Sheep anti-C-reactive protein Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
C-reactive protein has several roles associated with host defence such as; promoting agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. COFACTOR: Binds 2 calcium ions per subunit. C-reactive protein exists as a homopentamer. Pentaxin (or Pentraxin) have a discoid arrangement of 5 non-covalently bound subunits. There are 2 alternatively spliced isoforms. C-reactive protein is found in plasma and its concentration increases greatly during acute phase response to tissue injury, infection or other inflammatory stimuli. It is induced by IL-1 and IL-6.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with 0.01% Thimerosal
Host Animal:
Sheep
Species Reactivity:
Human
Immunogen:
Human recombinant C-Reactive protein
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. Extremely high titre antibody. For western blot a dilution of 1: 10,000 to 1: 100000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
CRP; PTX1
Accession Number:
P02741 (CRP_HUMAN)
Reconstitution:
Reconstitute in 100 µL of sterile water. Centrifuge to remove any insoluble material.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
It has been shown to be specific for C-reactive protein by WB. Human, other species have not yet been tested.
CNTF is a survival promoting factor for different types of neurons in vitro and in vivo. The essential structural features for the biological function of human CNTF were investigated by Thier, M. et al. They showed that deletion of 14 N-terminal and 18 C-terminal amino acids significantly increased bioactivity compared to wild-type CNTF. FUNCTION: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. TISSUE SPECIFICITY: Nervous system. PHARMACEUTICAL: CNTF is being tested under the name Axokine by Regeneron Pharmaceuticals for treatment of human motor neuron diseases, such as amyotrophic lateral sclerosis (ALS). As it induces substantial weight loss, preferentially of fat as opposed to lean body mass, it is being used for obesity treatment. SIMILARITY: Belongs to the CNTF family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human CNTF
Applications:
ELISA,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. A dilution of 1:500 to 4000 is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Ciliary neurotrophic factor
Accession Number:
P26441 (CNTF_HUMAN)
Reconstitution:
Reconstitute in 100 µL of sterile water. Centrifuge to remove any insoluble material.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
This antibody specifically detects CNTF shown by western blot. This antiserum to known to react with rat, mouse and human CNTF protein.
Rabbit anti-Insulin Receptor alpha Recombinant Antibody (Unconjugated), suitable for Crystallography.
Background Info:
This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. This antibody forms a stable complex with the L1-CR fragment of the human insulin receptor alpha-subunit. Consequently, this antibody can be used to facilitate the crystallization of the complex, and the establishment of its structure (McKern et al, 2006).
Product Type:
Antibody
Antibody Type:
Recombinant
Format:
Liquid. PBS with 0.02% Proclin 300.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
This antibody was raised by immunizing mice with IM-9 lymphocytes followed by purified insulin receptor.
Applications:
Crystallography
Clone number:
Fab 83-7
Antibody Isotype:
IgG, kappa
Application Details:
This antibody forms a stable complex with the L1-CR fragment of the human insulin receptor alpha-subunit. Consequently, this antibody can be used to facilitate the crystallization of the complex, and the establishment of its structure (McKern et al, 2006).
Alternative Names:
CD220
Accession Number:
P06213 (INSR_HUMAN)
Storage:
Store at 2-8°C for up to 1 month. For longer storage, aliquot and store at -20_C. Avoid mulitiple freeze thaw cycles.
Shelf Life:
Store at 2-8°C for up to 3 months. For longer storage, aliquot and store at -20°C for up to 12 months.
Specificity:
This antibody recognizes an epitope within the cysteine rich region (amino acids 140-301) of the extracellular domain of the human insulin receptor alpha.
This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques.
Product Type:
Antibody
Antibody Type:
Recombinant
Format:
Liquid. PBS with 0.02% Proclin 300.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Epitope within amino acids 140-301 (the cysteine rich region) of the extracellular domain of the human Insulin Receptor alpha.
Applications:
ELISA,IHC-Paraffin-embedded,IP
Clone number:
83-7
Antibody Isotype:
IgG, kappa
Alternative Names:
CD220; Insulin Receptor alpha; HHF5; IR; HIR
Accession Number:
P06213 (INSR_HUMAN)
Storage:
Store at 2-8°C for up to 1 month. For longer storage, aliquot and store at -20_C. Avoid mulitiple freeze thaw cycles.
Shelf Life:
Store at 2-8°C for up to 3 months. For longer storage, aliquot and store at -20°C for up to 12 months.
Specificity:
Recognises the extracellular domain of the Insulin Receptor alpha.
This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques.
Product Type:
Antibody
Antibody Type:
Recombinant
Format:
Liquid. PBS with 0.02% Proclin 300.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Pig,Sheep
Immunogen:
This antibody was raised by immunizing mice with IM-9 lymphocytes followed by purified insulin receptor.
Applications:
ELISA,ICC,IHC,IP,WB
Clone number:
83-14
Antibody Isotype:
IgG, kappa
Alternative Names:
CD220; Insulin Receptor alpha; HHF5; IR; HIR
Accession Number:
P06213 (INSR_HUMAN)
Storage:
Store at 2-8°C for up to 1 month. For longer storage, aliquot and store at -20_C. Avoid mulitiple freeze thaw cycles.
Shelf Life:
Store at 2-8°C for up to 3 months. For longer storage, aliquot and store at -20°C for up to 12 months.
Specificity:
Recognises the extracellular domain of the Insulin Receptor alpha. Amino acids 469 - 592 (exon 7 and 8) of Insulin Receptor alpha.
Glyceraldehyde 3-Phosphate Dehydrogenase (GAPDH) is a metabolic enzyme responsible for catalyzing one step in the glycolytic pathway, the reversible oxidative phosphorylation of glyceraldehyde 3-phosphate. GAPDH may have other roles in the activation of transcription and in the regulation of apoptosis as well as Alzheimer's disease and Huntington's disease. The immunogen used to raise this particular antibody was extensively purified pig GAPDH. This antibody can be used as a loading control for western blotting experiments, allowing comparison between the level of this protein and others in a cell or tissue.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized rabbit serum with 0.5% sodium azide.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted)
Immunogen:
Full length recombinant human GAPDH expressed in and purified from E. coli
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:10,000-1:30,000 is recommended for WB. A dilution of 1:1,000-1:10,000 is recommended for ICC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Glucose transporter 4 (GLUT4) is a multi-pass membrane protein. It is a member of the family of glucose transporters that facilitate glucose uptake by cells. GLUT4 is sequestered within cells not stimulated by insulin. After insulin stimulation, it is translocated to the cell surface where it transports glucose across the cell membrane. GLUT4 is found in skeletal and heart muscles and in adipose tissue. It is highly conserved between species.
A synthetic peptide corresponding to the region (491-509 aa) from the C-terminus of human GLUT4.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 0.1-0.5 µg/mL is recommended for WB. A concentration of 0.5-1.0 µg/mL is recommended to detect GLUT4 in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
GLUT4; SLC2A4;
Accession Number:
P14672 (GLUT4_HUMAN)
Reconstitution:
Reconstitute in 100 µL of sterile distilled water to achieve an antibody concentration of 1 µg/µL. Centrifuge to remove any insoluble material.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Rat; predicted to react with human and mouse due to sequence homology;
Rabbit anti-Receptor for advanced glycosylation end products (RAGE) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
The Receptor for Advanced Glycation Endproducts (RAGE) is also known as the Advanced glycosylation end product-specific receptor (AGER). RAGE is expressed in endothelial cells and interacts with many molecules including advanced glycosylation end products (AGE) and amyloid beta peptide. At least 2 RAGE isoforms are produced by alternative splicing. Isoform 1 is a single-pass type I membrane protein whereas isoform 2 is secreted.
A synthetic peptide corresponding to a region (178-196 aa) from human RAGE.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human RAGE (isoform 1) has a predicted length of 404 residues and MW of 43 kDa. A concentration of 1.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
AGER; RAGE;
Accession Number:
Q15109 (RAGE_HUMAN)
Reconstitution:
Reconstitute in 100 µL of sterile distilled water to achieve an antibody concentration of 1 mg/mL. Centrifuge to remove any insoluble material.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human (WB, IHC), Rat (IHC). Predicted to react with mouse due to sequence homology
Rabbit anti-Leptin Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Leptin is secreted by white adipocytes and functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. Leptin has a variety of other roles including endocrine functions, regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing (Ref Entrez Gene).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
Recombinant rat Leptin protein
Applications:
ELISA,WB
Antibody Isotype:
Mixed
Application Details:
WB and ELISA. Suggested dilution of 1:1,000-1:4,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Leptin; Obesity factor; Lep; Ob; Obese protein;
Accession Number:
P41159 (LEP_HUMAN)
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Leptin Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Leptin is secreted by white adipocytes and functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. Leptin has a variety of other roles including endocrine functions, regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing (Ref Entrez Gene).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant human Leptin protein
Applications:
ELISA,WB
Antibody Isotype:
Mixed
Application Details:
WB and ELISA. Suggested dilution of 1:1,000-1:2,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Leptin; Obesity factor; Lep; Ob; Obese protein;
Accession Number:
P41159 (LEP_HUMAN)
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Tyrosine Kinase Receptor B (TrkB) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, ELISA.
Background Info:
TrkB is a member of the neurotrophic tyrosine receptor kinase family. It is a membrane-bound receptor and upon neurotrophin binding, it phosphorylates itself as well as MAPK pathways members. TrkB is the receptor for brain-derived neurotrophic factor (BDNF), neurotrophin-3 and neurotrophin-4/5 but not nerve growth factor (NGF). It is Involved in the development and/or maintenance of the nervous system. SUBUNIT: Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. SUBCELLULAR LOCATION: Membrane; single-pass type I membrane protein. ALTERNATIVE PRODUCTS: 4 named isoforms produced by alternative splicing. Additional isoforms seem to exist. TISSUE SPECIFICITY: The different forms are differentially expressed in various cell types. SIMILARITY: Belongs to the Tyr protein kinase family. Insulin receptor subfamily. SIMILARITY: Contains 2 Ig-like C2-type (immunoglobulin-like) domains. SIMILARITY: Contains 2 LRR (leucine-rich) repeats. SIMILARITY: Contains 1 protein kinase domain. Mutations in the TrkB gene have been associated with obesity and mood disorders.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
Extracellular domain of glycosylated mouse TrkB protein produced in CHO cells was used as the immunogen. As shown for similar antisera, it is anticipated that this antibody will block the TrkB receptor binding of corresponding neurotrophin ligand.
Applications:
ELISA,IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IF (1:1000-1:3000), 1-site ELISA (1:10,000 dilution). A dilution of 1:1000 to 1:3000 o/n is recommended for IF. 4% PFA frozen sections tested. Not yet tested on paraffin embedded tissues. Use triton X-100 permeabilizaiton with frozen sections. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Reconstitute in 100 µL of sterile water. Centrifuge to remove any insoluble material.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
Specificity was demonstrated by immunohistochemistry. This antibody was used to stain cryostat sections of the rat peripheral sensory ganglia. Reacts with rat and mouse TrkB. Other species have not yet been tested.
References:
Rudolph M (2020). Mesolimbic GluA1 AMPA Receptor Signaling in Dopaminergic Neurons Plays a Critical Role in the Induction of Cross-Sensitization to Psychostimulants in Response to Social Stress. PhD Thesis. Application: IHC (IF), frozen sections. Species: Rat.Penzo MA et al. (2015). The paraventricular thalamus controls a central amygdala fear circuit. Nature. [Epub ahead of print]. Application: IHC (IF), 4% PFA, frozen sections. Species: Mouse.
PPARG is a nuclear hormone receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the receptor binds to a promoter element in the gene for acyl-CoA oxidase and activates its transcription (Ref: SWISSPROT).
A synthetic peptide (PHYEDIPFTRTDPVVADY) corresponding to a region (76-93 aa) from human Peroxisome proliferator-activated receptor gamma (PPARG).
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human PPARG (isoform 2) has a predicted length of 505 amino acids and MW of 58 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
PPAR-gamma; Nuclear receptor subfamily 1 group C member 3; PPARG; NR1C3;
Accession Number:
P37231 (PPARG_HUMAN)
Reconstitution:
Reconstitute in 100 µL of sterile distilled water to achieve an antibody concentration of 1 mg/mL. Centrifuge to remove any insoluble material.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
The specificity of this antibody has been confirmed by WB against the antigen. Human;
Rabbit anti-PRKR-like endoplasmic reticulum kinase (phosphorylated and non phosphorylated) (PERK) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
PERK (PKR-like ER kinase) is a single-pass type I ER membrane protein with a stress-sensing luminal domain connected by a transmembrane segment to a cytoplasmic-kinase domain.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. 50% glycerol
Host Animal:
Rabbit
Species Reactivity:
Mouse
Immunogen:
A recombinant peptide from mouse PERK.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunoprecipitation (IP). A dilution of 1:500 is recommended for WB. A dilution of 30 µL of antibody in a total reaction mixture of 500 µL is recommended for IP. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
This antiserum is known to recognise both phosphorylated and non phosphorylated mouse PERK.
References:
Bollo M. et al (2010) Calcineurin interacts with PERK and dephosphorylates calnexin to relieve ER stress in mammals and frogs PLoS One. 2010 Aug 5;5(8)
Rabbit anti-Adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 2 (APPL2) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
APPL2 is an isoform of APPL1 with 54% identity in their protein sequences. APPL2 has a role in cell proliferation and embryonic development. Recently, it was shown that APPL2 regulates FSH signaling and acts as a negative regulator in adiponectin signaling.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. 15% glycerol
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
Mouse APPL2 protein (amino acids: 619-662) conjugated to GST.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunoprecipitation (IP). A dilution between 1:2500 and 1:5000 is recommended for WB. A concentration of 3 µL/reaction is recommended for IP. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
DCC-interacting protein 13-beta; Dip13-beta; Adapter protein containing PH domain; PTB domain and leucine zipper motif 2; APPL2; DIP13B;
Accession Number:
Q8NEU8 (DP13B_HUMAN)
Storage:
Aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
This antiserum is known to recognise both mouse and human APPL2.
Rabbit anti-Adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1 (APPL1) Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
APPL1 (adaptor protein containing PH domain, PTB domain and leucine zipper motif 1) mediates adiponectin signaling in various types of cells. APPL1 is also thought to have a role in insulin signaling.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
The C-terminus of Human APPL1 protein (amino acids: 455-709) conjugated to GST.
Applications:
ICC,WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (WB) and Immunoprecipitation (IP). A dilution of 1:1,000 is recommended for WB. A concentration of 3 µL/reaction is recommended for IP. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
DCC-interacting protein 13-alpha; Dip13-alpha; Adapter protein containing PH domain; PTB domain and leucine zipper motif 1; APPL1; APPL; DIP13A; KIAA1428;
Accession Number:
Q9UKG1 (DP13A_HUMAN)
Reconstitution:
Reconstitute in 100 µL of sterile distilled water. Centrifuge to remove any insoluble material.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
This antiserum is known to recognise both mouse and human APPL1.
Adiponectin Receptors 1 and 2 are membrane receptors for adiponectin, a hormone secreted by adipocytes which regulates energy homeostatis and insulin sensitivity.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. 15% glycerol
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
Human Adiponectin Receptor 2 protein (amino acids: 78-219) conjugated to GST.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting. A dilution of 1:2000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Progestin and adipoQ receptor family member II; ADIPOR2; PAQR2;
Accession Number:
Q86V24 (PAQR2_HUMAN)
Storage:
Aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
This antiserum is known to recognise both mouse and human Adiponectin Receptor 2.
Adiponectin Receptors 1 and 2 are membrane receptors for adiponectin, a hormone secreted by adipocytes which regulates energy homeostatis and insulin sensitivity.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. 15% glycerol
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
The intracellular portion of mouse Adiponectin Receptor 1 protein (amino acids: 4-142) conjugated to GST.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting. A dilution of 1:2000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Adipor1; AdipoR1; Progestin and adipoQ receptor family member I; ADIPOR1; PAQR1;TESBP1A; CGI-45;
Accession Number:
Q91VH1 (PAQR1_MOUSE)
Storage:
Aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
This antiserum is known to recognise both mouse and human Adiponectin Receptor 1.
Rabbit anti-Tyrosine Kinase Receptor B (TrkB) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
FUNCTION: Receptor for brain-derived neurotrophic factor (BDNF), neurotrophin-3 and neurotrophin-4/5 but not nerve growth factor (NGF). Involved in the development and/or maintenance of the nervous system. This is a tyrosine-protein kinase receptor. Known substrates for the TRK receptors are SHC1, PI-3 kinase, and PLC-gamma-1. CATALYTIC ACTIVITY: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. SUBUNIT: Exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures (By similarity). Binds APS. Interacts with SQSTM1. SUBCELLULAR LOCATION: Membrane; single-pass type I membrane protein. ALTERNATIVE PRODUCTS: 3 named isoforms produced by alternative splicing. Additional isoforms seem to exist. TISSUE SPECIFICITY: The different forms are differentially expressed in various cell types. Isoform T2 is primarily expressed in neurons. PTM: Ligand-mediated auto-phosphorylation. SIMILARITY: Belongs to the Tyr protein kinase family. Insulin receptor subfamily. SIMILARITY: Contains 2 Ig-like C2-type (immunoglobulin-like) domains. SIMILARITY: Contains 2 LRR (leucine-rich) repeats. SIMILARITY: Contains 1 protein kinase domain.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (AFPRLEPNSIDPEN(C)) as part of rat TrkB protein (aa: 54-67) conjugated to KLH
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:1000 to 1:3000 is recommended for this application. For WB, a 1:500 to 1:1000 dilution is recommended. The sequence of the immunogen and the conjugate are identical to the one used by Yan et al (see the Refs) and the antiserum appears to have similar characteristics. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Reconstitute in 100 µL of sterile water. Centrifuge to remove any insoluble material.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
Sequence was chosen to avoid cross reactivity with TrkA and TrkC. This antiserum recognises human, rat and mouse TrkB. Cross reactivity with other species has not yet been tested.
References:
Warren PM et al. (2018) "Rapid and robust restoration of breathing long after spinal cord injury." Nat Commun. 2018 Nov. PMID: 30482901 9(1):4843. Application: IHC/IF. Species: Rat, spinal cord sections.Wang T et al. (2016) "Flux of signalling endosomes undergoing axonal retrograde transport is encoded by presynaptic activity and TrkB." Nat Commun. 2016 Sep. PMID: 27687129 30(7):12976. Application: IF & structured illumination microscopy (SIM). Species: Rat, Mouse; fixed 4% PFA with 4% sucroseMatusica D et al. (2016) Inhibition of motor neuron death in vitro and in vivo by a p75 neurotrophin receptor intracellular domain fragment. J Cell Sci. 2016 Feb 1;129(3):517-30. Application: WB.Brock JH et al. (2010) Local and remote growth factor effects after primate spinal cord injury. J Neurosci. 2010 Jul 21;30(29):9728-37.Gruber H. et al. (2008) Brain-derived neurotrophic factor and its receptor in the human and the sand rat intervertebral disc. Arthritis Res Ther. 2008; 10(4): R82.
The C-X-C Chemokine receptor 4 (CXCR4) is a multi-pass membrane protein that belongs to the G-protein coupled receptor 1 family. CXCR4 is a specific receptor for stromal cell-derived factor-1 (SDF-1) and is widely expressed in tissues including peripheral blood leukocytes, spleen, thymus, spinal cord, heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, cerebellum, cerebral cortex and medulla. At least 2 isoforms are produced by alternative splicing.
A synthetic peptide (SGDYDSMKEPCFREEN) corresponding to a region (18-33) from human C-X-C Chemokine receptor 4. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 0.1-0.5 µg/mL is recommended for WB. Human CXCR4 (isoform 1) has a predicted length of 352 residues and MW of 40 kDa. A concentration of 0.5-1.0 µg/mL is recommended to detect the protein in human formalin fixed and paraffin embedded tissues. Heat mediated antigen retrieval (Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins) is required. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Reconstitute in 100 µL of sterile distilled water to achieve an antibody concentration of 1 mg/mL. Centrifuge to remove any insoluble material.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for up to six months. Avoid freeze-thaw cycles
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human (WB, IHC); rat (WB); predicted to react with mouse due to sequence homology;
Mouse anti-Insulin Receptor alpha Recombinant Antibody (Unconjugated), suitable for Crystallography.
Background Info:
This antibody forms a stable complex with the L1-CR fragment of the human insulin receptor alpha-subunit. Consequently, this antibody can be used to facilitate the crystallization of the complex, and the establishment of its structure (McKern et al, 2006).
Product Type:
Antibody
Antibody Type:
Recombinant
Format:
Liquid. PBS with 0.02% Proclin 300.
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
This antibody was raised by immunizing mice with IM-9 lymphocytes followed by purified insulin receptor.
Applications:
Crystallography
Clone number:
Fab 83-7
Antibody Isotype:
IgG1, kappa
Application Details:
This antibody forms a stable complex with the L1-CR fragment of the human insulin receptor alpha-subunit. Consequently, this antibody can be used to facilitate the crystallization of the complex, and the establishment of its structure (McKern et al, 2006).
Alternative Names:
CD220
Accession Number:
P06213 (INSR_HUMAN)
Storage:
Store at 2-8°C for up to 1 month. For longer storage, aliquot and store at -20_C. Avoid mulitiple freeze thaw cycles.
Shelf Life:
Store at 2-8°C for up to 3 months. For longer storage, aliquot and store at -20°C for up to 12 months.
Specificity:
This antibody recognizes an epitope within the cysteine rich region (amino acids 140-301) of the extracellular domain of the human insulin receptor alpha.
The sortilin-related receptor SORLA is an endocytic receptor that belongs to the vacuolar protein sorting 10 (VPS10) domain receptor family. SORLA binds to the amyloid precursor protein (APP). It functions as an intracellular sorting receptor as APP is being trafficked between the secretory pathway, the cell surface, and, subsequently, endosomes. SORLA is localized primarily to the trans-Golgi network and early endosomes, shuttling between these two membrane compartments. SORLA's interaction with APP in endosomal compartments limits the amyloidogenic proteolysis of APP. Reduced brain levels of SORLA are thought to alter the transport and processing of APP to increase generation of A? peptides in early or late endosomes. SORLA is highly expressed in the brain. Expression is reported to be normal in familial Alzheimer's disease caused by mutations in presenilin or APP genes, but decreased in some cases of sporadic late-onset AD. In these cases, loss of SORLA activity has been hypothesized to be a proximal cause of amyloidosis. In addition, several private nonsense and missense mutations in SORLA that decrease SORLA levels in the brain were found in rare cases of familial AD. A genetic association of SORLA with AD is well established. Population-based studies initially linked nearly 30 SNPs in SORLA to increased risk of AD, and subsequent studies, meta-analyses, and GWAS have confirmed some of these associations. The genetic data on SORLA and LOAD is complex, with at least six different polymorphisms pointing toward the existence of several causative variants in distinct regions of the gene. Ref: alzforum.org
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Ascitic fluid containing 0.03% sodium azide
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Purified recombinant fragment of human SorLA expressed in E. Coli
Applications:
ICC,IHC-Paraffin-embedded,WB
Clone number:
3B6B11
Antibody Isotype:
IgG
Application Details:
Western Blotting (1:500-1:2,000), Immunohistochemistry (1:200-1:1,000, use at 1:200 for paraffin-embedded tissues), Immunocytochemistry (1:200-1:1,000) and ELISA (1:10,000). Other applications have not been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Sortilin-related receptor; Low-density lipoprotein receptor relative with 11 ligand-binding repeats; LDLR relative with 11 ligand-binding repeats; LR11; SorLA-11; Sorting protein-related receptor containing LDLR class A repeats; SorLA
Accession Number:
Q92673 (SORL_HUMAN)
Storage:
Spin vial briefly before opening. Divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
Anti-SorLA SORL1 Monoclonal Antibody validated for WB, IHC, IF, ELISA. Reactive to human, other species not yet tested
Mouse anti-Tyrosine Kinase Receptor C (TrkC) Monoclonal Antibody (Unconjugated), suitable for FC, ICC.
Background Info:
Receptor tyrosine kinase involved in nervous system and probably heart development. Upon binding of its ligand NTF3/neurotrophin-3, NTRK3 autophosphorylates and activates different signaling pathways, including the phosphatidylinositol 3-kinase/AKT and the MAPK pathways, that control cell survival and differentiation (Ref: uniprot.org).
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS, pH 7.2-7.6 with 0.1% trehalose and contains no preservatives.
Host Animal:
Mouse
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic peptide immunogen, KEPFPESTDNFI, cooresponding to amino acids 397-408 of human TrkC ECD.
Applications:
FC,ICC
Clone number:
BS337
Antibody Isotype:
IgG2b, kappa
Application Details:
Flow Cytometry (5-10 µg/mL): Tested on human and rodent cell lines. Cell staining can be performed under native conditions on ice, or on fixed cells with up to 4% formaldehyde. Immunocytochemistry (1-2 µg/mL): Tested on fixed (4% formaldehyde) human cells. Other applications have not been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Spin vial briefly before opening. Reconstitute in 100 uL sterile distilled water to obtain an antibody concentration of 1 mg/mL. Centrifuge to remove any insoluble material.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
Human TrkC ECD, cross reactivity to rodent species is expected.
Mouse anti-Tyrosine Kinase Receptor B (TrkB) Monoclonal Antibody (Unconjugated), suitable for FC.
Background Info:
The protein named TrkB (also named Neurotrophic tyrosine kinase receptor type 2 (NTRK2), GP145-TrkB or Tropomyosin-related kinase B is a receptor tyrosine kinase involved in the development and the maturation of the central and the peripheral nervous systems and is important in the regulation of neuron survival, proliferation, migration, differentiation, and synapse formation and plasticity. TrkB may also play a role in neutrophin-dependent calcium signaling in glial cells and mediate communication between neurons and glia. TrkB is the primary receptor for BDNF (brain-derived neurotrophic factor. TrkB also binds NT4 and NT3 but less efficiently. Upon ligand-binding, the receptor undergoes homodimerization, autophosphorylation and activation. TrkB activation recruits, phosphorylates and/or activates several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that each regulate distinct overlapping signaling cascades within cells. Through SHC1, FRS2, SH2B1, SH2B2, these activate the GRB2-Ras-MAPK cascade that regulates, for instance, neuronal differentiation including neurite outgrowth. These same effectors also control the Ras-PI3 kinase-AKT1 signaling cascade that mainly regulates growth and survival. TrkB, via activation of PLCG1 and the downstream protein kinase C-regulated pathways, also controls synaptic plasticity, and thus plays a role in learning and memory by regulating both short term synaptic function and long-term potentiation. PLCG1 also leads to NF-Kappa-B activation and the transcription of genes involved in cell survival. One such consequence is that PLCG1 activation via TrkB is able to suppress anoikis, the apoptosis resulting from loss of cell-matrix interactions. (Reference: www.uniprot.org)
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS, pH 7.2-7.6 with 0.1% trehalose.
Host Animal:
Mouse
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic peptide immunogen, ESSKNIPLANLQ. Extracellular domain of TrkB (amino acids 179-190 of human TrkB).
Applications:
FC
Clone number:
BS379
Antibody Isotype:
IgG2b, kappa
Application Details:
Flow Cytometry (5-10 µg/mL): Tested on human and rodent cell lines. Cell staining can be performed under native conditions on ice, or on fixed cells with up to 4% formaldehyde. Other applications have not been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Spin vial briefly before opening. Reconstitute in 100 uL sterile distilled water to obtain an antibody concentration of 1 mg/mL. Centrifuge to remove any insoluble material.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
TrkB; detects TrkB in both human, mouse and rat samples by Flow cytometry
SARS-CoV Spike Antibody: A novel coronavirus has been identified as the causative agent of SARS (Severe Acute Respiratory Syndrome). Coronaviruses are a major cause of upper respiratory diseases in humans. The genomes of these viruses are positive-stranded RNA approximately 27-31kb in length. SARS infection can be mediated by the binding of the viral spike protein, a glycosylated 139 kDa protein and the major surface antigen of the virus, to the angiotensin-converting enzyme 2 (ACE2) on target cells. This binding can be blocked by a soluble form of ACE2.
Background Info:
ACE2 Antibody: Angiotensin-converting enzyme 2 (ACE2) plays a central role in vascular, renal, and myocardial physiology. In contrast to its homolog ACE, ACE2 expression is restricted to heart, kidney, and testis. Recently. ACE2 has also been shown to be a functional receptor of the SARS coronavirus. Homology modeling shows 2019-nCoV has a similar receptor-binding domain structure as SARS-CoV, which suggests COVID-19 (2019-nCoV) may use ACE2 as a receptor in humans for infection. The normal function of ACE2 is to convert the inactive vasoconstrictor angiotensin I (AngI) to Ang1-9 and the active form AngII to Ang1-7, unlike ACE, which converts AngI to AngII. While the role of these vasoactive peptides is not well understood, lack of ACE2 expression in ace2-/ace2- mice leads to severely reduced cardiac contractility, indicating its importance in regulating heart function.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. ACE2 Antibody is supplied in PBS containing 0.02% sodium azide. Conc.1 mg/mL
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
ACE2 antibody was raised against a synthetic peptide corresponding to amino acids near the center of human ACE2. The immunogen is located within amino acids 150 - 200 of ACE2.
Applications:
ELISA,ICC,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
WB: 4 µg/mL; IHC: 2 µg/mL; IF: 20 µg/mL. Antibody validated: Western Blot in human, mouse and rat samples; Immunohistochemistry in human, mouse and rat samples; Immunofluorescence in human samples. All other applications and species not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
ACE2 antibody can be stored at 2-8°C for three months and -20°C, stable for up to one year. As with all antibodies care should be taken to avoid repeated freeze thaw cycles. Antibodies should not be exposed to prolonged high temperatures.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
Anti-ACE2 has no cross response to ACE1. Predicted species reactivity based on immunogen sequence: Bovine: (93%)
Research Areas:
Biosensis Diabetes & Obesity Infectious Disease
Purity:
ACE2 Antibody is affinity chromatography purified via peptide column.
ACE2 Antibody: Angiotensin-converting enzyme 2 (ACE2) plays a central role in vascular, renal, and myocardial physiology. In contrast to its homolog ACE, ACE2 expression is restricted to heart, kidney, and testis. Recently. ACE2 has also been shown to be a functional receptor of the SARS coronavirus. Homology modeling shows 2019-nCoV has a similar receptor-binding domain structure as SARS-CoV, which suggests COVID-19 (2019-nCoV) may use ACE2 as a receptor in humans for infection. The normal function of ACE2 is to convert the inactive vasoconstrictor angiotensin I (AngI) to Ang1-9 and the active form AngII to Ang1-7, unlike ACE, which converts AngI to AngII. While the role of these vasoactive peptides is not well understood, lack of ACE2 expression in ace2-/ace2- mice leads to severely reduced cardiac contractility, indicating its importance in regulating heart function.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. ACE2 Antibody is supplied in PBS containing 0.02% sodium azide. Conc.1 mg/mL
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Anti-ACE2 antibody ( R-1949-100 ) was raised against a peptide corresponding to 14 amino acids near the amino terminus of human ACE2. The immunogen is located within the first 50 amino acids of ACE2.
Applications:
ELISA,ICC,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
WB: 1-2 ?g/mL; IHC: 2 ?g/mL; ICC: 10 ?g/mL. Antibody validated: Western Blot in human, mouse and rat samples; Immunohistochemistry in human samples; Immunofluorescence in human samples. All other applications and species not yet tested.
ACE2 antibody can be stored at 2-8°C for three months and -20°C, stable for up to one year. As with all antibodies care should be taken to avoid repeated freeze thaw cycles. Antibodies should not be exposed to prolonged high temperatures.
Anti-ACE2 has no cross response to ACE1. Predicted species reactivity based on immunogen sequence: Bovine: (88%) Homology: Predicted species reactivity based on immunogen sequence: Bovine: (88%)
Background Info:
ACE2 Antibody: Angiotensin-converting enzyme 2 (ACE2) plays a central role in vascular, renal, and myocardial physiology. In contrast to its homolog ACE, ACE2 expression is restricted to heart, kidney, and testis. Recently. ACE2 has also been shown to be a functional receptor of the SARS coronavirus. Homology modeling shows 2019-nCoV has a similar receptor-binding domain structure as SARS-CoV, which suggests COVID-19 (2019-nCoV) may use ACE2 as a receptor in humans for infection. The normal function of ACE2 is to convert the inactive vasoconstrictor angiotensin I (AngI) to Ang1-9 and the active form AngII to Ang1-7, unlike ACE, which converts AngI to AngII. While the role of these vasoactive peptides is not well understood, lack of ACE2 expression in ace2-/ace2- mice leads to severely reduced cardiac contractility, indicating its importance in regulating heart function.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. ACE2 Antibody is supplied in PBS containing 0.02% sodium azide. Conc.1 mg/mL
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Anti-ACE2 antibody ( 3217 ) was raised against a peptide corresponding to 18 amino acids near the carboxy terminus of human ACE2. The immunogen is located within the last 50 amino acids of ACE2.
Applications:
ELISA,ICC,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
WB: 1-2 µg/mL; IHC: 2 µg/mL; IF: 10 µg/mL. Antibody validated: Western Blot in human, mouse and rat samples; Immunohistochemistry in human samples; Immunofluorescence in human samples. All other applications and species not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
ACE2 antibody can be stored at 2-8°C for three months and -20°C, stable for up to one year. As with all antibodies care should be taken to avoid repeated freeze thaw cycles. Antibodies should not be exposed to prolonged high temperatures.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
Anti-ACE2 has no cross response to ACE1. Predicted species reactivity based on immunogen sequence: Bovine: (88%)
Anti-ACE2 has no cross response to ACE1. Predicted species reactivity based on immunogen sequence: Bovine: (94%) Homology: Predicted species reactivity based on immunogen sequence: Bovine: (94%)
Background Info:
ACE2 Antibody: Angiotensin-converting enzyme 2 (ACE2) plays a central role in vascular, renal, and myocardial physiology. In contrast to its homolog ACE, ACE2 expression is restricted to heart, kidney, and testis. Recently. ACE2 has also been shown to be a functional receptor of the SARS coronavirus. Homology modeling shows 2019-nCoV has a similar receptor-binding domain structure as SARS-CoV, which suggests COVID-19 (2019-nCoV) may use ACE2 as a receptor in humans for infection. The normal function of ACE2 is to convert the inactive vasoconstrictor angiotensin I (AngI) to Ang1-9 and the active form AngII to Ang1-7, unlike ACE, which converts AngI to AngII. While the role of these vasoactive peptides is not well understood, lack of ACE2 expression in ace2-/ace2- mice leads to severely reduced cardiac contractility, indicating its importance in regulating heart function.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. ACE2 Antibody is supplied in PBS containing 0.02% sodium azide. Conc.1 mg/mL
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Anti-ACE2 antibody ( 3215 ) was raised against a peptide corresponding to 17 amino acids near the center of human ACE2. The immunogen is located within amino acids 180 - 230 of ACE2.
Applications:
ELISA,ICC,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
WB: 1-2 µg/mL; IHC: 2 µg/mL; IF: 20 µg/mL. Antibody validated: Western Blot in human, mouse and rat samples; Immunohistochemistry in human samples; Immunofluorescence in human samples. All other applications and species not yet tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
ACE2 antibody can be stored at 2-8°C for three months and -20°C, stable for up to one year. As with all antibodies care should be taken to avoid repeated freeze thaw cycles. Antibodies should not be exposed to prolonged high temperatures.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
Anti-ACE2 has no cross response to ACE1. Predicted species reactivity based on immunogen sequence: Bovine: (94%)
Rabbit anti-Tyrosine Kinase Receptor C (TrkC) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Receptor tyrosine kinase involved in nervous system and probably heart development. Upon binding of its ligand NTF3/neurotrophin-3, NTRK3 autophosphorylates and activates different signaling pathways, including the phosphatidylinositol 3-kinase/AKT and the MAPK pathways, that control cell survival and differentiation (Ref: uniprot.org).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from a solution containing 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Thimerosal, 0.05 mg NaN3.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Synthetic peptide immunogen, QLWQEQGEAKLNSQN from the ECD of human TrkC, amino acids 172-186.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (0.1 - 0.5 µg/mL): Tested on RIPA lysates from human and rodent tissue and cell lysates. Other applications have not been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Spin vial briefly before opening. Reconstitute in 100 uL sterile distilled water to obtain an antibody concentration of 1 mg/mL. Centrifuge to remove any insoluble material.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
Human TrkC, and Mouse and rat TrkC. Species cross-reactivity determined by Western Blotting. No Cross reactivity by WB seen with TrkA or TrkB receptors.
Rabbit anti-Tyrosine Kinase Receptor B (TrkB) Polyclonal Antibody (Unconjugated), suitable for WB, FC.
Background Info:
The protein named TrkB (also named Neurotrophic tyrosine kinase receptor type 2 (NTRK2), GP145-TrkB or Tropomyosin-related kinase B is a receptor tyrosine kinase involved in the development and the maturation of the central and the peripheral nervous systems and is important in the regulation of neuron survival, proliferation, migration, differentiation, and synapse formation and plasticity. TrkB may also play a role in neutrophin-dependent calcium signaling in glial cells and mediate communication between neurons and glia. TrkB is the primary receptor for BDNF (brain-derived neurotrophic factor. TrkB also binds NT4 and NT3 but less efficiently. Upon ligand-binding, the receptor undergoes homodimerization, autophosphorylation and activation. TrkB activation recruits, phosphorylates and/or activates several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that each regulate distinct overlapping signaling cascades within cells. Through SHC1, FRS2, SH2B1, SH2B2, these activate the GRB2-Ras-MAPK cascade that regulates, for instance, neuronal differentiation including neurite outgrowth. These same effectors also control the Ras-PI3 kinase-AKT1 signaling cascade that mainly regulates growth and survival. TrkB, via activation of PLCG1 and the downstream protein kinase C-regulated pathways, also controls synaptic plasticity, and thus plays a role in learning and memory by regulating both short term synaptic function and long-term potentiation. PLCG1 also leads to NF-Kappa-B activation and the transcription of genes involved in cell survival. One such consequence is that PLCG1 activation via TrkB is able to suppress anoikis, the apoptosis resulting from loss of cell-matrix interactions. (Reference: www.uniprot.org)
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from a solution containing 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Thimerosal, 0.05 mg NaN3.
Western Blotting (0.1 - 0.5 µg/mL): Tested on RIPA lysates from human and rodent brain tissue. Detects TrkB full-length (~140 kDa) and truncated TrkB (~100 kDa) in tissue homogenates. In cell lysates, only a ~50 kDa uncharacterized TrkB isoform is detected. Flow Cytometry (5-20 µg/mL): Tested on human cell lines. Other applications have not been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Trk-B,TrkB, GP145-TrkB, Neurotrophic tyrosine kinase receptor type 2, TrkB tyrosine kinase, Tropomyosin-related kinase B
Accession Number:
Q16620 (NTRK2_HUMAN)
Reconstitution:
Spin vial briefly before opening. Reconstitute in 100 uL sterile distilled water to obtain an antibody concentration of 1 mg/mL. Centrifuge to remove any insoluble material.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
TrkB; detects TrkB in both human, mouse and rat samples by western blot and has positive staining by Flow cytometry against human TrkB positive cell lines.
References:
Fleury S et al. (2021) Tissue-Specificity of Antibodies Raised Against TrkB and p75NTR Receptors; Implications for Platelets as Models of Neurodegenerative Diseases. Front Immunol. 12:606861 Application: WB, human platelets.
Rabbit anti-Beta casein protein Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Beta-casein has an important role in determination of the surface properties of the casein micelles. it is cleaved into 3 chains (casoparan, casohypotensin and antioxidant peptide). Casoparan acts as a macrophage activator, increasing the phagocytic activity of macrophages and peroxide release from macrophages. It also acts as a bradykinin-potentiating peptide. Casohypotensin acts as a bradykinin-potentiating peptide and induces hypotension in rats. Acts as a strong competitive inhibitor of endo-oligopeptidase A. Antioxidant peptide has antioxidant activity (ref: uniprot.org.).Bovine milk contains two types of beta-casein protein, A2 or A1. Recent studies have shown that milk containing the A1 beta casein protein can contribute to issues including gastrointestinal discomfort after ingestion. There is some evidence of a link between ingestion of A1 beta casein protein and the development of Type 1 diabetes.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS, pH 7.4, without preservative. Refer to the product label for antibody concentration.
Host Animal:
Rabbit
Species Reactivity:
Bovine
Immunogen:
Bovine beta-casein peptides
Applications:
ELISA,WB
Antibody Isotype:
IgG
Application Details:
ELISA and western blotting (1:5,000 - 1: 20,000). Do not use skim milk for blocking and dilution of assay reagents, BSA is recommended. Biosensis recommends that optimal working dilutions should be determined by the end user.
Accession Number:
P02666 (CASB_BOVIN)
Reconstitution:
Spin vial briefly before opening. Reconstitute in 100 uL sterile, ultrapure water to prepare 1 mg/mL solution. Centrifuge to remove any insoluble material.
Storage:
After opening maintain at -20°C in undiluted aliquots for up to 6 months. For short-term storage, keep aliquot at 2-8°C for up to one week. Avoid repeated freeze-thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
Bovine beta-casein. Detects both A1 and A2 beta-casein isoforms.
References:
Indyk HE et al. (2021) The determination of intact ?-casein in milk products by biosensor immunoassay. J. Food Compos. Anal. 101:103946 Application: Immunoassay.
Mouse anti-RAC-alpha serine/threonine-protein kinase Monoclonal Antibody (Unconjugated), suitable for WB.
Background Info:
The protein kinase AKT has a role in glucose transport, glycogen synthesis, inhibiting apoptosis, cell-cycle progression, cell growth and cancer. Three isoforms of the AKT gene have been identified; AKT1, AKT2 and AKT3. AKT1 or RAC-alpha serine/threonine-protein kinase is activated by insulin and various growth and factors.
A synthetic peptide (VDSERRPHFPQFSYSAS) corresponding to a region (461-477) from human RAC-alpha serine/threonine-protein kinase.
Applications:
WB
Clone number:
IML-26
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 0.25-0.50 µg/mL is recommended for WB. Human AKT1 has a predicted length of 480 residues and MW of 56 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Protein kinase B alpha; 2.7.11.1; RAC-PK-alpha; PKB; C-AKT; AKT1; RAC;
Accession Number:
P31749 (AKT1_HUMAN)
Reconstitution:
Reconstitute in 1 mL of PBS (pH 7.4) to achieve an antibody concentration of 100 µg/mL. Centrifuge to remove any insoluble material.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
The specificity of this antibody has been confirmed by WB against the antigen. Human; mouse; rat; chicken;
Mouse anti-Pro-glucagon Monoclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
The glucagon preproprotein is cleaved into a number of distinct peptides that include glucagon, glucagon-like peptide 1 (GLP-1) and glucagon-like peptide 2 (GLP-2). Glucagon has a key role in glucose metabolism and homeostasis. The release of glucagon is stimulated by hypoglycemia and regulates the level of blood glucose by increasing gluconeogenesis and decreasing glycolysis.
Immunohistochemistry (IHC). A concentration of 1.0-2.0 µg/mL is recommended to detect the protein in formalin fixed and paraffin embedded tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
GLP1; GLP2; GRPP; GCG;
Accession Number:
P01274 (GLUC_PIG)
Reconstitution:
Reconstitute in 1 mL of PBS (pH 7.4) to achieve an antibody concentration of 100 µg/mL. Centrifuge to remove any insoluble material.
Storage:
After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
The specificity of this antibody has been confirmed by IHC against the antigen. Human; rat;
Guinea Pig anti-Agouti related protein (AGRP) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Guinea Pig
Species Reactivity:
Human,Mouse,Rat,Sheep
Immunogen:
A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC, frozen, PFA fixed material. Not yet tested on paraffin embedded tissue sections. A concentration of 1:1000 to 1:2000 is recommended for IHC with overnight incubations. Permeabilization suggested is 0.1% triton X-100 in blocking buffer. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/mL of AGRP. In rodents such as rat cell terminal staining is most typically observed without cell body staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Agrp; Agrt; Art; Agouti-related protein;
Accession Number:
P56473 (AGRP_MOUSE)
Reconstitution:
Reconstitute in 50 µL sterile water. Centrifuge to remove any insoluble material.
Storage:
Store lyophilized antibody at 2-8ºC. It is recommended that a thawed sample is stored at 2-8°C for no longer than 2 weeks. Allocation of appropriate anti-bacterial agent can increase shelf life by several weeks. Diluted serum should be prepared as required. Long term stability requires storage, preferably in small aliquots at -20°C or lower. Glycerol (1:1) can be added to neat serum for additional stability if intended use does not prevent this.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
Specificity was demonstrated by immunohistochemistry. This antibody is known to react with human, rat and sheep. Other species have not yet been tested.
Goat anti-C-reactive protein (CRP) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. COFACTOR: Binds 2 calcium ions per subunit.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Goat
Species Reactivity:
Human
Immunogen:
Human recombinant C-Reactive protein
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. Extremely high titre antibody. For western blot a dilution of 1: 10,000 to 1: 100000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
CRP; PTX1;
Accession Number:
P02741 (CRP_HUMAN)
Reconstitution:
Reconstitute in 100 µL of sterile water. Centrifuge to remove any insoluble material.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
It has been shown to be specific for C-reactive protein by WB. Human
Bovine milk contains two types of beta-casein protein, A2 or A1. Recent studies have shown that milk containing the A1 beta casein protein can contribute to issues including gastrointestinal discomfort after ingestion. There is some evidence of a link between ingestion of A1 beta casein protein and the development of Type 1 diabetes.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS, pH 7.4, containing 0.02% sodium azide as preservative. Refer to the product label for antibody concentration.
Species Reactivity:
Bovine
Immunogen:
A synthetic peptide (PGPIHNSLP, aa: 78-86) conjugated to KLH has been used as immunogen. Bovine A2 beta casein differs from bovine A1 beta casein by one amino acid (P82 -> H82)
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
Western blot and ELISA. Suggested working dilution for western blot is 1:1,000-1:5,000. The amount of milk per lane can be 0.05 µL-0.1 µL for Western blot. Sample Preparation: Milk should be diluted 1:10 in 0.1M NaOH. The reason for diluting (1:10) in 0.1M NaOH is because the milk protein is easier to dissolve in NaOH. The sample is then further diluted with PBS or other buffer and mixed at 1:1 ratio, to prepare for loading. For example, one can take the 1:10 dilution milk (0.5 µL-1 µL) and add into 9.5 µL or 9 µL PBS and mix with 10 µL SDS-PAGE Sample buffer, boil for 5 minutes, quick spin, and load on the gel. Recommended blocking buffer: TBS with 5% BSA. Recommended antibody dilution buffer: TBST containing 3% BSA. Biosensis recommends that optimal working dilutions should be determined by the end user.
Accession Number:
P02666 (CASB_BOVIN)
Storage:
Maintain unopened vial at -20°C for up to 12 months after date of receipt. After opening maintain at -20°C in undiluted aliquots for up to 6 months. For short-term storage, keep aliquot at 2-8°C for up to one week. Avoid repeated freeze-thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
The antibody is specific to A1 beta casein by western blot. No cross-reactivity with A2 beta casein is seen. Species cross-reactivity not tested.
Bovine milk contains two types of beta-casein protein, A2 or A1. Recent studies have shown that milk containing the A1 beta casein protein can contribute to issues including gastrointestinal discomfort after ingestion. There is some evidence of a link between ingestion of A1 beta casein protein and the development of Type 1 diabetes.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS, pH 7.4, containing 0.02% sodium azide as preservative. Refer to the product label for antibody concentration.
Species Reactivity:
Bovine
Immunogen:
A synthetic peptide (PGPIPNSLP, aa: 78-86) conjugated to KLH has been used as immunogen. Bovine A1 beta casein differs from bovine A2 beta casein by one amino acid (H82 -> P82)
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
Western blot and ELISA. Suggested working dilution for western blot is 1:200-1:1,000. The amount of milk per lane can be 0.05 µL-0.1 µL for Western blot. Sample Preparation: Milk should be diluted 1:10 in 0.1M NaOH. The reason for diluting (1:10) in 0.1M NaOH is because the milk protein is easier to dissolve in NaOH. The sample is then further diluted with PBS or other buffer and mixed at 1:1 ratio, to prepare for loading. For example, one can take the 1:10 dilution milk (0.5 µL-1 µL) and add into 9.5 µL or 9 µL PBS and mix with 10 µL SDS-PAGE Sample buffer, boil for 5 minutes, quick spin, and load on the gel. Recommended blocking buffer: TBS with 5% BSA. Recommended antibody dilution buffer: TBST containing 3% BSA. Biosensis recommends that optimal working dilutions should be determined by the end user.
Accession Number:
P02666 (CASB_BOVIN)
Storage:
Maintain unopened vial at -20°C for up to 12 months after date of receipt. After opening maintain at -20°C in undiluted aliquots for up to 6 months. For short-term storage, keep aliquot at 2-8°C for up to one week. Avoid repeated freeze-thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
The antibody is specific to A2 beta casein by western blot. No cross-reactivity with A1 beta casein is seen. Species cross-reactivity not tested.
Chicken anti-Mitochondrial uncoupling protein 3 (UCP 3) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Uncoupling Protein 3 (UCP3) belongs to the mitochondrial carrier family. Located in the mitochondrion inner membrane, UCP3 creates proton leaks across the membrane thus uncoupling oxidative phosphorylation (Ref: SWISSPROT).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Species Reactivity:
Human,Mouse,Pig,Rat
Immunogen:
A peptide from the C-terminus of human Uncoupling Protein 3 (298-312 aa).
Applications:
WB
Antibody Isotype:
IgY
Application Details:
WB. Suggested dilution at 1:1,000 to 1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
UCP3; Mitochondrial uncoupling protein 3; UCP 3; Solute carrier family 25 member 9; SLC25A9;
Accession Number:
P55916 (UCP3_HUMAN)
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
This antibody detects UCP3 at approx 35 kDa. Human, Mouse, Rat, Porcine
Chicken anti-C-reactive protein (CRP) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
C-reactive protein has several roles associated with host defence such as; promoting agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. COFACTOR: Binds 2 calcium ions per subunit. C-reactive protein exists as a homopentamer. There are 2 alternatively spliced isoforms. C-reactive protein is found in plasma and its concentration increases greatly during acute phase response to tissue injury, infection or other inflammatory stimuli. It is induced by IL-1 and IL-6.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Species Reactivity:
Rat
Immunogen:
A peptide from rat C-reactive protein (108-121 aa).
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
WB and ELISA. Suggested dilution of 1:2,000-1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
CRP; PTX1;
Accession Number:
P48199 (CRP_RAT)
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Chicken anti-Obestatin Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
Obestatin is generated from the proteolytic cleavage of Ghrelin.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Species Reactivity:
Mouse,Rat
Immunogen:
Obestatin peptide (76-98 aa) from mouse ghrelin precursor.
Applications:
ELISA
Antibody Isotype:
IgY
Application Details:
ELISA . Suggested dilution at 1:500 to 1:2,000 in coating buffer as coating antibody in competitive ELISA testing. Biosensis recommends that the optimal working dilution should be determined by the end user.
Beta-adrenergic receptors are multi-pass membrane proteins that belong to the G-protein coupled receptor 1 family. Their function is to mediate the catecholamine-induced activation of adenylate cyclase through the action of G-proteins (ref: SWISSPROT).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Species Reactivity:
Mouse,Rat
Immunogen:
A synthetic peptide from mouse beta 3 Adrenergic Receptor (386-400 aa).
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
WB and ELISA. Suggested dilution of 1:2,000-1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
CNTF is a survival promoting factor for different types of neurons in vitro and in vivo. The essential structural features for the biological function of human CNTF were investigated by Thier, M. et al. They showed that deletion of 14 N-terminal and 18 C-terminal amino acids significantly increased bioactivity compared to wild-type CNTF. FUNCTION: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. TISSUE SPECIFICITY: Nervous system. PHARMACEUTICAL: CNTF is being tested under the name Axokine by Regeneron Pharmaceuticals for treatment of human motor neuron diseases, such as amyotrophic lateral sclerosis (ALS). As it induces substantial weight loss, preferentially of fat as opposed to lean body mass, it is being used for obesity treatment. SIMILARITY: Belongs to the CNTF family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Mixture of two peptides from human CNTF (11-25 and 186-200 aa). Both peptides are highly conserved among human and mouse.
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
WB and ELISA at a suggested dilution of 1:500 to 1:2,000. A titration between 1:50 to 1:500 is suggested for IHC. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Ciliary neurotrophic factor; CNTF;
Accession Number:
P26441 (CNTF_HUMAN)
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
CNTF, Cross reactivity to other species is expected
Chicken anti-Adiponectin Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Adiponectin is synthesized by adipocytes and is involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities (ref: SWISSPROT).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide from human Adiponectin (230-244 aa).
Applications:
WB
Antibody Isotype:
IgY
Application Details:
WB. Suggested dilution of 1:2,000-1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Chicken anti-Hormone-sensitive lipase (HSL) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Hormone Sensitive Lipase (HSL) hydrolyzes stored triglycerides to free fatty acids in adipose tissue and heart. In steroidogenic tissues, HSL principally converts cholesteryl esters to free cholesterol for steroid hormone production (ref: SWISSPROT).
WB. Suggested dilution at 1:1,000 to 1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
HSL; LIPE; Hormone-sensitive lipase; Lipe;
Accession Number:
P54310 (LIPS_MOUSE)
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
This antibody detects HSL at approx 83 kDa in various fat cell lysates from mouse and rat. Additional weaker band may appear at approx 40 kDa (unknown). Mouse, Rat, Human
Chicken anti-Hormone-sensitive lipase (HSL) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Hormone Sensitive Lipase (HSL) hydrolyzes stored triglycerides to free fatty acids in adipose tissue and heart. In steroidogenic tissues, HSL principally converts cholesteryl esters to free cholesterol for steroid hormone production (ref: SWISSPROT).
Chicken anti-Leptin Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Leptin is secreted by white adipocytes and functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. Leptin also has several endocrine functions and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing (Ref: Entrez Gene) .
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Species Reactivity:
Mouse,Rat
Immunogen:
Recombinant rat Leptin protein
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
ELISA and WB. Suggested dilution of 1:1,000-1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Leptin; Obesity factor; Lep; Ob; Obese protein;
Accession Number:
P50596 (LEP_RAT)
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Chicken anti-C-reactive protein (CRP) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
C-reactive protein has several roles associated with host defence such as; promoting agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. COFACTOR: Binds 2 calcium ions per subunit. C-reactive protein exists as a homopentamer. There are 2 alternatively spliced isoforms. C-reactive protein is found in plasma and its concentration increases greatly during acute phase response to tissue injury, infection or other inflammatory stimuli. It is induced by IL-1 and IL-6.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Species Reactivity:
Mouse
Immunogen:
A peptide from the C-terminus of mouse C-reactive protein (210-225 aa).
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
ELISA and WB. Suggested dilution of 1:2,000-1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
CRP; PTX1;
Accession Number:
P14847 (CRP_MOUSE)
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Chicken anti-Leptin Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Leptin is secreted by white adipocytes and functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. Leptin also has several endocrine functions and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing (Ref: Entrez Gene).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Species Reactivity:
Human
Immunogen:
Recombinant human Leptin protein
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
ELISA and WB. Suggested dilution of 1:1,000-1:2,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Leptin; Obesity factor; Lep; Ob; Obese protein;
Accession Number:
P41159 (LEP_HUMAN)
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Chicken anti-C-reactive protein (CRP) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
C-reactive protein has several roles associated with host defence such as; promoting agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. COFACTOR: Binds 2 calcium ions per subunit. C-reactive protein exists as a homopentamer. There are 2 alternatively spliced isoforms. C-reactive protein is found in plasma and its concentration increases greatly during acute phase response to tissue injury, infection or other inflammatory stimuli. It is induced by IL-1 and IL-6.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Species Reactivity:
Human
Immunogen:
Purified human C-reactive protein
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
ELISA and WB. Suggested dilution of 1:2,000-1:5,000. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
CRP; PTX1;
Accession Number:
P02741 (CRP_HUMAN)
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-C-reactive protein (CRP) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
C-reactive protein has several roles associated with host defence such as; promoting agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. COFACTOR: Binds 2 calcium ions per subunit. C-reactive protein exists as a homopentamer. There are 2 alternatively spliced isoforms. C-reactive protein is found in plasma and its concentration increases greatly during acute phase response to tissue injury, infection or other inflammatory stimuli. It is induced by IL-1 and IL-6.
A synthetic peptide corresponding to a region (209-224 aa) from human C-reactive protein. To enhance the immunological response, this peptide was coupled to carrier protein BSA.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB). A concentration of 1.0 µg/mL is recommended for WB. Human C-reactive protein (isoform 1) has a predicted length of 224 residues and MW of 25 kDa. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
CRP; PTX1;
Accession Number:
P02741 (CRP_HUMAN)
Reconstitution:
Reconstitute in 100 µL of sterile distilled water to achieve an antibody concentration of 1 mg/mL. Centrifuge to remove any insoluble material.
Storage:
After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
The specificity of this antibody has been confirmed by WB against the antigen. Human;
Rabbit anti-Orexin-A Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
FUNCTION: Neuropeptides that play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested. Orexin-A binds to both OX1R and OX2R with a high affinity, whereas orexin-B binds only to OX2R with a similar high affinity. SUBCELLULAR LOCATION: Endoplasmic reticulum; rough endoplasmic reticulum. Associated with perikaryal rough endoplasmic reticulum as well as cytoplasmic large granular vesicles at synapses. SIMILARITY: Belongs to the orexin family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Bovine,Rat
Immunogen:
A synthetic peptide (CRLYELLHGAGNHAAGILTL) as part of Bovine Orexin A (aa: 14-33) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. This is a superb antiserum for immunohistochemistry on Orexin A containing neurons exhibiting intense labelling of neurons with very low back ground. A dilution of 1:1000 to 1:2000 is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Orexin-A; Hypocretin-1; Hcrt1
Accession Number:
P56717 (OREX_BOVIN)
Reconstitution:
Reconstitute in 100 µL of sterile water. Centrifuge to remove any insoluble material.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
The specificity for this antiserum has been confirmed by immunohistochemistry on rat brain and the results reflect the current literature. This antibody is known to react with rat Orexin A.
References:
Kruger J.L. et al (2010) Cellular location and major terminal networks of the orexinergic system in the brains of five microchiropteran species. J Chem Neuroanat. 2010 Nov;40(3):256-62.Gaykema R.P. et al (2009) Lipopolysaccharide challenge-induced suppression of Fos in hypothalamic orexin neurons: their potential role in sickness behavior.Brain Behav Immun. 2009 Oct;23(7):926-30.Lee H.S. et al (2005) Retrograde study of hypocretin-1 (orexin-A) projections to subdivisions of the dorsal raphe nucleus in the rat. Brain Res. 2005 Oct 12;1059(1):35-45.Yao S.T. et al (2005) Water deprivation increases the expression of neuronal nitric oxide synthase (nNOS) but not orexin-A in the lateral hypothalamic area of the rat. J Comp Neurol. 2005 Sep 19;490(2):180-93.
Mouse anti-Tyrosine Kinase Receptor B (TrkB) Monoclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Tyrosine kinase receptor type B (TrkB) is a member of the neurotrophic tyrosine receptor kinase family. It is a membrane-bound receptor and upon neurotrophin binding, it phosphorylates itself as well as MAPK pathways members. TrkB is the receptor for brain-derived neurotrophic factor (BDNF), neurotrophin-3 and neurotrophin-4/5, but not nerve growth factor (NGF). It is involved in the development and/or maintenance of the nervous system. It exists in a dynamic equilibrium between monomeric (low affinity) and dimeric (high affinity) structures. It is a tran-membrane protein. There are 3 named isoforms produced by alternative splicing. Additional isoforms seem to exist. The different forms are differentially expressed in various cell types including neurons and microglia.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS pH 7.2
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant protein of human Tyrosine kinase receptor type B (isoform TrkB-T1) with a GST tag.
Applications:
ELISA,WB
Clone number:
4D3-F10
Antibody Isotype:
IgG2a, kappa
Application Details:
This antibody is recommended for WB, sandwich ELISA and Flow Cytometry. Use 2 ?g/10^6 cells for Flow Cytometry. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Reconstitute in 100 µL of sterile water. Centrifuge to remove any insoluble material.
Storage:
After reconstitution keep aliquots at -20°C for higher stability or at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
Specificity has been confirmed by WB and direct ELISA against the antigen. Human. Other species have not been tested.
Mouse anti-Neuropeptide Y Monoclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Neuropeptide Y is a 36 amino acid neurotransmitter found in the brain and autonomic nervous system. It has been associated with numerous physiologic processes in the brain, including the regulation of energy balance, memory and learning, and epilepsy. The main effect is increased food intake and decreased physical activity. It is also implicated in the secretion of gonadotrophin-release hormone. It is secreted by the hypothalamus and it is one of the most abundant peptides in the nervous system. It is also found in some chromaffin cells of the adrenal medulla.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS pH 7.4
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Partial recombinant human Neuropeptide Y (29-97: NB. Includes both the NPY peptide and the C-flanking peptide of NPY) with a GST tag.
Applications:
ELISA,WB
Clone number:
3B5
Antibody Isotype:
IgG
Application Details:
This antibody is recommended for WB and sandwich ELISA. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
NPY
Accession Number:
P01303 (NPY_HUMAN)
Reconstitution:
Reconstitute in 100 µL of sterile water. Centrifuge to remove any insoluble material.
Storage:
Store lyophilized antibody at 2-8ºC. After reconstitution keep aliquots at -20°C for higher stability or at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
Specificity has been confirmed by WB and direct ELISA against the antigen. Human. Other species have not been tested.
NeuroD1 is a differentiation factor required for dendrite morphogenesis and maintenance in the cerebellar cortex. It is a transcriptional activator and binds to the insulin gene E-box. Efficient DNA binding requires dimerisation with another basic helix-loop-helix protein. In islet cells, NeuroD1 is phosphoryated on Ser-274 upon glucose stimulation and in activated neurons it is phosphorylated on Ser-335, which promotes dendritic growth. Defects in NeuroD1 cause maturity onset diabetes of the young type 6 (MODY6). It is characterised by the onset of diabetes during young adulthood and a primary defect in insulin secretion.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS pH 7.2
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Partial recombinant human NeuroD1 (201-300) with a GST tag.
Applications:
ELISA,IHC-Frozen,WB
Clone number:
3H8
Antibody Isotype:
IgG2a
Application Details:
This antibody is recommended for WB, IHC, sandwich ELISA, immunofluorescence, Flow Cytometry. The recommended dilution for this antibody is 3 µg/mL for IHC and 10 µg/mL for immunofluorescence. Use ~2 ug per 10^6 cells for Flow Cytometry. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Reconstitute in 100 µL of sterile water. Centrifuge to remove any insoluble material.
Storage:
After reconstitution keep aliquots at -20°C for higher stability or at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
Specificity has been confirmed by WB and direct ELISA against the antigen. Human. Other species have not been tested.
Interleukin 6 (IL-6) is a cytokine with many biological functions. Some of its roles include the final differentiation of B-cells into Ig-secreting cells, induction of meloma and plasmacytoma growth, induction of nerve cell differentiation, and in hepatocytes, induction of acute phase reactants. IL-6 is secreted and is N- and O-glycosylated post translationally. Genetic variations in IL-6 can be correlated with bone mineral density and low bone mineral density is a risk factor for osteoporosis. Defects in IL-6 are associated with juvenile rheumatoid arthritis and at least one polymorphism in IL-6 makes HIV-infected men susceptible to Kaposi sarcoma which is a relatively rare malignant tumour.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS pH 7.2
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Recombinant human IL-6 protein with GST tag.
Applications:
ELISA,WB
Clone number:
3.00E+04
Antibody Isotype:
IgG
Application Details:
This antibody is recommended for WB and ELISA. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Reconstitute in 100 µL of sterile water. Centrifuge to remove any insoluble material.
Storage:
After reconstitution keep aliquots at -20°C for higher stability or at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
Specificity has been confirmed by WB and direct ELISA against the antigen. Human. Other species have not been tested.
Mouse anti-Orexin receptor type 2 (Ox-2-R) Monoclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Orexin receptor type 2 is a nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides. It is involved in the central feedback mechanism that regulates feeding behaviour. It is a transmembrane protein and belongs to the G-protein coupled receptor 1 family.
Product Type:
Antibody
Antibody Type:
Monoclonal
Format:
Lyophilized from PBS pH 7.2
Host Animal:
Mouse
Species Reactivity:
Human
Immunogen:
Partial recombinant protein of human Orexin receptor type 2 (aa 1 to 55) with a GST tag.
Applications:
ELISA,WB
Clone number:
1.00E+03
Antibody Isotype:
IgG
Application Details:
This antibody is recommended for WB, and sandwich ELISA. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Ox2r; Hypocretin receptor type 2; HCRTR2
Accession Number:
O43614 (OX2R_HUMAN)
Reconstitution:
Reconstitute in 100 µL of sterile water. Centrifuge to remove any insoluble material.
Storage:
After reconstitution keep aliquots at -20°C for higher stability or at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
Specificity has been confirmed by WB and direct ELISA against the antigen. Human. Other species have not been tested.
Glucose transporter 1 (GLUT1) is a multi-pass membrane protein. It is a member of the family of glucose transporters that facilitate glucose uptake by cells. GLUT1 is a major transporter at the mammalian blood-brain barrier.
A synthetic peptide (FYNQTWVHRYGESI) corresponding to a region (43-56) from the N-terminus of human Glucose transporter 1 (GLUT1).
Applications:
IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC) and Western Blotting (WB). A concentration of 1.0-2.0 µg/mL is recommended for WB. Human GLUT1 has a predicted length of 492 residues and MW of 55 kDa. A concentration of 1.0-2.0 µg/mL is recommended to detect GLUT1 in formalin fixed and paraffin embedded tissues. Antigen retrieval is required. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
SLC2A1; GLUT-1;
Accession Number:
P11166 (GTR1_HUMAN)
Reconstitution:
Reconstitute in 100 µL of sterile distilled water to achieve an antibody concentration of 1 µg/µL. Centrifuge to remove any insoluble material.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability.Avoid freeze-thaw cycles
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
The specificity of this antibody has been confirmed by WB and IHC against the antigen. Human; mouse; rat;
CNTF is a survival promoting factor for different types of neurons in vitro and in vivo. The essential structural features for the biological function of human CNTF were investigated by Thier, M. et al. They showed that deletion of 14 N-terminal and 18 C-terminal amino acids significantly increased bioactivity compared to wild-type CNTF. FUNCTION: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. TISSUE SPECIFICITY: Nervous system. PHARMACEUTICAL: CNTF is being tested under the name Axokine by Regeneron Pharmaceuticals for treatment of human motor neuron diseases, such as amyotrophic lateral sclerosis (ALS). As it induces substantial weight loss, preferentially of fat as opposed to lean body mass, it is being used for obesity treatment. SIMILARITY: Belongs to the CNTF family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human CNTF
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. A dilution of 1:500 to 1: 4000 is recommended for western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Ciliary neurotrophic factor
Accession Number:
P26441 (CNTF_HUMAN)
Reconstitution:
Reconstitute in 100 µL of sterile water. Centrifuge to remove any insoluble material.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Shelf Life:
12 months after date of receipt (unopened vial).
Specificity:
This antibody specifically detects CNTF shown by western blot. This antiserum to known to react with rat, mouse and human CNTF protein.
X
We use cookies to help personalise and improve your web experience.
By using our website you consent to our use of cookies, some of which may have already been set on your device.
View our Cookie Policy to learn more.
