rats via GPR54/ARRB2/AKT/GSK3? signaling pathway." Free Radic Biol Med. 171:99-111 . Application: IF. Species: Rat. Gong Y et al. (2021) "Inhibition of the NKCC1/NF-?B Signaling Pathway Decreases Inflammation and Improves Brain Edema and Nerve Cell Apoptosis in an SBI Rat Model." Front Mol Neurosci. 14:641993 . Application: IF. Species: Rat. Caron NS et al. (2021) "Mutant Huntingtin Is Cleared from the Brain via Active Mechanisms in Huntington Disease." J Neurosci. 41(4):780-796 . Application: IF. Species: Human. Liu L et al. (2021) "A Novel Netrin-1-Derived Peptide Enhances Protection against Neuronal Death and Mitigates of Intracerebral Hemorrhage in Mice." Int J Mol Sci. 22(9):4829 . Application: IF. Species: Mouse. Zalewska K et al. (2021) "Corticosterone Administration Alters White Matter Tract Structure and Reduces Gliosis in the Sub-Acute Phase of Experimental Stroke." Int J Mol Sci. 22(13):6693 . Application: IF. Species: Mouse. Agrawal RR et al. (2021) "Neurometabolic Alterations After Traumatic Brain Injury: Links to Mitochondria-Associated ER Membranes and Alzheimers Disease." PhD Thesis . Application: IF. Species: Mouse. Zhou H et al. (2021) "AXL kinase-mediated astrocytic phagocytosis modulates outcomes of traumatic brain injury." J Neuroinflammation. 18(1):154 . Application: IF. Species: Mouse. Ousta A et al. (2021) "Microglial Activation and Neurological Outcomes in a Murine Model of Cardiac Arrest." Neurocrit Care. [Epub ahead of print] . Application: IF. Species: Mouse. Horinokita H et al. (2021) "Possible involvement of progranulin in the protective effect of elastase inhibitor on cerebral ischemic injuries of neuronal and glial cells." Mol Cell Neurosci. 113:103625 . Application: IF. Species: Human. Ho MH et al. (2021) "CCL5 via GPX1 activation protects hippocampal memory function after mild traumatic brain injury." Redox Biol. 46:102067 . Application: IF. Species: Mouse. Lian C et al. (2021) "Pentraxin 3 secreted by human adipose-derived stem cells promotes dopaminergic neuron repair in Parkinson's disease via the inhibition of apoptosis." FASEB J. 35(7):e21748 . Application: IF. Species: Mouse. Li Z et al. (2021) "The combination of deferoxamine and minocycline strengthens neuroprotective effect on acute intracerebral hemorrhage in rats." Neurol Res. [Epub ahead of print] . Application: IF. Species: Rat. Zhou K et al. (2021) "Dihydrolipoic acid enhances autophagy and alleviates neurological deficits after subarachnoid hemorrhage in rats." Exp Neurol. 342:113752 . Application: IF. Asuni GP et al. (2021) "Neuronal apoptosis induced by morphine withdrawal is mediated by the p75 neurotrophin receptor." J Neurochem. [Epub ahead of print] . Application: IF. Deng S et al. (2021) "Albumin Reduces Oxidative Stress and Neuronal Apoptosis via the ERK/Nrf2/HO-1 Pathway after Intracerebral Hemorrhage in Rats." Oxid. Med. Cell. Longev. 2021, Article ID 8891373 . Application: IF. Wu MY et al. (2021) "Possible mechanisms of the PERK pathway on neuronal apoptosis in a rat model of surgical brain injury." Am J Transl Res. 13(2):732-742 . Application: IF. Cai G et al. (2021) "Mesenchymal stem cell-derived exosome miR-542-3p suppresses inflammation and prevents cerebral infarction." Stem Cell Res Ther. 12(1)2 . Application: IF. Xu W et al. (2021) "Melanocortin 1 receptor attenuates early brain injury following subarachnoid hemorrhage by controlling mitochondrial metabolism via AMPK/SIRT1/PGC-1_ pathway in rats." Theranostics. 11(2):522-39 . Application: IF. Wu M et al. (2020) "The Blood Component Iron Causes Neuronal Apoptosis Following Intracerebral Hemorrhage via the PERK Pathway." Front. Neurol. 11:588548 . Application: IF. Wu D et al. (2020) "Activated WNK3 induced by intracerebral hemorrhage deteriorates brain injury maybe via WNK3/SPAK/NKCC1 pathway." Exp Neuro. 332:113386 . Application: IF. Fang Y et al. (2020) "HIF-1_ Mediates TRAIL-Induced Neuronal Apoptosis via Regulating DcR1 Expression Following Traumatic Brain Injury." Front Cell Neurosci. 14:192 . Application: IF. Lin CT et al. (2020) "3,6 -dithiopomalidomide reduces neural loss, inflammation, behavioral deficits in brain injury and microglial activation." Elife. 9:e54726 . Application: IF. Wu H et al. (2020) "Upregulated Nmnat2 causes neuronal death and increases seizure susceptibility in temporal lobe epilepsy." Brain Res Bull. [Epub ahead of print] . Application: IF. Zahedi K et al. (2020) "Ablation of polyamine catabolic enzymes provokes Purkinje cell damage, neuroinflammation, and severe ataxia." J Neuroinflammation. 17(1):301 . Application: IF. Hu X et al. (2020) "Rh-CSF1 Attenuates Oxidative Stress and Neuronal Apoptosis via the CSF1R/PLCG2/PKA/UCP2 Signaling Pathway in a Rat Model of Neonatal HIE." Oxid Med Cell Longev. 2020:6801587 . Application: IF. Hu H et al. (2020) "Transient receptor potential melastatin 2 contributes to neuroinflammation and negatively regulates cognitive outcomes in a pilocarpine-induced mouse model of epilepsy." Int Immunopharmacol. 87:106824 . Application: IF. Wang S et al. (2020) "Aging exacerbates impairments of cerebral blood flow autoregulation and cognition in diabetic rats." Geroscience. [Epub ahead of print] . Application: IF. Chen PY et al. (2020) "Stearic Acid Methyl Ester Affords Neuroprotection and Improves Functional Outcomes after Cardiac Arrest." Prostag Leukotr Ess. [In Press] . Application: IF. Gamdzyk M et al. (2020) "cGAS/STING Pathway Activation Contributes to Delayed Neurodegeneration in Neonatal Hypoxia-Ischemia Rat Model: Possible Involvement of LINE-1." Mol Neurobiol. 57(6): 2600-19 . Application: IF. Species: Rat Tang H et al. (2020) "Delayed Recanalization After MCAO Ameliorates Ischemic Stroke by Inhibiting Apoptosis via HGF/c-met/STAT3/Bcl-2 Pathway in Rats." Exp Neurol. [Epub ahead of print] . Application: IF. Species: Rat Ocak U et al. (2020) "Inhibition of mast cell tryptase attenuates neuroinflammation via PAR-2/p38/NF?B pathway following asphyxial cardiac arrest in rats." J Neuroinflammation. 17(1):144 . Application: IF. Species: Rat Huang J et al. (2020) "IRE1? inhibition attenuates neuronal pyroptosis via miR-125/NLRP1 pathway in a neonatal hypoxic-ischemic encephalopathy rat model." J Neuroinflammation. 17(1):152 . Application: IF. Species: Rat Fouda MA et al. (2020) "Estrogen-dependent hypersensitivity to diabetes-evoked cardiac autonomic dysregulation: Role of hypothalamic neuroinflammation." Life Sci. 2020 Mar 31:117598. [Epub ahead of print] . Application: IF. Species: Rat Zhou Z et al. (2020) "Sodium butyrate attenuated neuronal apoptosis via GPR41/G??/PI3K/Akt pathway after MCAO in rats." J Cerebr Blood F Met. [Epub ahead of print]. Application: IF. Species: Rat Enam SF et al. (2020) "Engineering Cytokine and Macrophage Enrichment at Sites of Injury." PhD Thesis . Application: IF. Species: Mouse
Specificity:
Degenerating neurons, and neuronal degeneration. There is no specific staining in normal healthy brain. Note: Some researchers under some conditions report blood vessel staining with Fluoro Jade. This may be because Fluoro Jade is an analogue of eosin (which stains blood cells). In general, good perfusion and preparation of the tissue should help prevent blood vessel staining but it may not be possible to eliminate it entirely. In our experience it is generally possible to distinguish neuronal from blood vessels staining by eye.
Storage:
The unopened kit can be stored for up to 6 months at 2-8ºC after the date of receipt. The kit and components should be stored protected from light. Diluted FJC dye solutions are not stable and should be used within 4 hours of making. The other diluted solutions can be reused and stored for up to 48 hours if refrigerated and protected from light. Best results require freshly diluted solutions. We recommend using aseptic techniques when handling the reagents to avoid bacterial growth and contamination.<br><br>The FJC Ready to dilute kit is shipped ambient and stable at room temperature during transport. Refrigerate upon arrival, do not freeze.
The causes and effects of neuronal degeneration are of major interest to a wide variety of neuroscientists. Paralleling this growing interest is an increasing number of methods applicable to the detection of neuronal degeneration. Fluoro-Jade C stains all degenerating neurons regardless of specific insult or mechanism of cell death. Fluoro-Jade C exhibits the greatest signal to background ratio, as well as the highest resolution. This translates to a stain of maximal contrast and affinity for degenerating neurons. This makes it ideal for localising not only degenerating nerve cell bodies but also distal dendrites, axons and terminals. The dye is highly resistant to fading and is compatible with virtually all histological processing and staining protocols.
Product Type:
Staining Reagent
Format:
The reagents in the Fluoro Jade kit (10X) are all supplied in a liquid format and are ready-to-dilute.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
FC,ICC,IHC-Frozen,IHC-Paraffin-embedded
Application Details:
The Fluoro-Jade C 'Ready to Dilute' (RTD) Staining Kit provides an easy to use assortment of Fluoro-Jade C, DAPI, sodium hydroxide and potassium permanganate in liquid form. Following our detailed protocol, Fluoro-Jade C labelled degenerating neurons are visualised with blue light excitation while DAPI counter stained cell nuclei are visualised with ultra-violet illumination. The Fluoro-Jade C Staining Kit can be used on all kinds of preserved tissues, including fresh-frozen, paraformaldehyde or formalin fixed, and formalin fixed, paraffin-embedded tissues.
Alternative Names:
FJC
Biosensis Brand:
Biosensis® RTD
Detection Method:
Fluorescence
Excitation/Emission:
FJC visualization is accomplished using blue light or a 488 nm Laser. Excitation Peak: 495 nm Emission Peak: 521 nm Filter system for visualizing: Fluorescein/FITC
Shelf Life:
Unopened kit 6 months at 2-8ºC protected from light. See Storage instructions for working solutions recommendations.
Use:
For research use only.
Kit Components:
Materials provided: Sodium Hydroxide, Solution A (Dilute 1:10 prior to use) - 20 mL Potassium Permanganate, Solution B (Dilute 1:10 prior to use) - 20 mL Fluoro-Jade C, Solution C (Dilute 1:10 prior to use) - 20 mL DAPI, Solution D (Add to diluted Fluoro-Jade C) - 20 mL Equipment and Reagents required: Gelatin coated microscope slides Staining dishes/Coplin jars Cover slips DPX mounting media Slide warmer Convection oven Distilled water Ethanol Xylene Number of slides processed: The actual number of slides processed by this kit will depend largely upon the vessel that is used to incubate the slides. If using a standard Coplin Jar, its capacity is 50 mL and typically holds 5 slides per jar. If using such a device, then 80-100 slides stained per 50 ml of working solution (or, 5 ml of stock solution) could be processed in one day. Note the diluted dye is NOT stable and will not store overnight. It is best to use freshly diluted dye each time an experimental batch is started. Final working concentrations of FJC: 0.0001% Final working concentration of KMnO4: 0.06%
Product references:
Total Number of References: 153 Latest Publications (2020-2022):
Li L et al. (2022) "A selective degeneration of cholinergic neurons mediated by NRADD in an Alzheimer's disease mouse model" Cell Insight. [Epub ahead of print] . Application: IF. Species: Mouse. Karino K et al. (2022) "Inhibitor of nuclear factor kappa-B kinase epsilon contributes to neuropsychiatric manifestations in lupus-prone mice through microglial activation" Arthritis Rheumatol. [Epub ahead of print] . Application: IF. Species: Mouse. Chen J et al. (2022) "Flufenamic acid improves survival and neurologic outcome after successful cardiopulmonary resuscitation in mice" J Neuroinflammation. 19(1):214 . Application: IF. Species: Mouse. Zou Y et al. (2022) "Learning and memory impairment and transcriptomic profile in hippocampus of offspring after maternal fructose exposure during gestation and lactation" Food Chem Toxicol. [Epub ahead of print] . Application: IF. Species: Rat. Jin P et al. (2022) "Aprepitant attenuates NLRC4-dependent neuronal pyroptosis via NK1R/PKC? pathway in a mouse model of intracerebral hemorrhage" J Neuroinflammation. 19(10):198 . Application: IF. Species: Mouse. Koike-Kumagai M et al. (2022) "Sirolimus relieves seizures and neuropsychiatric symptoms via changes of microglial polarity in tuberous sclerosis complex model mice" Neuropharmacology. [Epub ahead of print] . Application: IF. Species: Mouse. Wang D et al. (2022) "Mesenchymal stromal cell treatment attenuates repetitive mild traumatic brain injury-induced persistent cognitive deficits via suppressing ferroptosis" Neuroinflammation. 19(1):185 . Application: IF. Species: Mouse. Seo Y et al. (2022) "Mesenchymal stem cells target microglia via galectin-1 production to rescue aged mice from olfactory dysfunction" Biomed Pharmacother. 153:113347 . Application: IF. Species: Mouse. Duan R et al. (2022) "Recurrent de novo single point variant on the gene encoding Na+/K+ pump results in epilepsy" Prog Neurobiol. 216:102310 . Application: IF. Species: Mouse. Liu P et al. (2022) "Suppression of phosphodiesterase IV enzyme by Roflumilast ameliorates cognitive dysfunction in aged rats after sevoflurane anesthesia via PKA-CREB and MEK/ERK pathways" Eur J Neurosci. [Epub ahead of print] . Application: IF. Species: Rat. Boucher ML et al. (2022) "Titrating the Translational Relevance of a Low-Level Repetitive Head Impact Model" Front Neurol. 13:857654 . Application: IF. Species: Mouse. Qian L et al. (2022) "Interleukin-35 attenuates blood-brain barrier dysfunction caused by cerebral ischemia-reperfusion injury through inhibiting brain endothelial cell injury" Ann Transl Med. 10.21037 . Application: IF. Species: Mouse. Buentello DC et al. (2022) "Use of standard U-bottom and V-bottom well plates to generate neuroepithelial embryoid bodies" PLoS One. 17(5): e0262062 . Application: IF. Species: Human. Jin P et al. (2022) "Activation of LRP6 with HLY78 Attenuates Oxidative Stress and Neuronal Apoptosis via GSK3?/Sirt1/PGC-1? Pathway after ICH" Oxid Med Cell Longev. 2022: 7542468 . Application: IF. Species: Mouse. Wang J et al. (2022) "Irisin protects against sepsis-associated encephalopathy by suppressing ferroptosis via activation of the Nrf2/GPX4 signal axis" Free Radic Biol Med. [Epub ahead of print] . Application: IF. Species: Mouse. Tang T et al. (2022) "Ginkgetin Promotes M2 Polarization of Microglia and Exert Neuroprotection in Ischemic Stroke via Modulation of PPAR? Pathway" Neurochem Res. [Epub ahead of print] . Application: IF. Species: Rat. Zhang Z et al. (2022) "Inhibiting Microglia-Derived NLRP3 Alleviates Subependymal Edema and Cognitive Dysfunction in Posthemorrhagic Hydrocephalus after Intracerebral Hemorrhage via AMPK/Beclin-1 Pathway" Oxid. Med. Cell. Longev. [Epub ahead of print] . Application: IF. Species: Rat. Ren R et al. (2022) "Kynurenine/Aryl Hydrocarbon Receptor Modulates Mitochondria-Mediated Oxidative Stress and Neuronal Apoptosis in Experimental Intracerebral Hemorrhage" Antioxid Redox Signal. [Epub ahead of print] . Application: IF. Species: Mouse. Deforzh E et al. (2022) "Promoter and enhancer RNAs regulate chromatin reorganization and activation of miR-10b/HOXD locus, and neoplastic transformation in glioma" Mol Cell. [Epub ahead of print] . Application: IF. Species: Human, Mouse. Chen X et al. (2022) "Mechanism of Baicalein in Brain Injury After Intracerebral Hemorrhage by Inhibiting the ROS/NLRP3 Inflammasome Pathway" Inflammation. 45(2):590-602 . Application: IF. Species: Rat. Komatsu A et al. (2022) "Ammonia induces amyloidogenesis in astrocytes by promoting amyloid precursor protein translocation into the endoplasmic reticulum" J Bio; Chem. [Epub ahead of print] . Application: IF. Species: Mouse. Jin P et al. (2022) "Activation of LRP6 with HLY78 Attenuates Oxidative Stress and Neuronal Apoptosis via GSK3 ?/Sirt1/PGC-1 ? Pathway after ICH" Oxid Med Cell Longev. 7542468 . Application: IF. Species: Mouse. Hong Y et al. (2022) "Ultrasound stimulation improves inflammatory resolution, neuroprotection, and functional recovery after spinal cord injury" Sci Rep. 12(1):3636 . Application: IF. Species: Rat. Li J et al. (2022) "Inhibition of LRRK2-Rab10 Pathway Improves Secondary Brain Injury After Surgical Brain Injury in Rats" Front Surg. 8:749310 . Application: IF. Species: Rat. Yamashima T et al. (2022) "Hydroxynonenal Causes Lysosomal and Autophagic Failure in the Monkey." J Alzheimers Dis Parkinsonism. 12:529 . Application: IF. Species: Monkey. Salvadores N et al. (2022) "A? oligomers trigger necroptosis-mediated neurodegeneration via microglia activation in Alzheimer's disease." Acta Neuropathol Commun. 10(1):31 . Application: IF. Species: Mouse. Shi M et al. (2022) "Downregulation of TREM2/NF-?B signaling may damage the blood-brain barrier and aggravate neuronal apoptosis in experimental rats with surgically injured brain." Brain Res Bull. [Epub ahead of print] . Application: IF. Species: Rat. Zhao Y et al. (2022) "ATAD3A oligomerization promotes neuropathology and cognitive deficits in Alzheimers disease models." Nat Commun. 13(1):1121 . Application: IF. Species: Mouse. Fan X et al. (2022) "Inhibiting Sphingosine 1-Phosphate Receptor Subtype 3 Attenuates Brain Damage During Ischemia-Reperfusion Injury by Regulating nNOS/NO and Oxidative Stress." Front Neurosci. 16:838621 . Application: IF. Species: Mouse. Yu S et al. (2022) "BMS-470539 Attenuates Oxidative Stress and Neuronal Apoptosis via MC1R/cAMP/PKA/Nurr1 Signaling Pathway in a Neonatal Hypoxic-Ischemic Rat Model." Oxid Med Cell Longev. 2022:4054938 . Application: IF. Species: Rat. Kim EC et al. (2021) "Spontaneous seizure and memory loss in mice expressing an epileptic encephalopathy variant in the calmodulin-binding domain of Kv7.2." Proc Natl Acad Sci USA. 118(51):e2021265118 . Application: IF. Species: Mouse. Zhang Y et al. (2021) "GSK-3? inhibition elicits a neuroprotection by restoring lysosomal dysfunction in neurons via facilitation of TFEB nuclear translocation after ischemic stroke." Brain Res. [Epub ahead of print] . Application: IF. Species: Rat. Kondoh D et al. (2021) "Cotton rats (Sigmodon hispidus) with a high prevalence of hydrocephalus without clinical symptoms." Neuropathology. [Epub ahead of print] . Application: IF. Species: Rat. Iwasa K et al. (2021) "A peripheral lipid sensor GPR120 remotely contributes to suppression of PGD2-microglia-provoked neuroinflammation and neurodegeneration in the mouse hippocampus." J Neuroinflammation. 18(1):304 . Application: IF. Species: Mouse. Rodriguez-Masso SR et al. (2021) "The Bradykinin B2 Receptor Agonist (NG291) Causes Rapid Onset of Transient BloodBrain Barrier Disruption Without Evidence of Early Brain Injury." Front Neurosci. 15:791709 . Application: IF. Species: Rat. Li N et al. (2021) "Postcooling But Not Precooling Benefits Motor Recovery by Suppressing Cell Death after Surgical Spinal Cord Injury in Rats." World Neurosurg. [Epub ahead of print] . Application: IF. Species: Rat. Estrada H et al. (2021) "High-resolution fluorescence-guided transcranial ultrasound mapping in the live mouse brain. Sci Adv. 7(50):eabi5464 . Application: IF. Species: Mouse. Gu R et al. (2021) "Rh-CXCL-12 Attenuates Neuronal Pyroptosis after Subarachnoid Hemorrhage in Rats via Regulating the CXCR4/NLRP1 Pathway." Oxid Med Cell Longev. 2021:6966394 . Application: IF. Species: Rat. Huang L et al. (2021) "Docosahexaenoic acid reduces hypoglycemia-induced neuronal necroptosis via the peroxisome proliferator-activated receptor ?/nuclear factor-?B pathway." Brain Res. [Epub ahead of print] . Application: IF. Species: Mouse. Yaguchi A et al. (2021) "Efficient protein incorporation and release by a jigsaw-shaped self-assembling peptide hydrogel for injured brain regeneration." Nat Commun. 12(1):6623 . Application: IF. Species: Mouse. Liu Y et al. (2021) "Neuroprotection of minocycline by inhibition of extracellular matrix metalloproteinase inducer expression following intracerebral hemorrhage in mice." Neurosci Lett. [Epub ahead of print] . Application: IF. Species: Mouse. Lam V et al. (2021) "Synthesis of human amyloid restricted to liver results in an Alzheimer disease-like neurodegenerative phenotype." PLoS Biol. 19(9):e3001358 . Application: IF. Species: Mouse. Wu Z et al. (2021) "Melibiose Confers a Neuroprotection against Cerebral Ischemia/Reperfusion Injury by Ameliorating Autophagy Flux via Facilitation of TFEB Nuclear Translocation in Neurons." Life. 11(9), 948 . Application: IF. Species: Rat. Fang Y et al. (2021) "Pituitary adenylate cyclase-activating polypeptide attenuates mitochondria-mediated oxidative stress and neuronal apoptosis after subarachnoid hemorrhage in rats." Free Radic Biol Med. 174:236-248 . Application: IF. Species: Rat. Huan PS et al. (2021) "3,6'-Dithiopomalidomide Ameliorates Hippocampal Neurodegeneration, Microgliosis and Astrogliosis and Improves Cognitive Behaviors in Rats with a Moderate Traumatic Brain Injury." Int J Mol Sci. 22(15):8276 . Application: IF. Species: Mouse. Han M et al. (2021) "Localized Modification of Water Molecule Transport After Focused Ultrasound-Induced BloodBrain Barrier Disruption in Rat Brain." Front Neurosci. 15:685977 . Application: IF. Species: Rat. Gong Y et al. (2021) "Inhibition of the p?SPAK/p?NKCC1 signaling pathway protects the blood?brain barrier and reduces neuronal apoptosis in a rat model of surgical brain injury." Mol Med Rep. 24(4):717 . Application: IF. Species: Rat. Zhu L et al. (2021) "Neuroprotective effects of salidroside on ageing hippocampal neurons and naturally ageing mice via the PI3K/Akt/TERT pathway." Phytother Res. [Epub ahead of print] . Application: IF. Species: Mouse. Huang Y et al. (2021) "Kisspeptin-54 attenuates oxidative stress and neuronal apoptosis in early brain injury after subarachnoid hemorrhage in rats via GPR54/ARRB2/AKT/GSK3? signaling pathway." Free Radic Biol Med. 171:99-111 . Application: IF. Species: Rat. Gong Y et al. (2021) "Inhibition of the NKCC1/NF-?B Signaling Pathway Decreases Inflammation and Improves Brain Edema and Nerve Cell Apoptosis in an SBI Rat Model." Front Mol Neurosci. 14:641993 . Application: IF. Species: Rat. Caron NS et al. (2021) "Mutant Huntingtin Is Cleared from the Brain via Active Mechanisms in Huntington Disease." J Neurosci. 41(4):780-796 . Application: IF. Species: Human. Liu L et al. (2021) "A Novel Netrin-1-Derived Peptide Enhances Protection against Neuronal Death and Mitigates of Intracerebral Hemorrhage in Mice." Int J Mol Sci. 22(9):4829 . Application: IF. Species: Mouse. Zalewska K et al. (2021) "Corticosterone Administration Alters White Matter Tract Structure and Reduces Gliosis in the Sub-Acute Phase of Experimental Stroke." Int J Mol Sci. 22(13):6693 . Application: IF. Species: Mouse. Agrawal RR et al. (2021) "Neurometabolic Alterations After Traumatic Brain Injury: Links to Mitochondria-Associated ER Membranes and Alzheimers Disease." PhD Thesis . Application: IF. Species: Mouse. Zhou H et al. (2021) "AXL kinase-mediated astrocytic phagocytosis modulates outcomes of traumatic brain injury." J Neuroinflammation. 18(1):154 . Application: IF. Species: Mouse. Ousta A et al. (2021) "Microglial Activation and Neurological Outcomes in a Murine Model of Cardiac Arrest." Neurocrit Care. [Epub ahead of print] . Application: IF. Species: Mouse. Horinokita H et al. (2021) "Possible involvement of progranulin in the protective effect of elastase inhibitor on cerebral ischemic injuries of neuronal and glial cells." Mol Cell Neurosci. 113:103625 . Application: IF. Species: Human. Ho MH et al. (2021) "CCL5 via GPX1 activation protects hippocampal memory function after mild traumatic brain injury." Redox Biol. 46:102067 . Application: IF. Species: Mouse. Lian C et al. (2021) "Pentraxin 3 secreted by human adipose-derived stem cells promotes dopaminergic neuron repair in Parkinson's disease via the inhibition of apoptosis." FASEB J. 35(7):e21748 . Application: IF. Species: Mouse. Li Z et al. (2021) "The combination of deferoxamine and minocycline strengthens neuroprotective effect on acute intracerebral hemorrhage in rats." Neurol Res. [Epub ahead of print] . Application: IF. Species: Rat. Zhou K et al. (2021) "Dihydrolipoic acid enhances autophagy and alleviates neurological deficits after subarachnoid hemorrhage in rats." Exp Neurol. 342:113752 . Application: IF. Asuni GP et al. (2021) "Neuronal apoptosis induced by morphine withdrawal is mediated by the p75 neurotrophin receptor." J Neurochem. [Epub ahead of print] . Application: IF. Deng S et al. (2021) "Albumin Reduces Oxidative Stress and Neuronal Apoptosis via the ERK/Nrf2/HO-1 Pathway after Intracerebral Hemorrhage in Rats." Oxid. Med. Cell. Longev. 2021, Article ID 8891373 . Application: IF. Wu MY et al. (2021) "Possible mechanisms of the PERK pathway on neuronal apoptosis in a rat model of surgical brain injury." Am J Transl Res. 13(2):732-742 . Application: IF. Cai G et al. (2021) "Mesenchymal stem cell-derived exosome miR-542-3p suppresses inflammation and prevents cerebral infarction." Stem Cell Res Ther. 12(1)2 . Application: IF. Xu W et al. (2021) "Melanocortin 1 receptor attenuates early brain injury following subarachnoid hemorrhage by controlling mitochondrial metabolism via AMPK/SIRT1/PGC-1_ pathway in rats." Theranostics. 11(2):522-39 . Application: IF. Wu M et al. (2020) "The Blood Component Iron Causes Neuronal Apoptosis Following Intracerebral Hemorrhage via the PERK Pathway." Front. Neurol. 11:588548 . Application: IF. Wu D et al. (2020) "Activated WNK3 induced by intracerebral hemorrhage deteriorates brain injury maybe via WNK3/SPAK/NKCC1 pathway." Exp Neuro. 332:113386 . Application: IF. Fang Y et al. (2020) "HIF-1_ Mediates TRAIL-Induced Neuronal Apoptosis via Regulating DcR1 Expression Following Traumatic Brain Injury." Front Cell Neurosci. 14:192 . Application: IF. Lin CT et al. (2020) "3,6 -dithiopomalidomide reduces neural loss, inflammation, behavioral deficits in brain injury and microglial activation." Elife. 9:e54726 . Application: IF. Wu H et al. (2020) "Upregulated Nmnat2 causes neuronal death and increases seizure susceptibility in temporal lobe epilepsy." Brain Res Bull. [Epub ahead of print] . Application: IF. Zahedi K et al. (2020) "Ablation of polyamine catabolic enzymes provokes Purkinje cell damage, neuroinflammation, and severe ataxia." J Neuroinflammation. 17(1):301 . Application: IF. Hu X et al. (2020) "Rh-CSF1 Attenuates Oxidative Stress and Neuronal Apoptosis via the CSF1R/PLCG2/PKA/UCP2 Signaling Pathway in a Rat Model of Neonatal HIE." Oxid Med Cell Longev. 2020:6801587 . Application: IF. Hu H et al. (2020) "Transient receptor potential melastatin 2 contributes to neuroinflammation and negatively regulates cognitive outcomes in a pilocarpine-induced mouse model of epilepsy." Int Immunopharmacol. 87:106824 . Application: IF. Wang S et al. (2020) "Aging exacerbates impairments of cerebral blood flow autoregulation and cognition in diabetic rats." Geroscience. [Epub ahead of print] . Application: IF. Chen PY et al. (2020) "Stearic Acid Methyl Ester Affords Neuroprotection and Improves Functional Outcomes after Cardiac Arrest." Prostag Leukotr Ess. [In Press] . Application: IF. Gamdzyk M et al. (2020) "cGAS/STING Pathway Activation Contributes to Delayed Neurodegeneration in Neonatal Hypoxia-Ischemia Rat Model: Possible Involvement of LINE-1." Mol Neurobiol. 57(6): 2600-19 . Application: IF. Species: Rat Tang H et al. (2020) "Delayed Recanalization After MCAO Ameliorates Ischemic Stroke by Inhibiting Apoptosis via HGF/c-met/STAT3/Bcl-2 Pathway in Rats." Exp Neurol. [Epub ahead of print] . Application: IF. Species: Rat Ocak U et al. (2020) "Inhibition of mast cell tryptase attenuates neuroinflammation via PAR-2/p38/NF?B pathway following asphyxial cardiac arrest in rats." J Neuroinflammation. 17(1):144 . Application: IF. Species: Rat Huang J et al. (2020) "IRE1? inhibition attenuates neuronal pyroptosis via miR-125/NLRP1 pathway in a neonatal hypoxic-ischemic encephalopathy rat model." J Neuroinflammation. 17(1):152 . Application: IF. Species: Rat Fouda MA et al. (2020) "Estrogen-dependent hypersensitivity to diabetes-evoked cardiac autonomic dysregulation: Role of hypothalamic neuroinflammation." Life Sci. 2020 Mar 31:117598. [Epub ahead of print] . Application: IF. Species: Rat Zhou Z et al. (2020) "Sodium butyrate attenuated neuronal apoptosis via GPR41/G??/PI3K/Akt pathway after MCAO in rats." J Cerebr Blood F Met. [Epub ahead of print]. Application: IF. Species: Rat Enam SF et al. (2020) "Engineering Cytokine and Macrophage Enrichment at Sites of Injury." PhD Thesis . Application: IF. Species: Mouse
Specificity:
Degenerating neurons, and neuronal degeneration. There is no specific staining in normal healthy brain. Note: Some researchers under some conditions report blood vessel staining with Fluoro Jade. This may be because Fluoro Jade is an analogue of eosin (which stains blood cells). In general, good perfusion and preparation of the tissue should help prevent blood vessel staining but it may not be possible to eliminate it entirely. In our experience it is generally possible to distinguish neuronal from blood vessels staining by eye.
Storage:
The unopened kit can be stored for up to 6 months at 2-8ºC after the date of receipt. The kit and components should be stored protected from light. Diluted FJC dye solutions are not stable and should be used within 4 hours of making. The other diluted solutions can be reused and stored for up to 48 hours if refrigerated and protected from light. Best results require freshly diluted solutions. We recommend using aseptic techniques when handling the reagents to avoid bacterial growth and contamination.<br><br>The FJC Ready to dilute kit is shipped ambient and stable at room temperature during transport. Refrigerate upon arrival, do not freeze.
The causes and effects of neuronal degeneration are of major interest to a wide variety of neuroscientists. Paralleling this growing interest is an increasing number of methods applicable to the detection of neuronal degeneration. The fluorescent dye Fluoro-Jade B (FJB), like its more purified brother Fluoro-Jade C (FJC), is an anionic fluorescein derivative useful for the histological staining of neurons undergoing degeneration. Fluoro-Jade B differs from FJC in that it is a slightly less refined chemical formulation and thus it does not quite provide the same level of signal to noise or high resolution as FJC. Nonetheless FJB is still widely used and works very well as a marker of degenerating neurons and even glia (see Damjanac M et al., Brain Res. 2007;1128(1):40-9). FJB operates nearly identically in protocol to that of FJC, and Fluoro-Jade B is compatible with several other labeling procedures including immunofluorescent and fluorescent Nissl techniques. Fluoro-Jade B stains all degenerating neurons regardless of specific insult or mechanism of cell death. Fluoro-Jade B exhibits the greatest signal to background ratio, as well as the highest resolution. This translates to a stain of maximal contrast and affinity for degenerating neurons. This makes it ideal for localising not only degenerating nerve cell bodies but also distal dendrites, axons and terminals. The dye is highly resistant to fading and is compatible with virtually all histological processing and staining protocols. Note: This product is equivalent to discontinued product AG310 from Merck-Millipore.
Product Type:
Staining Reagent
Format:
Dry, Coffee brown to brick red powder; hygroscopic powder keep dessicated.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
FC,ICC
Application Details:
Following our detailed protocol, Fluoro-Jade C labels degenerating neurons which are visualised with blue light excitation, while DAPI (not included) counter stains cell nuclei, visualised with ultra-violet illumination. The Fluoro-Jade C dye can be used on all kinds of preserved tissues, including fresh-frozen, paraformaldehyde or formalin fixed, and formalin fixed, paraffin-embedded tissues.
Alternative Names:
FJB, Fluoro-Jade
Biosensis Brand:
Biosensis®
Detection Method:
Fluorescence
Excitation/Emission:
FJB visualization is accomplished using blue light or a 488 nm Laser. <br>Excitation Peak: 495 nm<br>Emission Peak: 521 nm<br>Filter system for visualizing: Fluorescein/FITC
Shelf Life:
6 months after date of receipt (unopened vial).
Use:
For research use only.
Kit Components:
Materials Provided: 30 mg Fluoro-Jade B, dry powder Detailed protocol Equipment and Reagents Required: Distilled water ACS grade Ethanol (200 proof) for slide & solution preparation 1% sodium hydroxide in 80% ethanol (basic alcohol solution) 0.1% Acetic Acid solution (in water) 70% ethanol in distilled water 0.06% (KMnO4) potassium permanganate solution DAPI powder or 100X solution (working range is 0.5-5 µg/mL) Xylene liquid Staining dishes/Coplin jars Cover slips DPX mounting media or another permanent mounting medium. Non-polar media are preferred over aqueous mounting media such as glycerin/water to obtain high- contrast images (refer to Appendix B in the protocol for a comparative analysis). Traditional fluorescent mounting mediums are not recommended because of their high pH. Slide warmer Convection oven
Product references:
Ikeda A et al. (2022) "Alteration of the neuronal and glial cell profiles in Neu1-deficient zebrafish" Glycoconj ; [Epub ahead of print]; Application: ICC/FC Species: Zebrafish
Choi I et al. (2022) "Interleukin-17A Mediates Hippocampal Damage and Aberrant Neurogenesis Contributing to Epilepsy-Associated Anxiety" Front. Mol. Neurosci. ; [Epub ahead of print]; Application: ICC/FC Species: Mouse
Cui Y et al. (2022) "Modified Citrus Pectin Alleviates Cerebral Ischemia/Reperfusion Injury by Inhibiting NLRP Inflammasome Activation via TLR4/NF-?B Signaling Pathway in Microglia" J Inflamm. Res. ; 15: 3369-3385; Application: ICC/FC Species: Mouse
Specificity:
Degenerating neurons, and neuronal degeneration. There is no specific staining in normal healthy brain. Note: Some researchers under some conditions report blood vessel staining with Fluoro Jade. This may be because Fluoro Jade is an analogue of eosin (which stains blood cells). In general, good perfusion and preparation of the tissue should help prevent blood vessel staining but it may not be possible to eliminate it entirely. In our experience it is generally possible to distinguish neuronal from blood vessels staining by eye.
Storage:
The powdered dye can be stored desiccated at room temperature in the dark. Storage in a desiccator is recommended as FJB is hydroscopic. The 0.01% stock solution will remain stable for 3 months when stored in a refrigerator, in the dark. The 0.0001-0.0004% working solution in 0.1% acetic acid should be used within 4 hours of preparation. Diluted FJB dye solutions are not stable and should not be stored. The other diluted solutions can be reused and stored for up to 48 hours if refrigerated and protected from light. Best results require freshly diluted solutions.
Purification:
Thin layer chromatograpy using cellulose plates and a solvent system of n-propinol, water, and ammonium hydroxide (6:5:2) revealed the presence of two fluorescent isomers and two trace non-fluorescent bands. No amount of fluorescein or Fluoro-Jade was present.
The causes and effects of neuronal degeneration are of major interest to a wide variety of neuroscientists. Paralleling this growing interest is an increasing number of methods applicable to the detection of neuronal degeneration. Fluoro-Jade C stains all degenerating neurons regardless of specific insult or mechanism of cell death. Fluoro-Jade C exhibits the greatest signal to background ratio, as well as the highest resolution. This translates to a stain of maximal contrast and affinity for degenerating neurons. This makes it ideal for localising not only degenerating nerve cell bodies but also distal dendrites, axons and terminals. The dye is highly resistant to fading and is compatible with virtually all histological processing and staining protocols. Note: This product is equivalent to discontinued product AG325 from Merck-Millipore.
Product Type:
Staining Reagent
Format:
Dry, Coffee brown to brick red powder; hygroscopic powder keep dessicated.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
FC,ICC
Application Details:
Following our detailed protocol, Fluoro-Jade B labels degenerating neurons which are visualised with blue light excitation, while DAPI (not included) counter stains cell nuclei, visualised with ultra-violet illumination. The Fluoro-Jade C dye can be used on all kinds of preserved tissues, including fresh-frozen, paraformaldehyde or formalin fixed, and formalin fixed, paraffin-embedded tissues.
Alternative Names:
FJC, Fluoro-Jade
Biosensis Brand:
Biosensis®
Detection Method:
Fluorescence
Excitation/Emission:
FJC visualization is accomplished using blue light or a 488 nm Laser. <br>Excitation Peak: 495 nm<br>Emission Peak: 521 nm<br>Filter system for visualizing: Fluorescein/FITC
Shelf Life:
6 months after date of receipt (unopened vial).
Use:
For research use only.
Kit Components:
Materials Provided: 30 mg Fluoro-Jade C, dry powder Detailed protocol Equipment and Reagents Required: Distilled water ACS grade Ethanol (200 proof) for slide & solution preparation 1% sodium hydroxide in 80% ethanol (basic alcohol solution) 0.1% Acetic Acid solution (in water) 70% ethanol in distilled water 0.06% (KMnO4) potassium permanganate solution DAPI powder or 100X solution (working range is 0.5-5 µg/mL) Xylene liquid Staining dishes/Coplin jars Cover slips DPX mounting media or another permanent mounting medium. Non-polar media are preferred over aqueous mounting media such as glycerin/water to obtain high- contrast images (refer to Appendix B in the protocol for a comparative analysis). Traditional fluorescent mounting mediums are not recommended because of their high pH. Slide warmer Convection oven
Specificity:
Degenerating neurons, and neuronal degeneration. There is no specific staining in normal healthy brain. Note: Some researchers under some conditions report blood vessel staining with Fluoro Jade. This may be because Fluoro Jade is an analogue of eosin (which stains blood cells). In general, good perfusion and preparation of the tissue should help prevent blood vessel staining but it may not be possible to eliminate it entirely. In our experience it is generally possible to distinguish neuronal from blood vessels staining by eye.
Storage:
The powdered dye can be stored desiccated at room temperature in the dark. Storage in a desiccator is recommended as FJB is hydroscopic. The 0.01% stock solution will remain stable for 3 months when stored in a refrigerator, in the dark. The 0.0001-0.0004% working solution in 0.1% acetic acid should be used within 4 hours of preparation. Diluted FJB dye solutions are not stable and should not be stored. The other diluted solutions can be reused and stored for up to 48 hours if refrigerated and protected from light. Best results require freshly diluted solutions.
Purification:
Silica TLC (acetanitrile/water, 6/4) revealed the presence of 2 fluorescent spots, presumably corresponding to the mono and di sulphate homologues. The presence of precursors or free fluorescein was not detected.
Amylo-Glo RTD Ready to Dilute Staining reagent is designed to stain amyloid plaques in tissue sections. This novel marker has several advantages over other conventional markers such as Thioflavin S and Congo Red because of its unique chemical and spectral properties. (L. Schmued et al. (2012) J.Neuroscience Methods 209:120- 126). Using Amylo-Glo results in a very bright blue UV excitable stain under physiological conditions that will not bleed through when illuminated with other filters. Its brightness makes it ideal for low magnification quantification studies, while its unique excitation/emission profile and mild staining conditions makes it ideal for combination for multiple immunofluorescent labeling studies. Amylo-Glo RTD is compatible with fresh, frozen, and formalin-fixed immunohistochemistry or cytochemistry, and it is particularly good for confocal and multiple labeling because of its high fluorescent intensity and high resistance to photo-bleaching. Moreover because Amylo-Glo fluoresces in the UV channel, double and triple labeling experiments can be performed very easily (see protocol).
Product Type:
Staining Reagent
Format:
The reagents in the Amyloid Plaque Stain Reagent (100x) are all supplied in a liquid format and are ready-to-dilute.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Application Details:
Staining of amyloid plaques in human and animal tissues, see included protocol
Alternative Names:
AmyloGlo
Biosensis Brand:
Biosensis® RTD
Detection Method:
Fluorescence
Excitation/Emission:
Excitation Peak: 334 nm; Emission Peak: 533 nm - unbound, 438 nm when bound to amyloid. To visualize Amylo-glo in tissue, UV light is required. For example, Amylo-Glo tissue can be examined using an epifluoresent microscope with UV (Nikon UV-2A) filter cube. Excitation (325-375 nm) Emission (400-450 nm) is typical. Also note, it is not uncommon for Amylo-Glo to appear light yellow when examined by eye, yet appear a light blue color when photographed.
Shelf Life:
6 months after date of receipt (unopened vial).
Use:
For research use only.
Kit Components:
5 mL of 100X Amylo-Glo RTD (A-G RTD) solution
Product references:
Silvin A et al. (2022) "Dual ontogeny of disease-associated microglia and disease inflammatory macrophages in aging and neurodegeneration" Immunity. [Epub ahead of print]; Application: IHC/IF Species: Mouse Shrader JM et al. (2022) "Distinct Brain Proteomic Signatures in Cerebral Small Vessel Disease Rat Models of Hypertension and Cerebral Amyloid Angiopathy" J Neuropathol Exp Neurol. [Epub ahead of print]; Application: IHC/IF Species: Rat Zagorski K et al. (2022) "Immunogenicity of MultiTEP-Platform-Based Recombinant Protein Vaccine, PV-1950R, Targeting Three B-Cell Antigenic Determinants of Pathological ?-Synuclein" Int J Mol Sci. [Epub ahead of print]; Application: IHC/IF Species: Mouse Shabestari SK et al. (2022) "Absence of microglia promotes diverse pathologies and early lethality in Alzheimers disease mice" Cell Rep. 39(11):110961; Application: IHC/IF Species: Mouse Davis J et al. (2022) "rTg-D: A novel transgenic rat model of cerebral amyloid angiopathy Type-2." Cerebral Circulation - Cognition and Behavior [Epub ahead of print]; Application: IHC/IF Species: Rat Salvadores N et al. (2022) "A? oligomers trigger necroptosis-mediated neurodegeneration via microglia activation in Alzheimer's disease." Acta Neuropathol Commun. 10(1):31; Application: IHC/IF Species: Human Javonillo DI et al. (2022) "Systematic Phenotyping and Characterization of the 3xTg-AD Mouse Model of Alzheimer's Disease." Front Neurosci. 15:785276; Application: IHC/IF Species: Mouse Hohsfield LA et al. (2022) "MAC2 is a long-lasting marker of peripheral cell infiltrates into the mouse CNS after bone marrow transplantation and coronavirus infection." Glia. [Epub ahead of print]; Application: IHC/IF Species: Mouse Tsay HJ et al. (2021) "EK100 and Antrodin C Improve Brain Amyloid Pathology in APP/PS1 Transgenic Mice by Promoting Microglial and Perivascular Clearance Pathways." Int J Mol Sci. 22(19):10413; Application: IHC/IF Species: Mouse Henningfield CM et al. (2021) "Microglia-specific ApoE knock-out does not alter Alzheimer's disease plaque pathogenesis or gene expression." Glia. [Epub ahead of print]; Application: IHC/IF Species: Mouse Da Mesquita S et al. (2021) "Meningeal lymphatics affect microglia responses and anti-A? immunotherapy." Nature. 593(7858):255-260; Application: IHC/IF Species: Mouse Lauterborn JC et al. (2021) "Increased excitatory to inhibitory synaptic ratio in parietal cortex samples from individuals with Alzheimer's disease. Nat Commun. 12(1):2603; Application: IHC/IF Species: Human Kim JH et al. (2021) "Gamma subunit of complement component 8 is a neuroinflammation inhibitor." Brain. 144(2):528-552; Application: IHC/IF Species: Mouse Claes C et al. (2021) "Plaque-associated human microglia accumulate lipid droplets in a chimeric model of Alzheimer's disease." Mol Neurodegener. 16(1):50; Application: IHC/IF Species: Mouse Crapser JD. (2021) "Investigating microglial regulation of the extracellular matrix in health and neurodegenerative disease." PhD Thesis ; Application: IHC/IF Species: Human Baglietto-Vargas D et al. (2021) "Generation of a humanized A? expressing mouse demonstrating aspects of Alzheimer's disease-like pathology." Nature Communications. 2(1):2421; Application: IHC/IF Species: Mouse Mistrik M et al. (2021) "Microthermal-induced subcellular-targeted protein damage in cells on plasmonic nanosilver-modified surfaces evokes a two-phase HSP-p97/VCP response." Nature Communications. 12, Article Number 719; Application: ICC/IF Species: Human Lemoine L et al. (2020) "Regional binding of tau and amyloid PET tracers in Down syndrome autopsy brain tissue." Mol Neurodegener. 15(1):68; Application: IHC/IF Species: Human Hascup KN et al. (2020) "Riluzole attenuates glutamatergic tone and cognitive decline in A?PP/PS1 mice." J Neurochem. [Epub ahead of print]; Application: IHC/IF Species: Mouse Holloway OG et al. (2020) "Microglia Demonstrate Local Mixed Inflammation and a Defined Morphological Shift in an APP/PS1 Mouse Model. J Alzheimers Dis. 77(4):1765-81; Application: IHC/IF Species: Mouse McQuade A et al. (2020) "Gene expression and functional deficits underlie TREM2-knockout microglia responses in human models of Alzheimer s disease. Nat Commun. 11(1):5370; Application: IHC/IF Species: Mouse Hascup KN et al. (2020) "Hippocampal alterations in glutamatergic signaling during amyloid progression in A?PP/PS1 mice." Sci Rep. 10(1):14503; Application: IHC/IF Species: Mouse Crapser JD et al. (2020) "Microglia facilitate loss of perineuronal nets in the Alzheimer's disease brain." EBioMedicine. 58:102919; Application: IHC/IF Species: Mouse Abe Y et al. (2020) "Behavioral and electrophysiological evidence for a neuroprotective role of aquaporin-4 in the 5xFAD transgenic mice model." Acta Neuropathol Commun. 8(1):67; Application: IHC/IF Species: Mouse Zhu X et al. (2020) "Robust neuroinflammation and perivascular pathology in rTg-DI rats, a novel model of microvascular cerebral amyloid angiopathy." J Neuroinflammation. 17(1):78; Application: IHC/IF Species: Rat Majewski L et al. (2020) "Transgenic Mice Overexpressing Human STIM2 and ORAI1 in Neurons Exhibit Changes in Behavior and Calcium Homeostasis but Show No Signs of Neurodegeneration." Int J Mol Sci. 21(3); Application: IHC/IF Species: Mouse Davtyan H et al. (2019) "Testing a MultiTEP-based combination vaccine to reduce A? and tau pathology in Tau22/5xFAD bigenic mice." Alzheimers Res Ther. 11(1):107; Application: IHC/IF Species: Mouse Yeh SHH et al. (2019) "A high-sucrose diet aggravates Alzheimer's disease pathology, attenuates hypothalamic leptin signaling, and impairs food-anticipatory activity in APPswe/PS1dE9 mice." Neurbiol. Aging. [In press]; Application: IHC/IF Species: Mouse Bharani KL et al. (2019) "Serum Pro-Bdnf Levels Correlate With Phospho-Tau Staining In Alzheimer's Disease." Neurbiol. Aging. [In press]; Application: IHC/IF Species: Human Hovakimyan A et al. (2019) "A MultiTEP platform-based epitope vaccine targeting the phosphatase activating domain (PAD) of tau: therapeutic efficacy in PS19 mice." Sci Rep. 9(1):15455; Application: IHC/IF Species: Human Hasselmann J et al. (2019) "Development of a Chimeric Model to Study and Manipulate Human Microglia In Vivo." Neuron. [Epub ahead of print]; Application: IHC/IF Species: Mouse Spangenberg E et al. (2019) "Sustained microglial depletion with CSF1R inhibitor impairs parenchymal plaque development in an Alzheimer's disease model." Nat Commun. 10(1):3758 (Supplementary Figure 1); Application: IHC/IF Species: Human Eggers C et al. (2019) "Novel cannabis flavonoid, cannflavin A displays both a hormetic and neuroprotective profile against amyloid _-mediated neurotoxicity in PC12 cells: comparison with geranylated flavonoids, mimulone and diplacone." Biochem Pharmacol. [Epub ahead of print]; Application: IHC/IF Species: Rat Dominguez E (2019) "Microglial Contributions to Alzheimer's Disease Pathogenesis." PhD Thesis, UC Irvine. Application: IHC/IF Species: Mouse Jovic M et al. (2019) "Short-term fish oil supplementation applied in presymptomatic stage of Alzheimer's disease enhances microglial/macrophage barrier and prevents neuritic dystrophy in parietal cortex of 5xFAD mouse model." PLoS One. 14(5):e0216726; Application: IHC/IF Species: Mouse Collins MJ et al. (2019) "Age moderates the effects of traumatic brain injury on beta-amyloid plaque load in APP/PS1 mice." J Neurotrauma. [Epub ahead of print]; Application: IHC/IF Species: Mouse Shukla AK et al. (2018) "CD11a expression distinguishes infiltrating myeloid cells from plaque-associated microglia in Alzheimer's disease." Glia. [Epub ahead of print]; Application: IHC/IF Species: Mouse Feng X et al. (2018) "Quantitative proteomics reveals distinct composition of amyloid plaques in Alzheimer's disease." Alzheimers Dement. [In press]; Application: IHC/IF Species: Human, mouse Davis J et al. (2018) "A Novel Transgenic Rat Model of Robust Cerebral Microvascular Amyloid with Prominent Vasculopathy." Am J Pathol. [Epub ahead of print]; Application: IHC/IF Species: Rat Palombo F et al. (2017) "Detection of A? plaque-associated astrogliosis in Alzheimer's disease brain by spectroscopic imaging and immunohistochemistry." Analyst. [Epub ahead of print]; Application: IF Species: Mouse Abud EM (2017) "Generation of Human Microglia from Induced Pluripotent Stem Cells to Study Innate Immunity in Neurological Diseases." PhD Thesis. 2017; Application: IF Species: Mouse Abud EM et al. (2017) "iPSC-Derived Human Microglia-like Cells to Study Neurological Diseases." Neuron. 2017; 49(2):278-93 Application: IF Species: Mouse Solomon IH et al. (2017) "Brain and liver pathology, amyloid deposition, and interferon responses among older HIV-positive patients in the late HAART era." BMC Infect Dis. 2017; 17(1):151 Application: IF Species: Human Xu F et al. (2016) "Cerebral vascular amyloid seeds drive amyloid _-protein fibril assembly with a distinct anti-parallel structure." Nat Commun. 2016; 7:13527. Application: IF Species: Mouse Katsouri L et al. (2016) "PPARγ-coactivator-1_ gene transfer reduces neuronal loss and amyloid-_ generation by reducing _-secretase in an Alzheimer's disease model ." Proc Natl Acad Sci USA. 2016; 113(43):12292-97. Application: IF Species: Mouse Esposito G et al. (2016) "Autologous transplantation of intestine-isolated glia cells improves neuropathology and restores cognitive deficits in _ amyloid-induced neurodegeneration." Sci Rep. 2016; 6: 22605. Application: IF Species: Rat Marsh SE et al. (2016) "The adaptive immune system restrains Alzheimer's disease pathogenesis by modulating microglial function." Proc Natl Sci USA. Feb 16. pii: 201525466. Application: IF Species: Hu Fibrillar amyloid visualization. Kim YH et al. (2015) "A 3D human neural cell culture system for modeling Alzheimer's disease." Nat Protoc. Jul;10(7):985-1006. Application: IF Species: Hu , Human neural stem-cell-derived three-dimensional (3D) culture system. Nijholt DA et al. (2015) "Pregnancy Zone Protein is Increased in the Alzheimer's Disease Brain and Associates with Senile Plaques." J Alzheimer's Disease. 46(1):227-38. Application: IF Species: Hu Kamphuis W et al. (2015) "GFAP and vimentin deficiency alters gene expression in astrocytes and microglia in wild-type mice and changes the transcriptional response of reactive glia in mouse model for Alzheimer's disease." Glia. Jun;63(6):1036-56. Application: IF Species: Mouse Choi SH et al. (2014) "A three-dimensional human neural cell culture model of Alzheimer's disease." Nature Oct 12. doi: 10.1038/nature1380. Application: IF Species: Hu , Human neural stem-cell-derived three-dimensional (3D) culture system. Niedowicz DM et al. (2014). "Obesity and diabetes cause cognitive dysfunction in the absence of accelerated beta-amyloid deposition in a novel murine model of mixed or vascular dementia." Acta Neuropathol Commun. 2014 Jun 10;2:64.
Specificity:
Amyloid plaques both intraneuronal and vascular
Storage:
The stock solution can be stored for up to 6 months after date of receipt at 2-8°C protected from light. No preservatives. Use sterile technique when handling and proper laboratory procedures.
Purification:
Thin layer chromatography using alumina plates and a solvent system of ethanol and water (3:1) revealed the presence of two fluorescent isomers. No amount of starting material was detected.
The Biosensis AG-400-AG kit utilizes an ethidium bromide counter stain for a quick and effective way to visualize cell nuclei and cell bodies of cells while under UV illumination allowing the assessment of amyloid plaques and cell/tissue positioning as well in one step. Amylo-Glo RTD Ready to Dilute Staining reagent is designed to stain amyloid plaques in tissue sections. This novel marker has several advantages over other conventional markers such as Thioflavin S and Congo Red because of its unique chemical and spectral properties. (L. Schmued et al. (2012) J.Neuroscience Methods 209:120- 126). Using Amylo-Glo results in a very bright blue UV excitable stain under physiological conditions that will not bleed through when illuminated with other filters. Its brightness makes it ideal for low magnification quantification studies, while its unique excitation/emission profile and mild staining conditions makes it ideal for combination for multiple immunofluorescent labeling studies. Amylo-Glo RTD is compatible with fresh, frozen, and formalin-fixed immunohistochemistry or cytochemistry, and it is particularly good for confocal and multiple labeling because of its high fluorescent intensity and high resistance to photo-bleaching. Moreover because Amylo-Glo fluoresces in the UV channel, double and triple labeling experiments can be performed very easily (see protocol).
Product Type:
Staining Reagent
Format:
The reagents in the Amyloid Plaque Stain Reagent (100x) are all supplied in a liquid format and are ready-to-dilute.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Application Details:
Staining of amyloid plaques in human and animal tissues, see included protocol. EtBr counter stain stains nuclei and cell bodies for easy identification and spacial orientation.
Alternative Names:
AmyloGlo
Biosensis Brand:
Biosensis® RTD
Detection Method:
Fluorescence
Excitation/Emission:
Excitation Peak: 334 nm; Emission Peak: 533 nm - unbound, 438 nm when bound to amyloid. To visualize Amylo-glo in tissue, UV light is required. For example, Amylo-Glo tissue can be examined using an epifluoresent microscope with UV (Nikon UV-2A) filter cube. Excitation (325-375 nm) Emission (400-450 nm) is typical. Also note, it is not uncommon for Amylo-Glo to appear light yellow when examined by eye, yet appear a light blue color when photographed. <br>Visualization of EtBr: Ethidium bromide has an excitation peak of 300 nm and an emission peak 595 nm. Most UV compatible filter sets can be used.
Shelf Life:
6 months after date of receipt (unopened vial).
Use:
For research use only.
Kit Components:
1 bottle containing 40 mL of 10X Amylo-Glo RTD (A-G RTD) solution 1 bottle containing 40 mL of 10X A-G RTD Ethidium Bromide (EtBr RTD) solution
Product references:
Su IJ et al. (2021) "The Beneficial Effects of Combining Anti-A? Antibody NP106 and Curcumin Analog TML-6 on the Treatment of Alzheimer's Disease in APP/PS1 Mice." Int J Mol Sci. 23(1):556; Application: IHC/IF Species: Mouse Emre C et al. (2020) "Receptors for pro-resolving mediators are increased in Alzheimer's disease brain." Brain Pathol. [Epub ahead of print]; Application: IHC/IF Species: Human Hascup KN et al. (2019) "LY379268 Does Not Have Long-Term Procognitive Effects nor Attenuate Glutamatergic Signaling in A?PP/PS1 Mice." J Alzheimers Dis. [Epub ahead of print]; Application: IHC/IF Species: Mouse Hascup ER et al. (2018) "Diet-Induced Insulin Resistance Elevates Hippocampal Glutamate as well as VGLUT1 and GFAP Expression in A?PP/PS1 Mice." J Neurochem. [Epub ahead of print]; Application: IHC/IF Species: Mouse
Specificity:
Amyloid plaques both intraneuronal and vascular for A-G, Etbr, nuclei and cell bodies both DNA and RNA label
Storage:
The stock solution can be stored for up to 6 months at 2-8°C protected from light. No preservatives. Use sterile technique when handling and proper laboratory procedures.
Purification:
Thin layer chromatography using alumina plates and a solvent system of ethanol and water (3:1) revealed the presence of two fluorescent isomers. No amount of starting material was detected.
HQ-O Ready-To-Dilute (RTD TM ) Stain Reagent is designed to label amyloid plaques in paraffin-embedded or freshly cut frozen tissue sections. As a fluorescent zinc chelator, HQ-O is unique as it takes advantage of the known presence of concentrated zinc in amyloid plaques. Studies with HQ-O revealed that fluorescent plaque-like structures are only seen when synthetic A?x-42 is aggregated in the presence of zinc. Under blue light excitation, plaque structures appear bright green fluorescent in the brain parenchyma, correlating closely with plaque structures observed following A? antibody staining. HQ-O RTD TM staining reagent is compatible with other fluorophores, such as DAPI, Hoechst and ethidium bromide, as well as fluorescent-labelled antibodies with emission spectra in the blue and/or red emission range of fluorescent microscopes. Due to its zinc-chelating characteristics, HQ-O RTD TM staining reagent may visualize globular structures within blood vessels and intravascular leucocytes. HQ-O RTD TM staining reagent has multiple advantages over older blue-light exciting stains such as Thioflavin S. Thioflavin S typically exhibits relatively low contrast and resolution and suffers from bleed-through when excited by wavelengths other than blue light. HQ-O RTD TM staining reagent suffers none of these setbacks and not only provides a higher contrast and longer lasting dye, but because it lacks excitation bleed-through, HQ-O can be readily adapted to multiple labelling studies very easily. To visualize the HQ-O tracer, it is recommended to use a filter cube designed for visualizing Fluorescein/FITC or a blue-light laser. Although it can be seen with both narrow and wide-band pass filters, there is no need to use a narrow band filter since the compound does not bleed through when excited with other filters. A recommended excitation range of a wide band filter is 447-503 nm, with a peak at 475.
Background Info:
A novel zinc chelator, HQ-O, was developed for localizing zinc within amyloid plaques. The histology involves incubating tissue sections in a dilute aqueous solution of HQ-O.
Detection and fluorescent-staining of amyloid plaques in paraffin-embedded or freshly cut frozen tissue sections, please see detailed protocol for specific use instructions.
Alternative Names:
HQ-O tracer
Biosensis Brand:
Biosensis® RTD
Detection Method:
Fluorescence
Excitation/Emission:
To visualize the HQ-O tracer, it is recommended to use a filter cube designed for visualizing Fluorescein/FITC or a blue-light laser. Although it can be seen with both narrow and wide-band pass filters, there is no need to use a narrow band filter since the compound does not bleed through when excited with other filters. A recommended excitation range of a wide band filter is 447 503 nm, with a peak at 475 nm.
Shelf Life:
6 months after date of receipt (10X stock solution)
Use:
For research use only.
Kit Components:
One bottle containing 40 mL of 10X HQ-O RTD TM solution This quantity will be sufficient for approximately 8 Coplin Jars or 2-4 staining dishes.
Specificity:
As a fluorescent zinc chelator, HQ-O is unique as it takes advantage of the known presence of concentrated zinc in amyloid plaques. Studies with HQ-O revealed that fluorescent plaque-like structures are only seen when synthetic A?x-42 is aggregated in the presence of zinc. Under blue light excitation, plaque structures appear bright green fluorescent in the brain parenchyma, correlating closely with plaque structures observed following A? antibody staining.
Storage:
Store 10X stock solution at 2-8°C protected from light, for up to 6 months. The diluted dye (1X) should be used within 24 hours.
Based on IEP, the Goat anti-Rabbit IgG immunopolymer antibody reacts with heavy (γ) chains on rabbit IgG, light chains on all rabbit immunoglobulins; the Goat anti-Mouse IgG immunopolymer antibody reacts with heavy (γ) chains on mouse IgG, light chains on
Cross Reactivity:
Based on IEP, no cross-reactivity is observed from Goat-anti-Rabbit IgG to non-immunoglobulin rabbit serum proteins, serum proteins from human, mouse or rat; no cross-reactivity is observed from Goat-anti-Mouse IgG to non-immunoglobulin mouse serum proteins, serum proteins from bovine, horse, human, pig or rabbit
Country Of Origin:
Goat serum was obtained from healthy animals of US origin and under the care of a registered veterinarian.
Disclaimer:
For in vitro Laboratory Use Only. Not for diagnostic or therapeutic use. Not for human or animal consumption. Suggested applications of our products are not recommendations to use our products in violation of any patent or as a license under any patent of ImmunoReagents, Inc. Product may not be resold or modified for resale without prior written approval of ImmunoReagents, Inc.
hMSCs from adipose tissue (hADSCs) hADSCs have been shown to differentiate in vitro or in vivo into adipocytes, chondrocytes, osteoblasts, myocytes, neurons, hepatocytes, and pancreatic islet cells. hADSCs are harvested from normal human adipose tissue from individual donors and are provided in a cryopreserved format. The cells are tested for their ability to differentiate in vitro into adipocytes, chondrocytes, and osteoblasts and for a verified marker expression profile that complies with ISCT recommendations, providing well characterized cells.
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
Mesenchymal stem cells, also known as marrow stromal cells, are defined as a self-renewing population of adherent, bone-marrow-derived multipotent progenitor cells with the capacity to differentiate into several mesenchymal cell lineages. Bone marrow-derived MSCs are multipotent adult stem cells with multilineage differentiation potential, including the ability to differentiate into bone (osteoblasts), tendon, cartilage (chondrocytes), fat (adipocytes), fibroblasts, endothelial cells, and smooth and cardiac muscle cells.
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
Human dermal fibroblasts (HDFs) are a potential source of somatic cells for genetic manipulation and tissue engineering. Confirmation of cytogenetic stability of these cells is an essential step for cell nuclear transfer and generation of a suitable and functional induced pluripotent stem cells line.
Dermal fibroblasts are the main cell type present in skin connective tissue (dermis). Fibroblasts interact with epidermal cells during hair development and in interfollicular skin. Moreover, they play an essential role during cutaneous wound healing and in bioengineering of skin. Hence, culture of primary fibroblast is gaining in importance. In addition, fibroblasts established from skin biopsies provide a powerful tool for investigating normal skin physiology or specific disease states.
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
The human endometrium is a highly dynamic tissue that undergoes approximately 400 menstrual cycles during a woman's lifetime. This level of tissue regeneration is comparable to other tissues with high cellular turnover, such as epidermis, gut epithelium, and bone marrow. hEnMSCs are obtained through an endometrial biopsy, from women during a minimally invasive biopsy procedure.
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
Human Gingival fibroblasts (HGFs) are a potential source of somatic cells for genetic manipulation and tissue tissue repair and regeneration.
Gingival fibroblasts are the major constituents of gingival tissue and play a key role in their maintenance. Human gingival fibroblasts (hGFs) are undifferentiated cells with multi-differentiation and self-renewal capacities. The stem cell-like properties of GFs are largely due to the subsets of pluripotent cells including gingiva-derived mesenchymal stem cells (GMSCs) and gingival multipotent progenitor cells (GMPCs)
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
hMSCs have emerged as a promising regenerative tool, owing mainly to their multi-differentiation potential and immunosuppressive capacity. MSCs of neonatal origins exhibit superior proliferation ability, lower immunogenicity, and are expected to show lower incorporated mutation. hMSCs are isolated from three neonatal tissues, namely amniotic membrane, Chorion Villi, and Decidua tissue of the human placenta from the same donor.
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
hMSCs have emerged as a promising regenerative tool, owing mainly to their multi-differentiation potential and immunosuppressive capacity. MSCs of neonatal origins exhibit superior proliferation ability, lower immunogenicity, and are expected to show lower incorporated mutation. hMSCs are isolated from three neonatal tissues, namely amniotic membrane, Chorion Villi, and Decidua tissue of the human placenta from the same donor.
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
hUCAs-MSCs are specifically taken from umbilical cord artery tissues. Differentiation studies have shown variation between the cord regions, meaning that for some studies MSCs from specific cord regions may be of interest. The harvesting procedure is non-invasive, with umbilical cords obtained from women with healthy pregnancies during caesarean deliveries at the end of gestation.
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
hUC-MSCs strongly express MSC surface markers similar to Bone Marrow Stem Cells. Under optimal growth conditions, Umbical Cord-Derived Mesenchymal Stem Cells have been shown to be multipotent, capable of differentiating down adipogenic, osteogenic and chondrogenic lineages. The harvesting procedure is non-invasive, with umbilical cords obtained from women with healthy pregnancies during caesarean deliveries at the end of gestation.
Email us for more details - tech@nktscientific.com.
Background Info:
Product Quality Control:
Rigid quality control testing is performed for each batch (both cell donors and cell cultures). Cultured cells are tested for cell identity, purity, potency, viability and suitability for the intended use.
Before cryopreservation cultured MSCs (P2-P3) are characterised by flow cytometry analysis for identity by a comprehensive panel of markers [CD73/CD90/CD105 (positive) and CD14/CD34/CD45/HLA-DR (negative)] as proposed by the ISCTMSC committee position statement, 2006.
A multilineage differentiation assay into adipogenic and osteogenic directions is performed for each MSCs batch expanded in vitro. In addition, all donors and cell cultures have been screened for the absence of the following infectious agents: HIV-1/2, HBV, HCV, HSV1, HSV2, CMV, EBV, HHV6, Treponema pallidum, Toxoplasmagondii, Chlamydia trachomatis, Ureaplasma urealyticum, Ureaplasma parvum and microbial contaminants (bacteria & fungi,Mycoplasma hominis and Mycoplasma genitalium).
MSC cultures genetic stability is verified by karyotype evaluation (GTG banding).
X
We use cookies to help personalise and improve your web experience.
By using our website you consent to our use of cookies, some of which may have already been set on your device.
View our Cookie Policy to learn more.
