Aflatoxins are naturally occurring mycotoxins that are produced by many species of Aspergillus. Aflatoxins are toxic and among the most carcinogenic substances known. Crops which are frequently affected by Asperiillus include cereals (maize, sorghum, pearl millet, rice, wheat), oilseeds (peanut, soybean, sunflower, cotton), spices (chile peppers, black pepper, coriander, turmeric, ginger), and tree nuts (almond, pistachio, walnut, coconut, brazil nut).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Aflatoxins are naturally occurring mycotoxins that are produced by many species of Aspergillus. Aflatoxins are toxic and among the most carcinogenic substances known. Crops which are frequently affected by Asperiillus include cereals (maize, sorghum, pearl millet, rice, wheat), oilseeds (peanut, soybean, sunflower, cotton), spices (chile peppers, black pepper, coriander, turmeric, ginger), and tree nuts (almond, pistachio, walnut, coconut, brazil nut).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Antibodies are in a format of total IgG purified on protein G
Application Details:
The optimal working dilution should be determined by the investigator
Purity:
Total IgG. Protein G purified in PBS pH 7.4.
Reconstitution:
For reconstitution add 0,5 ml of sterile water
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Indyk et al. (2019). Development and Application of an Optical Biosensor Immunoassay for Aflatoxin M1 in Bovine Milk. Food Anal. Methods (2019). https://doi.org/10.1007/s12161-019-01621-5. Mohamadi Sani et al. (2018). Aflatoxin M1 contamination and antibiotic residue in milk in Khorasan province, Iran. Food Chem Toxicol. 2010 Aug-Sep;48(8-9):2130-2. doi: 10.1016/j.fct.2010.05.015.
AGB1 belongs to a family of proteins involved in signal transduction. They are acting like molecular switches when transmitting signals from the outside to the inside of cells.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brasica sp., Cajanus cajan, Camelina sativa, Capsella rubella, Eutrema sp., Cicer arietinum, Gossypium sp., Medicago truncatula, Morus sp., Cajanus cajan, Pisum sativum, Sesamum indicum, Solanum sp., Tarenaya hassleriana, Theobroma cacao, Trifolium subterraneum Species of your interest not listed? Contact us
AGO10 is involved in miRNA binding, and in RNA-mediated posttranscriptional gene silencing (PTGS).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
A. lyrata, B. napus, C. rubella, C. clementina, C. sinensis, E. salsugineum, G. arboreum, G. raimondii. N. benthamianaSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated synthetic peptide derived from Arabidopsis thaliana AGO10 protein sequence, Uniprot: Q9XGW1, TAIR: AT5G43810
AGO expression may be cell/tissue specific and using floral tissue is recommended where most of the AGOs are expressed the highest. Seedlings can be used as a negative control. Use of proteasome inhibitors as MG132 can help to stabilize AGO proteins during extraction procedure.
Application Details:
1 : 10 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
110,9 kDa
Not reactive in:
Zea mays
Selected references:
Sun et al. (2021) The epigenetic factor FVE orchestrates cytoplasmic SGS3-DRB4-DCL4 activities to promote transgene silencing in Arabidopsis. Sci Adv. 2021 Aug 4;7(32):eabf3898. doi: 10.1126/sciadv.abf3898. PMID: 34348894; PMCID: PMC8336953.Oliver & Martinez. (2021) Accumulation dynamics of ARGONAUTE proteins during meiosis in Arabidopsis. Plant Reprod. 2021 Nov 23. doi: 10.1007/s00497-021-00434-z. Epub ahead of print. PMID: 34812935.Sprunck et al. (2019). Elucidating small RNA pathways in Arabidopsis thaliana egg cells.
AGO1 belongs to a group of argonaute proteins which are catalytic component of the RNA-incudes silencing complex (RISC). This protein complex is responsible for the gene silencing (RNAi).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
AGO expression may be tissue specific and using floral tissue is recommended where most of the AGOs are expressed the highest. Use of proteasome inhibitors as MG132 can help to stabilize AGO proteins during extraction procedure. Buffer for extraction of AGO proteins: Paudel et al. 2018. The AGO1 antibody is extremely specific to AGO1 and does not cross-react with other antibodies. The evidence is 1) the peptide to which it was raised is at the very N-terminus of the protein and is not present in other AGOs 2) aAGO1 does not cross react with the AGOs which are overexpressed (AGO2, AGO3, AGO4, AGO5, AGO6, AGO9) using a western blot.TCA acetone precipitation method
Meng et al. (2022) The novel activity of Argonautes in intron splicing: A transcriptome-wide survey in plants. J Plant Physiol. 2022 Jan 31;270:153632. doi: 10.1016/j.jplph.2022.153632. Epub ahead of print. PMID: 35114616.Cabezas-Fuster et al. (2022). Missplicing suppressor alleles of Arabidopsis PRE-MRNA PROCESSING FACTOR 8 increase splicing fidelity by reducing the use of novel splice sites. Nucleic Acids Res. 2022 Jun 10;50(10):5513-5527. doi: 10.1093/nar/gkac338. PMID: 35639749; PMCID: PMC9177961.Delenko et al. (2022) MicroRNA biogenesis and activity in plant cell dedifferentiation stimulated by cell wall removal. BMC Plant Biol. 2022 Jan 3;22(1):9. doi: 10.1186/s12870-021-03323-9. PMID: 34979922; PMCID: PMC8722089. (immunofluorescence)Oliver & Martinez. (2021) Accumulation dynamics of ARGONAUTE proteins during meiosis in Arabidopsis. Plant Reprod. 2021 Nov 23. doi: 10.1007/s00497-021-00434-z. Epub ahead of print. PMID: 34812935.Dalmadi et al. (2021) Controlled RISC loading efficiency of miR168 defined by miRNA duplex structure adjusts ARGONAUTE1 homeostasis. Nucleic Acids Res. 2021 Dec 16;49(22):12912-12928. doi: 10.1093/nar/gkab1138. PMID: 34850097; PMCID: PMC8682782.
Special application note:
Antibody binds microRNA and tasiRNAs, preference for 21nt miRNAs with 5'U.To detect AGO1 in Nicotiana benthamiana, please inquire.Recommended for detection of AGO1: extreme low femtogram range chemiluminescent detection reagent
AGO1 belongs to a group of argonaute proteins which are catalytic component of the RNA-incudes silencing complex (RISC). This protein complex is responsible for the gene silencing (RNAi).This antibody is directly conjugated to Alkaline Phosphatase (ALP).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
AGO expression may be tissue specific and using floral tissue is recommended where most of the AGOs are expressed the highest. Use of proteasome inhibitors as MG132 can help to stabilize AGO proteins during extraction procedure.The AGO1 antibody is extremely specific to AGO1 and does not cross-react with other antibodies. The evidence is 1) the peptide to which it was raised is at the very N-terminus of the protein and is not present in other AGOs 2) aAGO1 does not cross react with the AGOs which are overexpressed (AGO2, AGO3, AGO4, AGO5, AGO6, AGO9) using a western blot.TCA acetone precipitation method
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to ALP.
AGO1 belongs to a group of argonaute proteins which are catalytic component of the RNA-incudes silencing complex (RISC). This protein complex is responsible for the gene silencing (RNAi).This antibody is directly conjugated to Biotin.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Brassica pekinensis, Capsella rubella, Malus domestica, Pisum sativum, Ricinus communis, Vitis vinifera Species of your interest not listed? Contact us
Immunogen:
KLH-conugated N-terminal peptide of Arabidopsis thaliana AGO1 UniProt: O04379, TAIR:At1g48410.
AGO expression may be tissue specific and using floral tissue is recommended where most of the AGOs are expressed the highest. Use of proteasome inhibitors as MG132 can help to stabilize AGO proteins during extraction procedure.The AGO1 antibody is extremely specific to AGO1 and does not cross-react with other antibodies. The evidence is 1) the peptide to which it was raised is at the very N-terminus of the protein and is not present in other AGOs 2) aAGO1 does not cross react with the AGOs which are overexpressed (AGO2, AGO3, AGO4, AGO5, AGO6, AGO9) using a western blot.
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to biotin.
Molecular Weight:
116,4 | 130 kDa
Not reactive in:
Chlamydomonas reinhardtii
Special application note:
Antibody binds microRNA and tasiRNAs, preference for 21nt miRNAs with 5'U.TCA acetone total protein precipitation method
AGO1 belongs to a group of argonaute proteins which are catalytic component of the RNA-incudes silencing complex (RISC). This protein complex is responsible for the gene silencing (RNAi).This antibody is directly conjugated to Horseradish Peroxidase (HRP).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid
Storage Temp:
Store at 4°Cfor 12-18 months. A preservative may be added for long time storage up to 2 years.
AGO expression may be tissue specific and using floral tissue is recommended where most of the AGOs are expressed the highest. Use of proteasome inhibitors as MG132 can help to stabilize AGO proteins during extraction procedure.The AGO1 antibody is extremely specific to AGO1 and does not cross-react with other antibodies. The evidence is 1) the peptide to which it was raised is at the very N-terminus of the protein and is not present in other AGOs 2) aAGO1 does not cross react with the AGOs which are overexpressed (AGO2, AGO3, AGO4, AGO5, AGO6, AGO9) using a western blot.
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4, conjugated to HRP.
This blocking peptide can be used as a control to neutralize AGO1 | argonaute 1 before immunolocalization or western blot. Furter details are provided below.AGO1 belongs to a group of argonaute proteins which are catalytic component of the RNA-incudes silencing complex (RISC). This protein complex is responsible for the gene silencing (RNAi).
Product Type:
Antibody
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Due to its low molecular weight, this peptide is not suitable for separation on a SDS gel,
Reconstitution:
For reconstitution please add sterile water
Molecular Weight:
1716,9 Da
Special application note:
Estimation of the ratio between antibodies and peptide : In neutralisation assay use 9,16 g of argonaute 1 peptide for 10 ml of reaction volume. In case of any questions please contact support@agrisera.com
AGO1 belongs to a group of argonaute proteins which are catalytic component of the RNA-incudes silencing complex (RISC). This protein complex is responsible for the gene silencing (RNAi).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
AGO1 belongs to a group of argonaute proteins which are catalytic component of the RNA-incudes silencing complex (RISC), This protein complex is responsible for the gene silencing (RNAi).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Nicotiana benthamiana
Expected Species:
Brassica pekinensis, Capsella rubella, Glycine max, Malus domestica, Pisum sativum, Ricinus communis, Solanum tuberosum, Zea mays, Vitis viniferaSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated, N-terminal peptide of Arabidopsis thaliana AGO1 O04379, At1g48410
AGO expression may be tissue specific and using floral tissue is recommended where most of the AGOs are expressed the highest. Use of proteasome inhibitors as MG132 can help to stabilize AGO proteins during extraction procedure. The AGO1 antibody is extremely specific to AGO1 and does not cross-react with other antibodies. The evidence is 1) the peptide to which it was raised is at the very N-terminus of the protein and is not present in other AGOs 2) aAGO1 does not cross react with the AGOs which are overexpressed (AGO2, AGO3, AGO4, AGO5, AGO6, AGO9) using a western blot.
Application Details:
To be determined by end user.
Purity:
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 488.
Molecular Weight:
116,4 | 130 kDa
Not reactive in:
Chlamydomonas reinhardtii
Selected references:
To be added when available. Antibody released in May 2023.
Special application note:
Antibody binds microRNA and tasiRNAs, preference for 21nt miRNAs with 5'U,TCA acetone total protein precipitation method.DyLight 488 Amax = 493 nm, Emax = 519 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
AGO1 belongs to a group of argonaute proteins which are catalytic component of the RNA-incudes silencing complex (RISC). This protein complex is responsible for the gene silencing (RNAi). This antibody is directly conjugated to Horseradish Peroxidase (HRP).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Nicotiana benthamiana
Expected Species:
Brassica pekinensis, Capsella rubella, Malus domestica, Pisum sativum, Ricinus communis, Vitis viniferaSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated, N-terminal peptide of Arabidopsis thaliana AGO1 O04379, At1g48410
AGO expression may be tissue specific and using floral tissue is recommended where most of the AGOs are expressed the highest. Use of proteasome inhibitors as MG132 can help to stabilize AGO proteins during extraction procedure. The AGO1 antibody is extremely specific to AGO1 and does not cross-react with other antibodies. The evidence is 1) the peptide to which it was raised is at the very N-terminus of the protein and is not present in other AGOs 2) aAGO1 does not cross react with the AGOs which are overexpressed (AGO2, AGO3, AGO4, AGO5, AGO6, AGO9) using a western blot.
Application Details:
To be determined by end user.
Purity:
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 594.
Molecular Weight:
116,4 | 130 kDa
Not reactive in:
Chlamydomonas reinhardtii
Selected references:
To be added when available. Antibody released in May 2023.
Special application note:
Antibody binds microRNA and tasiRNAs, preference for 21nt miRNAs with 5'U,TCA acetone total protein precipitation method.DyLight 594 has Amax = 593 nm, Emax = 618 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
AGO1 belongs to a group of argonaute proteins which are catalytic component of the RNA-incudes silencing complex (RISC), This protein complex is responsible for the gene silencing (RNAi),This antibody is directly conjugated to Horseradish Peroxidase (HRP).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS pH 7,4.
Storage Temp:
Store at 4°C for 12-18 months. A preservative may be added for long time storage up to 2 years. Store in provided dark tube and avoid direct light exposure. Shortly spin the tube before use.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana, Nicotiana benthamiana
Expected Species:
Brassica pekinensis, Capsella rubella, Glycine max, Malus domestica, Pisum sativum, Ricinus communis, Solanum tuberosum, Zea mays, Vitis viniferaSpecies of your interest not listed? Contact us
Immunogen:
KLH-conjugated, N-terminal peptide of Arabidopsis thaliana AGO1 O04379, At1g48410
AGO expression may be tissue specific and using floral tissue is recommended where most of the AGOs are expressed the highest. Use of proteasome inhibitors as MG132 can help to stabilize AGO proteins during extraction procedure. The AGO1 antibody is extremely specific to AGO1 and does not cross-react with other antibodies. The evidence is 1) the peptide to which it was raised is at the very N-terminus of the protein and is not present in other AGOs 2) aAGO1 does not cross react with the AGOs which are overexpressed (AGO2, AGO3, AGO4, AGO5, AGO6, AGO9) using a western blot.
Application Details:
To be determined by end user.
Purity:
Immunogen affinity purified serum, in PBS pH 7.4, conjugated to DyLight 650.
To be added when available. Antibody released in May 2023.
Special application note:
Antibody binds microRNA and tasiRNAs, preference for 21nt miRNAs with 5'U, TCA acetone total protein precipitation method.DyLight 650 has Amax = 652 nm, Emax = 672 nm. DyLight is a registered trademark of Thermofisher Inc., and its subsidiaries.
AGO1 belongs to a group of argonaute proteins which are catalytic component of the RNA-incudes silencing complex (RISC). This protein complex is responsible for the gene silencing (RNAi).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Immunogen:
KLH-conjugated peptide derived from AGO1-PAZ domain of Chlamydomonas reinhardtii Cre02.g141050.t1.1
AGO2 belongs to a group of argonaute proteins which are catalytic component of the RNA-incudes silencing complex (RISC). This protein complex is responsible for the gene silencing (RNAi). AGO2 is probably involved in antiviral RNA silencing.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Capsella rubella, Solanum tuberosumSpecies of your interest not listed? Contact us
AGO2 protein is strongly induced by stress. AGO expression may be tissue specific and using floral tissue is recommended where most of the AGOs are expressed the highest. Use of proteasome inhibitors as MG132 can help to stabilize AGO proteins during extraction procedure. Antibody incubation should be done over night in 4 C. Use of material with enriched AGO2 levels is recommened.
Clavel et al. (2021) Atypical molecular features of RNA silencing against the phloem-restricted polerovirus TuYV. Nucleic Acids Res. 2021 Nov 8;49(19):11274-11293. doi: 10.1093/nar/gkab802. PMID: 34614168; PMCID: PMC8565345.Oliver & Martinez. (2021) Accumulation dynamics of ARGONAUTE proteins during meiosis in Arabidopsis. Plant Reprod. 2021 Nov 23. doi: 10.1007/s00497-021-00434-z. Epub ahead of print. PMID: 34812935.Wang et al. (2019). The PROTEIN PHOSPHATASE4 Complex Promotes Transcription and Processing of Primary microRNAs in Arabidopsis. Plant Cell. 2019 Feb;31(2):486-501. doi: 10.1105/tpc.18.00556.Dalmadi et al. (2019). AGO-unbound cytosolic pool of mature miRNAs in plant cells reveals a novel regulatory step at AGO1 loading. Nucleic Acids Res. 2019 Aug 8. pii: gkz690. doi: 10.1093/nar/gkz690.You et al. (2019). FIERY1 promotes microRNA accumulation by suppressing rRNA-derived small interfering RNAs in Arabidopsis. Nat Commun. 2019 Sep 27;10(1):4424. doi: 10.1038/s41467-019-12379-z. (immunoprecipiation)
Argonaute 3(AGO3) of Chlamydmonas reinhardii is cytoplasmic enriched and associated with polysomes and miRNAs (Chung et al. 2019).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Chlamydomonas reinhardtii
Immunogen:
KLH-conjugated peptide derived from C-terminal of AGO3 protein of Chlamydomonas reinhardtii
Chung et al. (2019) Distinct roles of Argonaute in the green alga Chlamydomonas reveal evolutionary conserved mode of miRNA-mediated gene expression. Sci Rep. 2019 Jul 31;9(1):11091. doi: 10.1038/s41598-019-47415-x.
AGO4 (Argonaute 4) belongs to a group of argonaute proteins which are catalytic component of the RNA-incudes silencing complex (RISC). This protein complex is responsible for the gene silencing (RNAi).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur adhering to the cap or sides of the tube.
AGO expression may be tissue specific and using floral tissue is recommended where most of the AGOs are expressed the highest. Use of proteasome inhibitors as MG132 can help to stabilize AGO proteins during extraction procedure. Use a 6 % gel for protein separation, which is run longer to avoid a cross-reactivity at ca. 40 kDa.Binds endogenous siRNAs, preference for 24nt siRNAs with 5' A.Note that the AGO4 antibody reacts with the NEB prestained protein marker.
Application Details:
1 : 100 (ICC), 5 g of antibody per 1 gram of a fresh tissue (IP),1 : 2000-1 : 5000 (WB)
Clavel et al. (2021) Atypical molecular features of RNA silencing against the phloem-restricted polerovirus TuYV. Nucleic Acids Res. 2021 Nov 8;49(19):11274-11293. doi: 10.1093/nar/gkab802. PMID: 34614168; PMCID: PMC8565345.Oliver & Martinez. (2021) Accumulation dynamics of ARGONAUTE proteins during meiosis in Arabidopsis. Plant Reprod. 2021 Nov 23. doi: 10.1007/s00497-021-00434-z. Epub ahead of print. PMID: 34812935.Niedojad?o et al. (2020). Dynamic distribution of ARGONAUTE1 (AGO1) and ARGONAUTE4 (AGO4) in Hyacinthus orientalis L. pollen grains and pollen tubes growing in vitro. Protoplasma. 2020 Jan 8. doi: 10.1007/s00709-019-01463-2.Sprunck et al. (2019). Elucidating small RNA pathways in Arabidopsis thaliana egg cells. http://dx.doi.org/10.1101/525956Yang et al. (2017). The developmental regulator PKL is required to maintain correct DNA methylation patterns at RNA-directed DNA methylation loci. Genome Biol. 2017 May 31;18(1):103. doi: 10.1186/s13059-017-1226-y.
AGO5 belongs to a group of argonaute proteins which are catalytic component of the RNA-incudes silencing complex (RISC). This protein complex is responsible for the gene silencing (RNAi). Probably involved in antiviral RNA silencing.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabidopsis thaliana
Immunogen:
peptide of Arabidopsis thaliana AGO5 UniProt: Q9SJK3, TAIR:AT2G27880
Applications:
Immunofluorescebce (IF), Immunoprecipitation (IP), Western blot (WB)
AGO expression may be tissue specific and using floral tissue is recommended where most of the AGOs are expressed the highest, Use of proteasome inhibitors as MG132 can help to stabilize AGO proteins during extraction procedure
Application Details:
1 : 100 (IF), 5 ug per gram floral tissue (IP), 1 : 1500 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
111 | 111 kDa
Not reactive in:
Hordeum vulgare, Solanum lycopersicum, Zea mays
Selected references:
Oliver & Martinez. (2021) Accumulation dynamics of ARGONAUTE proteins during meiosis in Arabidopsis. Plant Reprod. 2021 Nov 23. doi: 10.1007/s00497-021-00434-z. Epub ahead of print. PMID: 34812935.
AGO6 (Argonaute 6) belongs to a group of argonaute proteins which are catalytic component of the RNA-incudes silencing complex (RISC). This protein complex is responsible for the gene silencing (RNAi).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabidopsis thaliana
Immunogen:
KLH-conjugated peptide derived from Arabidopsis thaliana AGO6 UniProt: O48771 TAIR:At2g32940
AGO6 expression is cell specific, Seedlings can be used as a negative control
Application Details:
1 : 1000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
116,4 | 99 kDa
Not reactive in:
Zea mays
Selected references:
Oliver & Martinez. (2021) Accumulation dynamics of ARGONAUTE proteins during meiosis in Arabidopsis. Plant Reprod. 2021 Nov 23. doi: 10.1007/s00497-021-00434-z. Epub ahead of print. PMID: 34812935.Sprunck et al. (2019). Elucidating small RNA pathways in Arabidopsis thaliana egg cells. http://dx.doi.org/10.1101/525956 Havecker el al. (2010). The RNA-directed DNA methylation Arabidopsis Argonautes functionally diverge based on expression and interaction with target loci. Plant Cell. 2010 Feb;22(2):321-34. doi: 10.1105/tpc.109.072199.
Special application note:
There can be a reaction with NEB broad range prestained protein ladder depending upon secondary antibody used.AGO6 accumulates to lower levels in the nrpd1a mutant (Havecker at el. 2010). In addition, a non-specific band migrates to a similar location and thus protein was run on a 6% denaturing gel to obtain good separation.If other secondary antibody is used than in the figure below, cross-reacting pattern can be different.
AGO9 belongs to a group of argonaute proteins which are catalytic component of the RNA-incudes silencing complex (RISC).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Storage Temp:
Store lyophilized/reconstituted at -20 °C; once reconstituted make aliquots to avoid repeated freeze-thaw cycles. Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
Host Animal:
Rabbit
Species Reactivity:
Arabidopsis thaliana
Expected Species:
Arabidopsis thaliana
Immunogen:
KLH-conjugated synthetic peptide derived from Arabidopsis thaliana AGO9 protein sequence UniProt: Q84YI4, TAIR:At5g21150.
Applications:
Immunolocalization, whole-mount (IL), Immunoprecipitation (IP), Western blot (WB)
AGO expression may be cell/tissue specific and using floral tissue is recommended where most of the AGOs are expressed the highest. Seedlings can be used as a negative control. Use of proteasome inhibitors as MG132 can help to stabilize AGO proteins during extraction procedure.A recommended whole-mount immunolocalization protocol can be found here.
Application Details:
5 g of antibody per 1 gram of a fresh tissue (IP), 1 : 10 000 (WB)
Purity:
Immunogen affinity purified serum in PBS pH 7.4.
Reconstitution:
For reconstitution add 50 l of sterile water
Molecular Weight:
101 kDa
Not reactive in:
No confirmed exceptions from predicted reactivity are currently known
Selected references:
Hou et al. (2021) High-throughput single-cell transcriptomics reveals the female germline differentiation trajectory in Arabidopsis thaliana. Commun Biol. 2021 Oct 1;4(1):1149. doi: 10.1038/s42003-021-02676-z. PMID: 34599277; PMCID: PMC8486858. (immunolocalization)Oliver & Martinez. (2021) Accumulation dynamics of ARGONAUTE proteins during meiosis in Arabidopsis. Plant Reprod. 2021 Nov 23. doi: 10.1007/s00497-021-00434-z. Epub ahead of print. PMID: 34812935.Sprunck et al. (2019). Elucidating small RNA pathways in Arabidopsis thaliana egg cells. http://dx.doi.org/10.1101/525956Su et al. (2017). The THO Complex Non-Cell-Autonomously Represses Female Germline Specification through the TAS3-ARF3 Module. Curr Biol. 2017 Jun 5;27(11):1597-1609.e2. doi: 10.1016/j.cub.2017.05.021.Havecker et al. (2010) The RNA-directed DNA methylation Arabidopsis Argonautes functionally diverge based on expression and interaction with target loci. Plant Cell 22(2): 321-34.
Guinea Pig anti-Agouti related protein (AGRP) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Guinea Pig
Species Reactivity:
Human,Mouse,Rat,Sheep
Immunogen:
A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC, frozen, PFA fixed material. Not yet tested on paraffin embedded tissue sections. A concentration of 1:1000 to 1:2000 is recommended for IHC with overnight incubations. Permeabilization suggested is 0.1% triton X-100 in blocking buffer. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/mL of AGRP. In rodents such as rat cell terminal staining is most typically observed without cell body staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Agrp; Agrt; Art; Agouti-related protein;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity was demonstrated by immunohistochemistry. This antibody is known to react with human, rat and sheep. Other species have not yet been tested.
Storage:
Store lyophilized antibody at 2-8ºC. It is recommended that a thawed sample is stored at 2-8°C for no longer than 2 weeks. Allocation of appropriate anti-bacterial agent can increase shelf life by several weeks. Diluted serum should be prepared as required. Long term stability requires storage, preferably in small aliquots at -20°C or lower. Glycerol (1:1) can be added to neat serum for additional stability if intended use does not prevent this.
AGR3 (Anterior Gradient 3) protein, also known as AG3 (hAG-3, HAG3 in human), or BCMP11, is a secreted cytoplasmic protein which is involved in metastasis induction and p53 tumour supressor inhibition. It may serve as molecular marker and potential therapeutic target for hormone-responsive breast tumours. Its Xenopus homolog is associated with anteroposterior fate determination during early development.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Purified human AGR3 protein
Applications:
WB,IHC,ICC
Additional Info:
The antibody AGR3.2 recognizes epitope QYSQALKKV within AGR3 (AG3) protein (19-20 kDa); secreted cytoplasmic protein which can serve as a marker of carcinogenesis.
Clone number:
AGR3.2
Antibody Isotype:
IgG1
Application Details:
Immunohistochemistry (frozen sections): Recommended dilution: 1 ?g/ml; positive tissue: breast cancer. Western blotting: Recommended dilution: 1 ?g/ml; positive control: T47D breast cancer cell line, negative control: H1299 lung carcinoma cell line. Immunocytochemistry: Recommended dilution: 1 ?g/ml; positive control: T47D breast cancer cell line, negative control: H1299 lung carcinoma cell line.
X
We use cookies to help personalise and improve your web experience.
By using our website you consent to our use of cookies, some of which may have already been set on your device.
View our Cookie Policy to learn more.
